Fandom

Proteins Wiki

At2g07750.1/PDB

< At2g07750.1

47,922pages on
this wiki
Add New Page
Talk0 Share
&&&&&&&&&&&&&&&&&&&& BEGIN  /usr/local/www/html/proteins/Compiled_Programs/WYRM/PyMOL_highlight_conserved_residues &&&&&&&&&&&&&&&&&&&&

Successfully read 2 file paths from WYRM_file_paths.txt

generic_input                                         /usr/local/www/html/proteins/workspace/
generic_output                                        /usr/local/www/html/proteins/htdocs/results/

======================================================

Sequence file type = 3

Sequence type = 3

Got here 1
Got here 2
Got here 3
Sequence 1
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Sequence 2
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Read 2 amino_acid sequences from PIR Sequence file /usr/local/www/html/proteins/workspace/At2g07750-2db3_A.pir.txt

======================================================

Assigned types to 845 residues in Sequence 2-07750, 5 remain unknown
Assigned types to 419 residues in Sequence 2db3_A, 431 remain unknown

======================================================

Successfully read 576 entries for residue match scoring matrix /usr/local/www/html/proteins/workspace/BLOSUM62.dat

Read the residue match scoring matrix /usr/local/www/html/proteins/workspace/BLOSUM62.dat

======================================================

Error in function WYRM_analyze_conservation_in_sequence_alignment()
Path index 359  All residues are positively and negatively charged

Error in function WYRM_analyze_conservation_in_sequence_alignment()
Path index 360  All residues are positively and negatively charged

Error in function WYRM_analyze_conservation_in_sequence_alignment()
Path index 563  All residues are positively and negatively charged

Error in function WYRM_analyze_conservation_in_sequence_alignment()
Path index 564  All residues are positively and negatively charged

Error in function WYRM_analyze_conservation_in_sequence_alignment()
Path index 747  All residues are positively and negatively charged

Translated sequence file At2g07750-2db3_A.pir.txt into sequence alignment.

======================================================

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

>2DB3.pdb  Made from 13672 ATOM records in 2DB3.pdb
YIPPEPSNDAIEIFSSGIASGIHFSKYNNIPVKVTGSDVPQPIQHFTSAD
LRDIIIDNVNKSGYKIPTPIQKCSIPVISSGRDLMACAQTGSGKTAAFLL
PILSKLLEDPHELELGRPQVVIVSPTRELAIQIFNEARKFAFESYLKIGI
VYGGTSFRHQNECITRGCHVVIATPGRLLDFVDRTFITFEDTRFVVLDEA
DRMLDMGFSEDMRRIMTHVTMRPEHQTLMFSATFPEEIQRMAGEFLKNYV
FVAIGIVGGACSDVKQTIYEVNKYAKRSKLIEILSEQADGTIVFVETKRG
ADFLASFLSEKEFPTTSIHGDRLQSQREQALRDFKNGSMKVLIATSVASR
GLDIKNIKHVINYDMPSKIDDYVHRIGRTGRVGNNGRATSFFDPEKDRAI
AADLVKILEGSGQTVPDFLRYIPPEPSNDAIEIFSSGIASGIHFSKYNNI
PVKVTGSDVPQPIQHFTSADLRDIIIDNVNKSGYKIPTPIQKCSIPVISS
GRDLMACAQTGSGKTAAFLLPILSKLLEDPHELELGRPQVVIVSPTRELA
IQIFNEARKFAFESYLKIGIVYGGTSFRHQNECITRGCHVVIATPGRLLD
FVDRTFITFEDTRFVVLDEADRMLDMGFSEDMRRIMTHVTMRPEHQTLMF
SATFPEEIQRMAGEFLKNYVFVAIGIVGGACSDVKQTIYEVNKYAKRSKL
IEILSEQADGTIVFVETKRGADFLASFLSEKEFPTTSIHGDRLQSQREQA
LRDFKNGSMKVLIATSVASRGLDIKNIKHVINYDMPSKIDDYVHRIGRTG
RVGNNGRATSFFDPEKDRAIAADLVKILEGSGQTVPDFLRYIPPEPSNDA
IEIFSSGIASGIHFSKYNNIPVKVTGSDVPQPIQHFTSADLRDIIIDNVN
KSGYKIPTPIQKCSIPVISSGRDLMACAQTGSGKTAAFLLPILSKLLEDP
HELELGRPQVVIVSPTRELAIQIFNEARKFAFESYLKIGIVYGGTSFRHQ
NECITRGCHVVIATPGRLLDFVDRTFITFEDTRFVVLDEADRMLDMGFSE
DMRRIMTHVTMRPEHQTLMFSATFPEEIQRMAGEFLKNYVFVAIGIVGGA
CSDVKQTIYEVNKYAKRSKLIEILSEQADGTIVFVETKRGADFLASFLSE
KEFPTTSIHGDRLQSQREQALRDFKNGSMKVLIATSVASRGLDIKNIKHV
INYDMPSKIDDYVHRIGRTGRVGNNGRATSFFDPEKDRAIAADLVKILEG
SGQTVPDFLRYIPPEPSNDAIEIFSSGIASGIHFSKYNNIPVKVTGSDVP
QPIQHFTSADLRDIIIDNVNKSGYKIPTPIQKCSIPVISSGRDLMACAQT
GSGKTAAFLLPILSKLLEDPHELELGRPQVVIVSPTRELAIQIFNEARKF
AFESYLKIGIVYGGTSFRHQNECITRGCHVVIATPGRLLDFVDRTFITFE
DTRFVVLDEADRMLDMGFSEDMRRIMTHVTMRPEHQTLMFSATFPEEIQR
MAGEFLKNYVFVAIGIVGGACSDVKQTIYEVNKYAKRSKLIEILSEQADG
TIVFVETKRGADFLASFLSEKEFPTTSIHGDRLQSQREQALRDFKNGSMK
VLIATSVASRGLDIKNIKHVINYDMPSKIDDYVHRIGRTGRVGNNGRATS
FFDPEKDRAIAADLVKILEGSGQTVPDFLRXXXXXXXXXXXXXXXXXXXX
XXXXXXX

======================================================

Best alignment:
2DB3.pdb    44  QHFTSADLRDIIIDNVNKSGYKIPTPIQKCSIPVISSGRDLMACAQTGSG    93
                + F  + +  + +  ++ SG    T +Q  ++     G+D +  A+TG+G
2-07750    375  KRFDESCISPLTLKALSASGIVKMTRVQDATLSECLDGKDALVKAKTGTG   424

2DB3.pdb    94  KTAAFLLPILSKLLE---DPHELELGRP-QVVIVSPTRELAIQIFNEARK   139
                K+ AFLLP +  +L+       +    P  V+I+ PTRELA QI  E  K
2-07750    425  KSMAFLLPAIETVLKAMNSGKGVHKVAPIFVLILCPTRELASQIAAEG-K   473

2DB3.pdb   140  FAFESYLKIGI--VYGGTSFR-HQNECITRGCHVVIATPGRLLDFVD-RT   185
                   +++  IG+  + GGT FR  Q    +  C ++IATPGRLLD ++ ++
2-07750    474  ALLKNHDGIGVQTLIGGTRFRLDQQRLESEPCQILIATPGRLLDHIENKS   523

2DB3.pdb   186  FIT--FEDTRFVVLDEADRMLDMGFSEDMRRIMTHVTMRPEHQTLMFSAT   233
                 +T      +  ++DEAD +LD+GF  D+ +I+    +  + Q+L+FSAT
2-07750    524  GLTSRLMALKLFIVDEADLLLDLGFKRDVEKII--DCLPRQRQSLLFSAT   571

2DB3.pdb   234  FPEEIQRMAGEFLK-NYVFV-AIGIVGGACSD-VKQT----IYEVNKYAK   276
                 P+E++R++   LK ++ ++  IG+      D VKQ+     +E + +  
2-07750    572  IPKEVRRVSQLVLKRDHSYIDTIGLGCVETHDKVKQSCIVAPHESHFHLV   621

2DB3.pdb   277  RSKLIEILSEQAD-GTIVFVETKRGADFLASFLSEKEFPTTSIHGDRLQS   325
                   L E ++   D   IVF  T      + + L E +     IH  + Q 
2-07750    622  PHLLKEHINNMPDYKIIVFCSTGMVTSLMYTLLREMKLNVREIHARKPQL   671

2DB3.pdb   326  QREQALRDFKNGSMKVLIATSVASRGLDIKNIKHVINYDMPSKIDDYVHR   375
                 R     +FK  +  +L+ + V++RG++  ++  VI   +PS  + Y+HR
2-07750    672  HRTCVSDEFKESNRLILVTSDVSARGMNYPDVTLVIQVGIPSDREQYIHR   721

2DB3.pdb   376  IGRTGRVGNNGRATSFFDP   394
                +GRTGR G  G+      P
2-07750    722  LGRTGREGKGGKGLLLIAP   740

======================================================

Highlighted IDENTICAL residue PHE  247  index1   46  path  379  %Seq 100.00
Highlighted IDENTICAL residue SER  263  index1   62  path  395  %Seq 100.00
Highlighted IDENTICAL residue GLY  264  index1   63  path  396  %Seq 100.00
Highlighted IDENTICAL residue THR  269  index1   68  path  401  %Seq 100.00
Highlighted IDENTICAL residue GLN  272  index1   71  path  404  %Seq 100.00
Highlighted IDENTICAL residue GLY  282  index1   81  path  414  %Seq 100.00
Highlighted IDENTICAL residue ASP  284  index1   83  path  416  %Seq 100.00
Highlighted IDENTICAL residue ALA  289  index1   88  path  421  %Seq 100.00
Highlighted IDENTICAL residue THR  291  index1   90  path  423  %Seq 100.00
Highlighted IDENTICAL residue GLY  292  index1   91  path  424  %Seq 100.00
Highlighted IDENTICAL residue GLY  294  index1   93  path  426  %Seq 100.00
Highlighted IDENTICAL residue LYS  295  index1   94  path  427  %Seq 100.00
Highlighted IDENTICAL residue ALA  298  index1   97  path  430  %Seq 100.00
Highlighted IDENTICAL residue PHE  299  index1   98  path  431  %Seq 100.00
Highlighted IDENTICAL residue LEU  300  index1   99  path  432  %Seq 100.00
Highlighted IDENTICAL residue LEU  301  index1  100  path  433  %Seq 100.00
Highlighted IDENTICAL residue PRO  302  index1  101  path  434  %Seq 100.00
Highlighted IDENTICAL residue LEU  308  index1  107  path  440  %Seq 100.00
Highlighted IDENTICAL residue PRO  311  index1  110  path  446  %Seq  50.00
Highlighted IDENTICAL residue HIS  312  index1  111  path  447  %Seq  50.00
Highlighted IDENTICAL residue GLU  313  index1  112  path  448  %Seq  50.00
Highlighted IDENTICAL residue LEU  314  index1  113  path  449  %Seq  50.00
Highlighted IDENTICAL residue VAL  321  index1  120  path  457  %Seq 100.00
Highlighted IDENTICAL residue ILE  323  index1  122  path  459  %Seq 100.00
Highlighted IDENTICAL residue PRO  326  index1  125  path  462  %Seq 100.00
Highlighted IDENTICAL residue THR  327  index1  126  path  463  %Seq 100.00
Highlighted IDENTICAL residue ARG  328  index1  127  path  464  %Seq 100.00
Highlighted IDENTICAL residue GLU  329  index1  128  path  465  %Seq 100.00
Highlighted IDENTICAL residue LEU  330  index1  129  path  466  %Seq 100.00
Highlighted IDENTICAL residue ALA  331  index1  130  path  467  %Seq 100.00
Highlighted IDENTICAL residue GLN  333  index1  132  path  469  %Seq 100.00
Highlighted IDENTICAL residue ILE  334  index1  133  path  470  %Seq 100.00
Highlighted IDENTICAL residue GLU  337  index1  136  path  473  %Seq 100.00
Highlighted IDENTICAL residue TYR  346  index1  145  path  481  %Seq  50.00
Highlighted IDENTICAL residue GLY  354  index1  153  path  491  %Seq 100.00
Highlighted IDENTICAL residue GLY  355  index1  154  path  492  %Seq 100.00
Highlighted IDENTICAL residue THR  356  index1  155  path  493  %Seq 100.00
Highlighted IDENTICAL residue PHE  358  index1  157  path  495  %Seq 100.00
Highlighted IDENTICAL residue ARG  359  index1  158  path  496  %Seq 100.00
Highlighted IDENTICAL residue ILE  365  index1  164  path  503  %Seq  50.00
Highlighted IDENTICAL residue CYS  369  index1  168  path  507  %Seq 100.00
Highlighted IDENTICAL residue ILE  373  index1  172  path  511  %Seq 100.00
Highlighted IDENTICAL residue ALA  374  index1  173  path  512  %Seq 100.00
Highlighted IDENTICAL residue THR  375  index1  174  path  513  %Seq 100.00
Highlighted IDENTICAL residue PRO  376  index1  175  path  514  %Seq 100.00
Highlighted IDENTICAL residue GLY  377  index1  176  path  515  %Seq 100.00
Highlighted IDENTICAL residue ARG  378  index1  177  path  516  %Seq 100.00
Highlighted IDENTICAL residue LEU  379  index1  178  path  517  %Seq 100.00
Highlighted IDENTICAL residue LEU  380  index1  179  path  518  %Seq 100.00
Highlighted IDENTICAL residue ASP  381  index1  180  path  519  %Seq 100.00
Highlighted IDENTICAL residue PHE  387  index1  186  path  526  %Seq  50.00
Highlighted IDENTICAL residue ILE  388  index1  187  path  527  %Seq  50.00
Highlighted IDENTICAL residue THR  389  index1  188  path  528  %Seq  50.00
Highlighted IDENTICAL residue ASP  399  index1  198  path  540  %Seq 100.00
Highlighted IDENTICAL residue GLU  400  index1  199  path  541  %Seq 100.00
Highlighted IDENTICAL residue ALA  401  index1  200  path  542  %Seq 100.00
Highlighted IDENTICAL residue ASP  402  index1  201  path  543  %Seq 100.00
Highlighted IDENTICAL residue LEU  405  index1  204  path  546  %Seq 100.00
Highlighted IDENTICAL residue ASP  406  index1  205  path  547  %Seq 100.00
Highlighted IDENTICAL residue GLY  408  index1  207  path  549  %Seq 100.00
Highlighted IDENTICAL residue PHE  409  index1  208  path  550  %Seq 100.00
Highlighted IDENTICAL residue ASP  412  index1  211  path  553  %Seq 100.00
Highlighted IDENTICAL residue ILE  416  index1  215  path  557  %Seq 100.00
Highlighted IDENTICAL residue GLN  427  index1  226  path  568  %Seq 100.00
Highlighted IDENTICAL residue LEU  429  index1  228  path  570  %Seq 100.00
Highlighted IDENTICAL residue PHE  431  index1  230  path  572  %Seq 100.00
Highlighted IDENTICAL residue SER  432  index1  231  path  573  %Seq 100.00
Highlighted IDENTICAL residue ALA  433  index1  232  path  574  %Seq 100.00
Highlighted IDENTICAL residue THR  434  index1  233  path  575  %Seq 100.00
Highlighted IDENTICAL residue PRO  436  index1  235  path  577  %Seq 100.00
Highlighted IDENTICAL residue GLU  438  index1  237  path  579  %Seq 100.00
Highlighted IDENTICAL residue ARG  441  index1  240  path  582  %Seq 100.00
Highlighted IDENTICAL residue LEU  447  index1  246  path  588  %Seq 100.00
Highlighted IDENTICAL residue LYS  448  index1  247  path  589  %Seq 100.00
Highlighted IDENTICAL residue TYR  450  index1  249  path  592  %Seq  50.00
Highlighted IDENTICAL residue VAL  451  index1  250  path  593  %Seq  50.00
Highlighted IDENTICAL residue PHE  452  index1  251  path  594  %Seq  50.00
Highlighted IDENTICAL residue VAL  465  index1  264  path  609  %Seq 100.00
Highlighted IDENTICAL residue LYS  466  index1  265  path  610  %Seq 100.00
Highlighted IDENTICAL residue GLN  467  index1  266  path  611  %Seq 100.00
Highlighted IDENTICAL residue LEU  481  index1  280  path  629  %Seq 100.00
Highlighted IDENTICAL residue GLU  483  index1  282  path  631  %Seq 100.00
Highlighted IDENTICAL residue ILE  484  index1  283  path  632  %Seq  50.00
Highlighted IDENTICAL residue LEU  485  index1  284  path  633  %Seq  50.00
Highlighted IDENTICAL residue SER  486  index1  285  path  634  %Seq  50.00
Highlighted IDENTICAL residue GLU  487  index1  286  path  635  %Seq  50.00
Highlighted IDENTICAL residue GLN  488  index1  287  path  636  %Seq  50.00
Highlighted IDENTICAL residue ILE  493  index1  292  path  642  %Seq 100.00
Highlighted IDENTICAL residue VAL  494  index1  293  path  643  %Seq 100.00
Highlighted IDENTICAL residue PHE  495  index1  294  path  644  %Seq 100.00
Highlighted IDENTICAL residue THR  498  index1  297  path  647  %Seq 100.00
Highlighted IDENTICAL residue LEU  509  index1  308  path  658  %Seq 100.00
Highlighted IDENTICAL residue GLU  511  index1  310  path  660  %Seq 100.00
Highlighted IDENTICAL residue ILE  519  index1  318  path  668  %Seq 100.00
Highlighted IDENTICAL residue HIS  520  index1  319  path  669  %Seq 100.00
Highlighted IDENTICAL residue GLN  525  index1  324  path  674  %Seq 100.00
Highlighted IDENTICAL residue ARG  528  index1  327  path  677  %Seq 100.00
Highlighted IDENTICAL residue PHE  535  index1  334  path  684  %Seq 100.00
Highlighted IDENTICAL residue LYS  536  index1  335  path  685  %Seq 100.00
Highlighted IDENTICAL residue LEU  543  index1  342  path  692  %Seq 100.00
Highlighted IDENTICAL residue VAL  548  index1  347  path  697  %Seq 100.00
Highlighted IDENTICAL residue ARG  551  index1  350  path  700  %Seq 100.00
Highlighted IDENTICAL residue GLY  552  index1  351  path  701  %Seq 100.00
Highlighted IDENTICAL residue VAL  561  index1  360  path  710  %Seq 100.00
Highlighted IDENTICAL residue ILE  562  index1  361  path  711  %Seq 100.00
Highlighted IDENTICAL residue PRO  567  index1  366  path  716  %Seq 100.00
Highlighted IDENTICAL residue SER  568  index1  367  path  717  %Seq 100.00
Highlighted IDENTICAL residue TYR  573  index1  372  path  722  %Seq 100.00
Highlighted IDENTICAL residue HIS  575  index1  374  path  724  %Seq 100.00
Highlighted IDENTICAL residue ARG  576  index1  375  path  725  %Seq 100.00
Highlighted IDENTICAL residue GLY  578  index1  377  path  727  %Seq 100.00
Highlighted IDENTICAL residue ARG  579  index1  378  path  728  %Seq 100.00
Highlighted IDENTICAL residue THR  580  index1  379  path  729  %Seq 100.00
Highlighted IDENTICAL residue GLY  581  index1  380  path  730  %Seq 100.00
Highlighted IDENTICAL residue ARG  582  index1  381  path  731  %Seq 100.00
Highlighted IDENTICAL residue GLY  584  index1  383  path  733  %Seq 100.00
Highlighted IDENTICAL residue GLY  587  index1  386  path  736  %Seq 100.00
Highlighted IDENTICAL residue PRO  595  index1  394  path  744  %Seq 100.00
Highlighted 118 residues for visualization

Wrote PyMOL macro into file /usr/local/www/html/proteins/htdocs/results/At2g07750-2db3_A.pir.txt.2DB3.pdb.conservation.pml

===============================================================================

The program

/usr/local/www/html/proteins/Compiled_Programs/WYRM/PyMOL_highlight_conserved_residues At2g07750-2db3_A.pir.txt PIR amino_acid 2DB3.pdb _ 100.0 BLOSUM62.dat 

completed successfully.

@@@@@@@@@@@@@@@@@@@@ END  /usr/local/www/html/proteins/Compiled_Programs/WYRM/PyMOL_highlight_conserved_residues @@@@@@@@@@@@@@@@@@@@

Ad blocker interference detected!


Wikia is a free-to-use site that makes money from advertising. We have a modified experience for viewers using ad blockers

Wikia is not accessible if you’ve made further modifications. Remove the custom ad blocker rule(s) and the page will load as expected.