FANDOM


In the plant Arabidopsis thaliana, At2g07750.1 is a gene model for the locus At2g07750.[1]

This gene model is classified by TAIR as "DEAD box RNA helicase, putative". It is located on chr2, region 3576480-3580393 FORWARD.

Physiological functionEdit

At2g07750.1/Function_____________The entry below does not belong to this gene_________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________ ______________ ________________ (At1g78590) NADK3 (At1g78590) is a NAD(H) kinase with a strong preference for NADH over NAD+. NAD(H) kinases phosphorylate NAD(H) with ATP (other phosphoryl donors are not used preferentially) to form NADP(H). Phosphorylation of NAD(H) is the sole known means of generating NADP(H) de novo.

Tissue expressionEdit

At2g07750.1/Expression

Subcellular localizationEdit

At2g07750.1/Localization_____________The entry below does not belong to this gene_________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________

NADK3-GFP has been shown by in vivo transient expression to be localized to the cytosol, confirmed by immunoblotting.

Biophysical propertiesEdit

The gene model At2g07750.1 has 845 amino-acid residues and a molecular weight Mw = 94.916 kDa.

The protein is relatively basic; at the physiological pH 7.4, its net charge is 32.12, or 0.038 per residue._____________The entry below does not belong to this gene_________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________ NADK3-GFP has been shown by in vivo transient expression to be localized to the cytosol, confirmed by immunoblotting.

Knockout phenotypeEdit

At2g07750.1/Knockout

Protein interactionsEdit

At2g07750.1/Interactions_____________The entry below does not belong to this gene_________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________ This protein does not interact with calmodulin in the presence or absence of calcium or EGTA. NADK3 has been reported to be phosphorylated in vitro by AtMAPK4. NADK3 forms a homodimer.

Domain structureEdit

The gene model At2g07750.1 has 2 recognized domains:

  • Domain_0399_0579 DEAD domain (PF00270, IPR011545) Description: DEAD/DEAH box helicase, N-terminal;Molecular Function: nucleic acid binding (GO:0003676), Molecular Function: helicase activity (GO:0004386), Molecular Function: ATP binding (GO:0005524)
  • Domain_0653_0729 Helicase_C domain (PF00271, IPR001650) Description: Helicase, C-terminal;Molecular Function: nucleic acid binding (GO:0003676), Molecular Function: helicase activity (GO:0004386), Molecular Function: ATP binding (GO:0005524)_____________The entry below does not belong to this gene_________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________

NADK3 contains the conserved NAD(H) kinase domain, GSTAAMQSAGG for binding NAD and the upstream GGDGT ATP-binding domain.

Amino-acid sequenceEdit

>At2g07750.1
MAMAMRLPAI SRAVTEVASS PVGLRRLFCS NASRFSFLSP PARRQAEPST NLFHSGLSKR ITSERSLWNR IFSRNMGGGP RTFPGGLNKW QWKRMHEKKA REKENKLLDQ EKQLYEARIR TEIRAKMWGH PDSGEKTAKL KQSHGPMSPK EHIKTLADRF MKAGADDLWN DNDGPVKKFD QGSRSCSDSI DSTPIDVRRL VSATCDSMGK HRVLDSSRRG FSSMSRFKRN ESSCDEGDDV DAKKLDTLSP FSPKFSGTKE KVKSSTSVVG VIRNKGLFGR RKFRKNDSST EEDSDEEGNE GKMIGWMDLR KTGSSASLGN HDIKLTKRVN RNVTDEELYP PLDINRVRED LSKKQSVDNV MEEKQEPHDS IYSAKRFDES CISPLTLKAL SASGIVKMTR VQDATLSECL DGKDALVKAK TGTGKSMAFL LPAIETVLKA MNSGKGVHKV APIFVLILCP TRELASQIAA EGKALLKNHD GIGVQTLIGG TRFRLDQQRL ESEPCQILIA TPGRLLDHIE NKSGLTSRLM ALKLFIVDEA DLLLDLGFKR DVEKIIDCLP RQRQSLLFSA TIPKEVRRVS QLVLKRDHSY IDTIGLGCVE THDKVKQSCI VAPHESHFHL VPHLLKEHIN NMPDYKIIVF CSTGMVTSLM YTLLREMKLN VREIHARKPQ LHRTCVSDEF KESNRLILVT SDVSARGMNY PDVTLVIQVG IPSDREQYIH RLGRTGREGK GGKGLLLIAP WERYFLDELK DLPLEPIPAP DLDSRVKHQV DQSMAKIDTS IKEAAYHAWL GYYNSVRETG RDKTTLAELA NRFCHSIGLE KPPALFRRTA VKMGLKGISG IPIRK
________________Given the above incorrect annotations, this may, or may not, be the correct sequence for At1g57680.1 _________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________ MAIRKLLLLLKPIDPYPFLQTEGASLIKNPQVLQYLESRCKVHKNAIKFCQEILSKKPVE WKPISRNDLSHPIRDVDMVITVGGDGTLLHASHFIDDSVPVLGVNSDPTQAHEVEELSDQ FDASRSTGHLCAATVENFEQVLDDILFGRVVPAKVSRISLKLNSETLLSHALNDILIAQP CPAAVSRFSFKIKNKDGASSPKTVNCRSSGLRICTAAGSTAAMQSAGGFVMPMLSRDLQF MVREPISPGSTASLMHSTFKPDQFMDVNWYSDHGTIYIDGCQVQHSVQLGDTIEISSDAP VLNVFLSHGISQIRSRY-

Multiple sequence alignmentEdit

A full-length multiple-sequence alignment (MSA) is available here. This MSA may be visualized by submitting it to a server such as ESPript.

Protein structureEdit

A predicted structure for this protein is available here.

ReferencesEdit

  1. This is a test reference.

Further readingEdit

General database linksEdit

Ad blocker interference detected!


Wikia is a free-to-use site that makes money from advertising. We have a modified experience for viewers using ad blockers

Wikia is not accessible if you’ve made further modifications. Remove the custom ad blocker rule(s) and the page will load as expected.