FANDOM


>gi|15226148|ref|NP_178814.1|	   150 residues, 50 /line  unknown protein [Arabidopsis thaliana]
MS---SSSVIMDFLKYS-------------------------------------------
------------------------------------------------------------
---------------------------PQPLQLITRPRH------SIHHS----------
--------TLRSSRRLTTSH----NHSTPRSSS--SHHHFSPSLDPVAEHHHHQ------
-----------------------------------------SLDRTLDLVVESPH--HHS
LDPS--LCHQV---EFHHHPPLDIILDCQ----------LQSLL-DSAINKTLEHKEE--
----------------------------------------------MKTL---------A
R--HSTHYLIT-------------------------------------------------
------------------------------------------------------------
--WVEYHS------------------------
>gi|12321081|gb|AAG50650.1|AC073433_2	   126 residues, 50 /line  hypothetical protein [Arabidopsis thaliana]
-----MSS----------------------------------------------------
------------------------------------------------------------
------------LMMHCLI------------HVQ----------ELMNVKGIV-------
-------------------------------------------VDELTGRSGPDHAK---
------SLDPRTSL--------LRLITRPLGRVPP-----------R----ESLDH--FT
RPP---GRVSS---PLPPSPSLDYILDVE----------LQSLL-HSALNQTLEHKEE--
----------------------------------------------KKTP---------A
I--HSTSHSTTLVEYSS-------------------------------------------
------------------------------------------------------------
--------------------------------
>gi|123337223|ref|XP_001294321.1|	   162 residues, 50 /line  hypothetical protein TVAG_318700 [Trichomonas vaginalis G3]
------------------------------------------------------------
------------------------------------------------------------
--------------MHSTP------------HST---------PDSTMHS----------
-------------------------------------------TPHSTPHSTPDSTM---
------HSTPHSTPD-------STMHSTPH-----------------------------S
TPD---STMHS-----TPHSTPDSTMHST----------PHSTP-HSTPHST-PHSTP--
----------------------------------------------HSTP---------A
STPHSTPHSTPASTPASTPATTPADTPAITENEAAQAFGSTTFIVPMTIVLIVTISLIV-
VF----------------------------------------------------------
--------------ALIANQSCW-------RW
>gi|15221112|ref|NP_174876.1|	   212 residues, 50 /line  unknown protein [Arabidopsis thaliana]
-----MLRTVARESNHISEELLVE-----------KKYDSIRENEASANEF---------
--EEEDEIAN-----NEDDVVTKEAAALEANNDNEKKDDIYIGMEFSSDQIAYITYKKYG
GNHGFNVGKQRKM--------KKREG---DLELFASKLEETSQ-NQKTYSTPWS------
------------SDFEAILP----IHSTTRSSN-LSSGHSMTLLDPLVEYHFAT------
------------------------------------------------------------
-----------------PSPSLDHSLYQVTRPPGQVSSLTTISI-TRPDTRSRLHSLL--
----------------------------------------------KS------------
--------------ALN-------------------------------------------
------------------------------------------------------------
--------------------------------
>gi|8778803|gb|AAF79811.1|AC020646_34	   240 residues, 50 /line  T32E20.7 [Arabidopsis thaliana]
-----MSSLMMHCLIHVPELMNVKGIGRFESMCRSSIRDGLIDNKAWLTFL---------
--SRIQSYRI-----LELPTWTMILFALSY---------ALCPFIMVLSPVSYHSSLFYI
ISHHSCILCMIRIVLHTYYISELFSG---DLELFASKLEETSQ-NQKTYSTPRSSD--FG
AILPTY-STPRSSDFGAILP----IHSTTRSSN-LSSGHSMTILDPLVEYHFAT------
------------------------------------------------------------
-----------------PSPSLDHSLYQVTRPPGRVSTLTTISI-TRPDTRSRLHSLL--
----------------------------------------------KF------------
--------------ALNQT-----------------------------------------
------------------------------------------------------------
-------------------------------S
>gi|15235658|ref|NP_192473.1|	   207 residues, 50 /line  unknown protein [Arabidopsis thaliana]
----------MHCLIHIPELMNVKGIGRFESM----------------------------
------------------------------------------------------------
-------------------------C---DLELFASKLEETSQ-NKKTYSTPRSSD--FG
AILPTY-STPRSSDFGAILP----IHSTTRSSN-LRSGHSMTLLDPLVEYQFTTPPDNTR
PFTLPHHSTPRSSITSPHH----------------HHHSTIHSTKLLDPLVEYHHS----
----------------PPSASLDRTLDHV----------FTVYS-NPHSTRQAEHKEE--
----------------------------------------------KR------------
--------------RRQSVWKRP---------------------GLPSDHEAH-------
---------------LGP------------------------------------------
--LSLYG---------------P-------SD
>gi|22328390|ref|NP_680613.1|	   193 residues, 50 /line  unknown protein [Arabidopsis thaliana]
-----MIR----------------------------------------------------
------------------------------------------------------------
------------ITLHTYCISELFSG---DLELFASKLEETSQ-NQKTYSTPRSSD--FR
AILPTY-STPRSSDFGAILP----IHSTTRLSN-LSSGHSMTLLDPLVEYHFATLPDNTR
PFTLPSYSTPWSSIITHHH----------------QHHSTGHSITS--------------
-------------------------------------SQSTQIR-TQPD---KLSTRK--
----------------------------------------------RR------------
-----------------GEDKVF---------------------GSGLDLHRIKKPISAH
YLSMGRAIRLLARLLSFY------------------------------------------
--FVLY-------------------------K
>gi|22329987|ref|NP_683367.1|	   261 residues, 50 /line  unknown protein [Arabidopsis thaliana]
-----MSSLMMHCLIYVPELKNVKGF----------------------------------
------------------------------------------------------------
-------------------------G---DLELLASKLEEESR-NQKPHTRPPG-----R
VHPAPH-STPWSSNIGAVLA----NHSTPWSSN-HTPGYSMTPLDRIGKQHFVTPL----
-----------------------------------DNHLTIHSTTLLDPLVEYHHS----
----------------PPIKSLDQALDHT----------FRVFS-NPHSNRQAEHKAE--
----------------------------------------------KR------------
--------------RRRSVWKRPGASPD-----HKAQFGPLSFYGPKMFDGMLDPLVPE-
ILVSIPRDWPFRALGELTDSSTELGELIKCKVER---------------VPTNGCIA-QR
MQGIDVTF------RKDAKNGCDISEGCKDRM
>gi|4773910|gb|AAD29780.1|AF147259_3	   267 residues, 50 /line  F10A2.13 gene product [Arabidopsis thaliana]
-----MANVSKH----LGSSCIRI-----------ACFGVFSGVEGAKKDFTRSIHSIQA
ATEEASIHSTSLLDPGCYRGGYSLLDPLTRSRQPQMKQQIDLLAPPTRSIYSTTAVDELI
GRSG--------------------------------------------------------
-PDRIKPLDPLSSTCFTTST----NHSTPSSSR--RPRHFAPPLDHMAEYHQLHHLTITR
----SHHSTPWSSTSITFTRSLTRLHGRPSITISI-------------------------
-----------------------------TRIYTRLPALESSPFRTQPNTRAQGRKED--
----------------------------------------------SSSS----------
-LDHSLDHLVEFEPRHFR---------------------AQKVFD---------------
------------EMSEPLIPEIRGSVPRLT------------------------------
--LVNG-------------------------D
>gi|9294211|dbj|BAB02113.1|	   174 residues, 50 /line  unnamed protein product [Arabidopsis thaliana]
-----MIR----------------------------------------------------
------------------------------------------------------------
------------IALHTYCIFELFSG---DLGCWRGNWKKRAR-TRRHTRPPG------R
VHPTPY-STPWSSDIGAILP----IYSTPWSSN-HSSGHSMTPLDPMVEYHYTTPL----
-----------------------------------DHHSAIHSTTSLNPLVEYHHS----
----------------TPTPSLDQTLDHI----------FKVYS-NSHLTRQAEHKDE--
----------------------------------------------KR------------
--------------RRRSVWKRS---------------------GASSDHEAH-------
------------------------------------------------------------
--LGPLSL------------YGP-------VD
>gi|15226655|ref|NP_178822.1|	   175 residues, 50 /line  unknown protein [Arabidopsis thaliana]
------------------------------------------------------------
------------------------------------------------------------
-------------MLHICVDFRGRVGASRSQETTRPPGRVEDITTSLHHSTTRSSA--LI
SITRSHHSTMRSSVFTSIIRQ-PLDLVNQPGSRVSPDKHLITSLDHEVECLH--------
----------------LH----CQTTTRPHCSTW--------------------------
-------------KSSITITPLDCILDDK----------LQSLL-HSALNQTLEHRKG--
----------------------------------------------KKTP---------A
T--HSTSHSTT-------------------------------------------------
------------------------------------------------------------
--WVEYSS------LSVPILRRF-------EY
>gi|22331493|ref|NP_683640.1|	   104 residues, 50 /line  unknown protein [Arabidopsis thaliana]
------------------------------------------------------------
------------------------------------------------------------
---------------------------------------------MSNHSTPRSSR--SF
KISIDH--------------------STPWSSR--GHHYLITSLDPEVETL---------
----------------------LDLFTLPGSRVS--------------------------
-----------------PSPPLDCILDDK----------LQSLL-HSGLNQTLEHKEE--
----------------------------------------------KKTP---------V
I--HSTTHSTT-------------------------------------------------
------------------------------------------------------------
--WVEYSS------------------------
>gi|9293995|dbj|BAB01898.1|	   104 residues, 50 /line  unnamed protein product [Arabidopsis thaliana]
------------------------------------------------------------
------------------------------------------------------------
---------------------------------------------MTNHSTQRSSR--SF
KISRDH--------------------STPRSSR--RHHHFTSPLDHQVEPL---------
----------------------LDLITLPGSRVS--------------------------
-----------------PSPPLDCILDDK----------LQSLL-HSALNQTLEHKEE--
----------------------------------------------KKTP---------A
I--HSTSHSTT-------------------------------------------------
------------------------------------------------------------
--WVEYSS------------------------
>gi|18412965|ref|NP_567303.1|	   104 residues, 50 /line  unknown protein [Arabidopsis thaliana]
------------------------------------------------------------
------------------------------------------------------------
---------------------------------------------MSNHSTPRSSR--SF
KISTDH--------------------STPRSSR--GHHYFTTSLDPEVE-----------
--------------------PLLDLITLPGSRVSPS------------------------
-------------------PPLDCILDDK----------LQSLL-YSALNQTLEHKEE--
----------------------------------------------KKTP---------A
I--HSTSYSTT-------------------------------------------------
------------------------------------------------------------
--WVEYSS------------------------
>gi|30693479|ref|NP_849763.1|	   150 residues, 50 /line  unknown protein [Arabidopsis thaliana]
------------------------------------------------------------
------------------------------------------------------------
---------------------------------------------MTNHSTQRSSR--SF
KISRDH--------------------STTRSSR--GHHHFTSPLAPRSSAII--------
----------------SITRPSLDHFTRPRGRVPSSPSPDRHSITSLDHEVECLHL--YH
QTTT--RPPHSTQRSSISITPLDSILDDK----------LQSLL-HSALNQTFEHKEE--
----------------------------------------------KKTP---------A
I--HSSSHSTT-------------------------------------------------
------------------------------------------------------------
--WVEYSS------------------------
>gi|9293994|dbj|BAB01897.1|	   112 residues, 50 /line  unnamed protein product [Arabidopsis thaliana]
------------------------------------------------------------
------------------------------------------------------------
---------------------------------------------MKEESSLFATYKENI
RQSSYH--------------------HFSSPSL--DH-HSITSLDPEVECLH--------
----------------PIARPVLDLIILPGSRVSPS------------------------
-------------------PPLECILDDK----------LQSLL-HSALNQTLEHKEE--
----------------------------------------------KKTP---------A
I--HSTSHSTT-------------------------------------------------
------------------------------------------------------------
--WVEYSS------------------------
>gi|22327209|ref|NP_680270.1|	   258 residues, 50 /line  unknown protein [Arabidopsis thaliana]
-----MFR----------------------------------------------------
------------------------------------------------------------
------------IVLHACCIFALISG---DLELLTSYLEEADL-IMTNHSTQRSSR--SF
KISRDH--------------------STTRSRR--GHHHFTSPLDPEVECPRLHHQTNTR
----SRHSTSRSSAFTFTARPLLDLITLPRGRVSPS------------------------
--------------------------------------------------------HH--
----------------------------------------------STAYSMTSFRAFFI
P--HSTRHSSTRKKRRLQLFTRPLTRP----------PGSSTVLNPSQYFVVLSIRVSG-
YLAISSMYFSFSQEEVSYLVLFPQTLCSRLFVIRISLYLFSIQFLYLI-----SFTVVHS
VIILLLHCCYHVFNLFNVYAFCY-------DV
>gi|29423658|gb|AAO73423.1|	   107 residues, 50 /line  hypothetical protein [Arabidopsis thaliana]
-----MFR----------------------------------------------------
------------------------------------------------------------
------------IVLHACCIFALISG---DLELLTSYLEEADL-IMTNHSTQRSSR--SF
KISRDH--------------------STTRSSR--AHHHFTSPLDPEVECHHLHHQTVTR
----SLHST---------------------------------------------------
------------------------------------------------------------
------------------------------------------------SSLY--LEVEYL
H--HTTR-----------------------------------------------------
---------------------------------------------------------LHT
R-------------------------------
>gi|22327253|ref|NP_680292.1|	   240 residues, 50 /line  unknown protein [Arabidopsis thaliana]
MLSKEKDH----------------------------------------------------
------------------------------------------------------------
------------LVSHH------HQG---DLELLTSYLEEEDL-IMTNHSTKRSSR--SF
KISRDH--------------------STPWSSR--GHHHFTSPLDHEVECPHLHHQTITR
----SHHSTMRSSVFTSIIRPPLDLVTQPGSRVSSDT-----------------------
---T--RSHHSTPRPS------DFIPLPD----------LYSTL-SLYLDVEYHHHHH--
----------------------------------------------STAYSMTSFRAFFI
P--HSTRHSSKRKKRRLQLFTRPLTRP----------RGSSTVLNPSQYFVVLSIRVSG-
YLAISSMYFTFSQTRSF-----------------------------LS-----SFISADL
VF------------------------------
>gi|42573503|ref|NP_974848.1|	   256 residues, 50 /line  unknown protein [Arabidopsis thaliana]
-----MFR----------------------------------------------------
------------------------------------------------------------
------------IVLHACCIFALISG---DLELLTSHLEEADL-ITTNHSTKRSSR--SF
KIPRDQ--------------------STPRSSI--GHHHFTSPLDLFTPPGSRVSSNTTR
----SPHSTPRSSAFTFTARPLLDLITLPRGRVPPS------------------------
--------------------------------------------------------HR--
----------------------------------------------STAYSMTSFRAFFI
P--HSTRHSSTRKKRRLQLFTRPLTRP----------PGSSTVLNPSKYFVVLSIRVSG-
YLAISSMYFSFSQTRSFYLVLFPQTLCSRLFVIRISLYLFSIQLWFLIFVYCCSFC-YHT
TVTLLLSC------LQPVQRLCF-------LL
>gi|22331459|ref|NP_683624.1|	   120 residues, 50 /line  unknown protein [Arabidopsis thaliana]
------------------------------------------------------------
------------------------------------------------------------
--------------MRSSI------------VIL----------DFLNYSATTST--ANH
LTTTLYPS------------------LDLEVEC--SHHHFSPSLDPLEGTSITTYRH---
------SLDPLVEQ--------QHHHLSSFTQSPP-----------LDLVVE--------
---------------------------YS----------MQWTT-MEIRRHFGAKAKE--
----------------------------------------------KEAK---------D
D--FGSGISEE-------------------------------------------------
------------------------------------------------------------
--------------------------------
>gi|8777504|dbj|BAA97074.1|	   148 residues, 50 /line  unnamed protein product [Arabidopsis thaliana]
------------------------------------------------------------
------------------------------------------------------------
--------------MRSSI------------VIL----------DFLNYSATTST--ANH
LTTTLYPS------------------LDLEVEC--SHHHFSPSLDPLEGTSITTYRH---
------SLDPLVEQ--------QHHHLSSFTQSPP-----------LDLVVESDHH--HS
FDQS--LCHQV---EFHHHPPLDIILDCQ----------LQSLL-NSALNQTFEHKEE--
----------------------------------------------KRTP---------T
H--HSTHYSTT-------------------------------------------------
------------------------------------------------------------
--------------------------------
>gi|42573505|ref|NP_974849.1|	   123 residues, 50 /line  unknown protein [Arabidopsis thaliana]
----------MDLIISI-------------------------------------------
------------------------------------------------------------
---------------------------------------------YSTLS----------
--------TRSHLRSQSLDRNTLVHHSTPWSSR--RHHHFSPP-----------------
----------------------------------------------LDTLVEYHHLYHST
FTRSPPLDYIV---EYHHHPPLDIILDCQ----------LQSLL-HSALNQTLEHKEE--
----------------------------------------------KKTP---------A
Y--HSTNHSTT-------------------------------------------------
------------------------------------------------------------
--WVECRS------------------------
>gi|98961923|gb|ABF59291.1|	   196 residues, 50 /line  unknown protein [Arabidopsis thaliana]
------------------------------------------------------------
------------------------------------------------------------
---------------------------------------------MSNHS----------
--------TPWSSRCFTTST----DQSTPWSSR--KPQHSTLPLDNVIEYHQDN------
-----------------------------------------HSITSLDHLVEYNHAHHIT
FTQS--LYQQV---EYHHHHSLDQSLYQQ----------VEYHH-HHSLDQSLYQQVEYH
HHHSLDQSLYQQVVNHHHHSLDQSLYQHGRVPPLSFTRQITLPTWPSITI---------I
I--HSTNNSTN-------------------------------------------------
------------------------------------------------------------
--MVKYHHHHSLDQSLYHQV--EYYHHHPLDQ

Ad blocker interference detected!


Wikia is a free-to-use site that makes money from advertising. We have a modified experience for viewers using ad blockers

Wikia is not accessible if you’ve made further modifications. Remove the custom ad blocker rule(s) and the page will load as expected.