FANDOM


>gi|15226092|ref|NP_178788.1|	   777 residues, 50 /line  ATP synthase alpha chain, mitochondrial, putative [Arabidopsis thaliana]
MITRLFAQLVSLSIVTYWNDAIVATNFSWLFITFFVMTFTFRTFSRYFKKPIIWTFYFFL
CLIAFLLLWAARIHINILFSFAFGDVYSFFMAGVFLFYGFGELLPIGSDSDVGEASWVVN
PATGASGSGGNGWTESAANDPAREVSLAPFPLQLTHPVPFPAEPGSPDPVSPPPPIASFY
SRIERAESLHAGNIELAEDLQRIQEMERNLENERSPYRGRELAARIDWEVRELEGKVARN
RAWDMVRDAQLDIWRQGLDQELVRQQENESRLEERRAAELTNLFESRIRNFYANFQVDEI
GRVVSVGDGIAQVYGLNEIQAGEMVLFANGVKGMALNLENENVGIVVFGGDTAIKEGDLV
KRTGSIVDVPAGKAMLGRVVDAMGVPIDGKGAL-SDHEQRRVEVKAPGILERKSVHEPMQ
TGLKAVDSLVPIGRGQRELLIGDRQTGKTTIAIDTILNQKQINSRATSESETMYCVYVAI
GQKRSTVGQLIQTLEEANALEYSILVAATASDPAPLQFLAPYSGCAMGEYFRDNGMHALI
IYDDLSKQAVAYRQMSLLLRRPPGREAFPGDVFYLHSRLLERAAKRSDQTGAGSLTALPV
IETQAGDVSAYIPTNVISITDGQICLETELFYRGIRPAINVGLSVSRVGSAAQLKAMKQV
CGSSKLELAQYREVAAFAQFGSDLDAATQALLNRGARLTEVPKQPQYAPLPIEKQILVIY
AAVNGFCDRMPLDRISQYEKAIPNSVKPELLQAL--KGGLTNERKMEPDAFLKERALALI
-----
>gi|114404|sp|P18260|ATPAM_HELAN	   510 residues, 50 /line  ATP synthase subunit alpha, mitochondrial
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------MEFSPRAAELTTLLESRISNFYTNFQVDEI
GRVVSVGDGIARVYGLNEIQAGEMVEFASGVKGIALNLENENVGIVVFGSDTAIKEGDLV
KRTGSIVDVPAGKAMLGRVVDALGVPIDGRGAL-SDHERRRVEVKAPGIIERKSVHEPMQ
TGLKAVDSLVPIGRGQRELIIGDRQTGKTAIAIDTILNQKQMNSRSTSESETLYCVYVAI
GQKRSTVAQLVQILSEANAMEYSILVAATASDPAPLQFLAPYSGCAMGEYFRDNGMHALI
IYDDLSKQAVAYRQMSLLLRRPPGREAFPGDVFYLHSRLLERAAKRSDQTGAGSLTALPV
IETQAGDVSAYIPTNVIPITDGQICSETELFYRGIRPAINVGLSVSRVGSAAQLKTMKQV
CGSSKLELAQYREVAALAQFGSDLDAATQALLNRGARLTEVPKQPQYAPLPIEKQILVIY
AAVNGFCDRMPLDRISQYERAILKSIKTELLQSLLEKGGLTNERKMEPDTFLKECALPYT
I----
>gi|114408|sp|P05492|ATPAM_OENBI	   511 residues, 50 /line  ATP synthase subunit alpha, mitochondrial
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------MEFSPRAAELTTLLESRITNFYTNFQVDEI
GRVISVGDGIARVYGLNEIQAGEMVEFASGVKGIALNLENENVGIVVFGSDTAIKEGDLV
KRTGSIVDVPAGKSLLGRVVDALGVPIDGRGAL-GDHERRRVEVKVPGIIERKSVHEPMQ
TGLKAVDSLVPIGRGQRELIIGDRQTGKTAIAIDTILNQKQMNSRATSESETLYCVYVAI
GQKRSTVAQLVQILSEGNALEYSILVAATASDPAPLQFLAPYSGCAMGEYFRDNGMHALI
IYDDLSKQAVAYRQMSLLLRRPPGREAFPGDVFYLHSRLLERAAKRSDQTGAGSLTALPV
IETQAGDVSAYIPTNVISITDGQICLETELFYRGIRPAINVGLSVSRVGSAAQLKAMKQV
CGSLKLELAQYREVAAFAQFGSDLDAATQALLNRGARLTEILKQPQYAPLPIEKQIIVIY
AAVNGFCDRMPLDRISQYERAIPQSVKQELLQSLVEKGGLNNERKIEPDAFLKENAKPYI
K-G--
>gi|89112894|gb|ABD61059.1|	   431 residues, 50 /line  ATPase alpha subunit [Allium cepa]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------FQVDEI
GRVVSVGDGIARVYGLNEIQAGEMVEFASGVKGIALNLENENVGIVVFGSDTAIKEGDLV
KRTGSIVDVPAGKAMLGRVVDALGVPIDGKGAL-SNHERRRVEVKAPGIIERKSVHEPMQ
TGLKAVDSLVPIGRGQRELIIGDRQTGKTAIAIDTILNQKQMNE--SSESETLYCVYVAI
GQKRSTVAQFVQILIEANALEYSILVAATASDPAPLQFLAPYSGCAMGEYFRDNSMHALI
IYDDLSKQAVAYRQMSLLLRRPPGREAFPGDVFYLHSRLLERAAKRSDQTGAGSLTALPV
IETQAGDVSAYIPTNVIPITDGQICSETELFYRGIRPAINVGLSVSRVGSAAQLKTMKQV
RGSSKLELAQYREVAAFAQFGSDLDAATQALPNRGARLTEVTKQPQYSPLPIEKQIVVIY
AAVKGFCD----------------------------------------------------
-----
>gi|98986470|gb|ABF60013.1|	   451 residues, 50 /line  ATPase alpha subunit [Phoenix dactylifera]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------------------RMTNFYTNFQVDEI
GRVVSVGDGIARVYGLNEIQAGEMVEFASGVKGIALNLENENVGIVVFGSDTAIKEGDLV
KRTGSIVDVPAGKAMLGRVVDALGVPIDGRGAL-SDHERRRVEVKAPGIIERKSVHEPMQ
TGLKAVDSLVPIGRGQRELIIGDRQTGKTAIAIDTILNQKQMNSRGTSESETLYCVYVAI
GQKRSTVAQLVQILPEANALEYSILVAATASDPAPLQFLAPYSGCAMGEYFRDNGMHALI
IYDDLSKQAVAYRQMSLLLRRPPGREAFPGDVFYLHSRLLERAAKRSDQTGAGSSTALPV
IETQAGDVSAYIPTNVIPITDGQICSETELFYRGIRPAINVGLSVSRVGSAAQLRAMKQV
RGSSKLELAQYREVAAFAQFGSDLDAATQALPNRGARLTEVPKQPQYSPLPIEKQIVVIY
AAVKGFCDRMPLDRISHI------------------------------------------
-----
>gi|231585|sp|Q01915|ATPAM_SOYBN	   508 residues, 50 /line  ATP synthase subunit alpha, mitochondrial
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------MEFSVRAAELTTLLESRITNFYTNFQVDEI
GRVVSVGDGIARVYGLNEIQAGEMVEFASGVKGIALNLENENVGIVVFGSDTAIKEGDLV
KRTGSIVDVPAGKAMLGRVVDALGVPIDGRGAL-SDHERRRVEVKAPGIIERKSVHEPMQ
TGLKAVDSLVPIGRGQRELIIGDRQTGKTAIAIDTILNQKQMNSRATSESETLYCVYVAI
GQKRSTVAQLVQILSEANALEYSILVAATASDPAPLQFLAPYSGCAMGEYFRDNGMHALI
IYDDLSKQAVAYRQMSLLLRRPPGREAFPGDVFYLHSRLLERAAKRSDQTGAGSLTALPV
IETQAGDVSAYIPTNVISITDGQICLETELFYRGIRPAINVGLSVSRVGSAAQLKAMKQV
CGSLKLELAQYREVAAFAQFGSDLDAATQALLNRGARLTEVLKQPQYAPLPIEKQILVIY
AAVNGFCDRMPLDKIPQYERDILTTIKPELLQSL--KGGLTSERKIELEKFLKEKGGTY-
---YI
>gi|5305369|gb|AAD41619.1|AF071550_4	   508 residues, 50 /line  ATP synthase alpha chain [Vigna radiata]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------MEFSVRAAELTTLLESRITNFYTNLKVDEI
GRVVSVGDGIARVYGLNEIQAGEMVEFASGVKGIALNLENENVGIVVFGSDTAIKEGDLV
KRTGSIVDVPAGKAMLGRVVDALGVPIDGRGAL-SDHERRRVEVKAPGIIERKSVHEPMQ
TGLKAVDSLVPIGRGQRELIIGDRQTGKTAIAIDTILNQKQMNSRATSESETLYCVYVAI
GQKRSTVAQLVQILSEANALEYSILVAATASDPAPLQFLAPYSGCAMGEYFRDNGMHALI
IYDDLSKQAVAYRQMSLLLRRPPGREAFPGDVFYLHSRLLERAAKRSDQTGAGSLTALPV
IETQAGDVSAYIPTNVISITDGQICLETELFYRGIRPAINVGLSVSRVGSAAQLKAMKQV
CGSLKLELAQYREVAAFAQFGSDLDAATQALLNRGARLTEVLKQPQYAPLPIEKQILVIY
AAVNGFCDKMPLDQIPQYERDILTTIKPELLQSL--KGGLTSEIKIELEKFFKEKAKNYN
L----
>gi|543866|sp|P05493|ATPAM_PEA	   507 residues, 50 /line  ATP synthase subunit alpha, mitochondrial
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------MEFSVRAAELTTLLESRITNFYTNFQVDEI
GRVVSVGDGIARVYGLNEIQAGELVEFASGVKGIALNLENENVGIVVFGSDTSIKEGDLV
KRTGSIVDVPAGKAMLGRVVDALGVPIDGRGAL-SDHERRRVEVKAPGIIERKSVHEPMQ
TGLKAVDSLVPIGRGQRELIIGDRQTGKTAIAIDTILNQKQMNSRATSESETLYCVYVAI
GQKRSTVAQLVQILSEANALEYSILVAATASDPAPLQFLAPYSGCAMGEYFRDNGMHALI
IYDDLSKQAVAYRQMSLLLRRPPGREAFPGDVFYLHSRLLERAAKRSDQTGAGSLTALPV
IETQAGDVSAYIPTNVISITDGQICLETELFYRGIRPAINVGLSVSRVGSAAQLKAMKQV
CGSLKLELAQYREVAAFAQFGSDLDAATQALLNRGARLTEVLKQPQYAPLPIEKQILVIY
AAVNGFCDRMPLDKIAQYERDILSTIKQELLQSL--KGGLTGERKIEPDAFLKEKALSLI
-----
>gi|74181742|dbj|BAE32582.1|	   509 residues, 50 /line  unnamed protein product [Mus musculus]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------MEFSPRAAELTTLLESRISNFYTNFQVDEI
GRVVSVGDGIARVYGLNEIQAGEMVEFASGVKGIALNLENENVGIVVFGSDTAIKEGDLV
KRTGSIVDVPAGKAMLGRVVDALGVPIDGRGAL-SDHERRRVEVKAPGIIERKSVHEPMQ
TGLKAVDSLVPIGRGQRELIIGDRQTGKTAIAIDTILNQKQMNSRAASESETLYCVYVAV
GQKRSTVAQLVQILSEANALEYSILVAATASDPAPLQFLAPYSGCAMGEYFRDNGMHALI
IYDDLSKQAVAYRQMSLLLRRPPGREAFPGDVFYLHSRLLERAAKRSDQTGAGSLTALPV
IETQAGDVSAYIPTNVISITDGQICLETELFYRGIRPAINVGLSVSRVGSAAQLKAMKQV
CGSSKLELAQYREVAAFAQFGSDLDAATQALLNRGARLTEVLKQPQYAPLPIEKQILVIY
AAVNGFCDRMPLDRISQYERAIPSQIKPELLQSLLEKGGLTNERKMEPDAFLKESALPYL
-----
>gi|1421799|gb|AAB03873.1|	   509 residues, 50 /line  F1-ATPase alpha subunit [Petunia axillaris subsp. parodii]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------MELSPRAAELTSLLESRISNFYTNFQVDEI
GRVVSVGDGIARVYGLNEIQAGEMVEFASGVKGIALNLENENVGIVVFGSDTAIKEGDLV
KRTGSIVDVPAGKAMLGRVVDGLGLPIDGKGAL-SDHERRRVEVKAPGIIERKSVHEPMQ
TGLKAVDSLVPIGRGQRELIIGDRQTGKTAIAIDTILNQKQLNSRATSESETLYCVYVAI
GQKRSTVAQLVQILSEANALEYSILVAATASDPAPLQFLAPYSGCAMGEYFRDNGMHALI
IYDDLSKQAVAYRQMSLLLRRPPGREAFPGDVFYLHSRLLERAAKRSDQTGAGSLTALPV
IETQAGDVSAYIPTNVIPITDGQICLETELFYRGIRPAINVGLSVSRVGSAAQLKTMKQV
CGSSKLELAQYREVAALAQFGSDLDAATQALLNRGARLTEVPKQPQYAPLPIEKQILVIY
AAVNGFCDRMPLDRISQYERAIPNSVKPELLQSFLEKGGLTNERKMEPDTFLKESALAFI
-----
>gi|9838493|ref|NP_064105.1|	   506 residues, 50 /line  ATPase subunit 1 [Beta vulgaris subsp. vulgaris]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------MEFSPRAAELTNLLESRITNFYTNFQVDEI
GRVVSVGDGIARVYGLNEIQAGEMVEFASGVKGIALNLENENVGIVVFGSDTAIKEGDLV
KRTGSIVDVPAGKAMLGRVVDALGVPIDGRGAL-SDHERRRVEVKAPGIIERKSVHEPMQ
TGLKAVDSLVPIGRGQRELIIGDRQTGKTAIAIDTILNQKQLNSKATSESETLYCVYVAV
GQKRSTVAQLVQILSEANALEYSILVAATASDPAPLQFLAPYSGCAMGEYFRDNGMHALI
IYDDLSKQAVAYRQMSLLLRRPPGREAFPGDVFYLHSRLLERAAKRSDQTGAGSLTALPV
IETQAGDVSAYIPTNVISITDGQICLETELFYRGIRPAINVGLSVSRVGSAAQLKAMKQV
CGSPKLELAQYREVAAFAQFGSDLDAATQALLNRGARLTEVPKQPQYAPLPIEKQILVIY
AAVNGFCDRMPLDKISQYERTIPNSVKPELLQSL--KGGLTNEKKMELDSFLKECALNY-
-----
>gi|115278526|ref|YP_762326.1|	   513 residues, 50 /line  ATPase subunit 1 [Sorghum bicolor]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------MEFSPRAAELTTLLESRMTNFYTNFQVDEI
GRVVSVGDGIARVYGLNEIQAGEMVEFASGVKGIALNLENENVGIVVFGSDTAIKEGDLV
KRTGSIVDVPAGKAMLGRVVDALGVPIDGKGAL-SDHERRRVEVKAPGIIERKSVHEPMQ
TGLKAVDSLVPIGRGQRELIIGDRQTGKTAIAIDTILNQKQMNSRGTNESETLYCVYVAI
GQKRSTVAQLVQILSEANALEYSILVAATASDPAPLQFLAPYSGCAMGEYFRDNGMHALI
IYDDLSKQAVAYRQMSLLLRRPPGREAFPGDVFYLHSRLLERAAKRSDQTGAGSLTALPV
IETQAGDVSAYIPTNVISITDGQICLETELFYRGIRPAINVGLSVSRVGSAAQLKAMKQV
CGSSKLELAQYREVAAFAQFGSDLDAATQALLNRGARLTEVPKQPQYEPLPIEKQIVVIY
AAVNGFCDRMPLDRISQYEKNILSTINPELLKSFLEKGGLTNERKMEPDASLKESALNLG
E-AKI
>gi|15429015|gb|AAK98045.1|AF301602_1	   513 residues, 50 /line  ATP1 [Daucus carota]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------MKNSPRAAELTTLLESRISHFYTNFQVDEI
GRVVSVGDGIARVYGLNEIQAGEMVEFASGVKGIALNLENENVGIVVFGSDTAIKEGDLV
KRTGSIVDVPAGKAMLGRVVDALGVPIDGRGAL-SDHERRRVEVKAPGIIERKSVHEPMQ
TGLKAVDSLVPIGRGQRELIIGDRQTGKTAIAIDTILNQKQMNSRSTSESETLYCVYVAI
GQKRSTVAQLVQILSEANALEYSILVAATASDPAPLQFLAPYSGCAMGEYFRDNGMHALI
IYDDLSKQAVAYRQMSLLLRRPPSREAFPGDVFYLHSRLLERAAKRSDQTGAGSLTALPV
IETQAGDVSAYIPTNVIPITDGQICLETELFYRGIRPAINVGLSVSRVGSAAQLKAMKQV
CGSSKLELAQYREVAALAQFGSDLDAATQALLNRGARLTEVPKQPQYAPLPIEKQILVIY
AAVNGFCDRMPLEKIEQFEKVITSLIIPELLQKLLEKGGLTNERKMEPDAFLKESAFKII
T-NDA
>gi|11467148|ref|NP_054447.1|	   513 residues, 50 /line  ATP synthase F1 subunit alpha [Marchantia polymorpha]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------------------------------MNKLAGAELSTLLEQRITNYYTKLQVDEI
GRVVSVGDGIARVYGLNKIQAGEMVEFASGVKGMALNLENENVGIVIFGSDTAIKEGDIV
KRTGSIVDVPVGKGMLGRVVDALGVPIDGKGAL-SAVERRRVEVKAPGIIARKSVHEPMQ
TGLKAVDSLVPIGRGQRELIIGDRQTGKTAIAIDTILNQKQINAQGTSDSEKLYCVYVAI
GQKRSTVAQLVKILSEAGALEYSIIVAATASDPAPLQFLAPYSGCAMGEYFRDNGMHALI
IYDDLSKQSVAYRQMSLLLRRPPGREAFPGDVFYLHSRLLERAAKMSDQTGAGSLTALPV
IETQAGDVSAYIPTNVISITDGQIFLETELFYRGSRPAINVGLSVSRVGSAAQLKAMKQV
CGSLKLELAQYREVAAFAQFGSDLDAATQYLLNRGARLTEILKQAQYSPIPIEKQIVVIY
AAVKGYLDQIPVALITHYEQELLKSIDPGLLSAIVQQKNITEQISSQLATFCQKFTQSFL
ATHQS
>gi|71149406|gb|AAZ29198.1|	   514 residues, 50 /line  ATP synthase subunit A [Pellia epiphylla]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------------------------------MNKLAGAELSTLLEQRITNYYTKLQVDEI
GRVVSVGDGIARVYGSNKIQAGEMVESASGVKGMALNLENENVGIVIFGSDTAIKEGDIV
KRTGSIVDVPVGKAMLGRVVDALGVPIDGKGALLSAVERRRVEVKAPGIIARKSVHEPMQ
TGLKAVDSLVPIGRGQRELIIGDRQTGKTAIAIDTISNQKQINAQGTSDSEKLYCVYVAI
GQKRSTVAQLVKIPSEAGASEYSIIVAATASDPAPPQFLAPYSGCAMGEYFRDNGMHALI
IYDDLSKQSVAYRQMSLLLRRPPGREAFPGDVFYLHSRLSERAAKMSDQTGAGSLTAPPV
IETQAGDVSAYIPTNVISITDGQIFLETEPFYRGSRPAINVGLSVSRVGSAAQLKAMKQV
CGSLKLELAQYREVAAFAQFGSDLDAATQYLSNRGARLTEILKQPQYSPIPIEKQIVVIY
AAVKGYLDQIPVVLITHYEQELLKSIDPGILSAIVQQKNITEQISSQLATFCQKFTQSFL
ATHQS
>gi|91208868|ref|YP_539029.1|	   518 residues, 50 /line  ATP synthase F1 subunit alpha [Physcomitrella patens]
------------------------------------------------------------
----------------------------------------------------------MN
KL----------------------------------------------------------
------------------------------------------------------------
------------------------------TGNKLAGAELSTLLEQRITNYYTKLQVDEI
GRVVSVGDGIARVYGLNKIQAGEMVEFASGVKGMALNLENENVGIVIFGSDTAIKEGDIV
KRTGSIVDVPVGKGLLGRVVDALGVPIDGKGAL-SAAERRRVEVKAPGIIARKSVHEPMQ
TGLKAVDSLVPIGRGQRELIIGDRQTGKTAIAIDTILNQKQINTQGTSDSEKLYCVYVAI
GQKRSTVAQLVKILSEAGALEYCIIVAATASDPAPLQFLAPYSGCAMGEYFRDNGMHALI
IYDDLSKQSVAYRQMSLLLRRPPGREAFPGDVFYLHSRLLERAAKMSDQTGAGSLTALPV
IETQAGDVSAYIPTNVISITDGQIFLETELFYRGIRPAINVGLSVSRVGSAAQLKAMKQV
CGSLKLELAQYREVAAFAQFGSDLDAATQYLLNRGARLTEVLKQPQYSPISIEKQIVVIY
AAVKGYLDQIPISSINQYEHELLKSIDPDILSAIVQQKNITEQINSQLATFCQKFTQSFL
ATHSV
>gi|22550331|ref|NP_689366.1|	   508 residues, 50 /line  ATP synthase F1 subunit alpha [Chaetosphaeridium globosum]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------MNAAELSSLLESRITNYYTKFQVDEV
GRVVSVGDGIARVYGLNKIQAGEMVEFASGVKGMALNLENENVGIVVFGNDTAIKEGDIV
KRTGSIVDVPVGKELLGRVVDALGVPIDGKGPL-GHSSRIRVEVKAPGIISRKSVHEPMQ
TGLKAVDSLVPIGRGQRELIIGDRQTGKTAIAIDTILNQKQLNASATSEKDKLYCVYVAI
GQKRSTVAQLVKSLSEAGALEYSIIVAATASDPAPLQFLAPYSGCAMAEYFRDNGMHALI
VYDDLSKQSVAYRQMCLLLRRPPGREAFPGDVFYLHSRLLERAAKMSNDKGAGSMTALPV
IETQAGDVSAYIPTNVISITDGQIFLETELFYRGIRPAINVGLSVSRVGSAAQMKAMKQV
CGSLKLELAQYREVAAFAQFGSDLDASTQYLLNRGARLTEVLKQAQYSPLPIEKQIVVIF
AAVKGYLDSIAISSIGEYEQQLLKAVPVELLSAILKEKNMTETISAELANFCSTFTANFN
AIN--
>gi|38638271|ref|NP_943682.1|	   516 residues, 50 /line  ATP synthase F1 subunit alpha [Chara vulgaris]
------------------------------------------------------------
------------------------------------------------------------
MK----------------------------------------------------------
------------------------------------------------------------
------------------------------FMNKFAGAELSTLLEQRITNYYTKLQVDEI
GRVVSVGDGIARVYGLNKIQAGEMVEFSSGVKGMALNLENESVGIVVFGSDTAIKEGDIV
KRTGSIVDVPVGRSMLGRVVDALGVPIDGKGAL-GAVERRRVEVKAPGIISRKSVHEPMQ
TGLKAVDSLVPIGRGQRELIIGDRQTGKTAIAIDTILNQKQINAKGASEKEKLYCVYVAI
GQKRSTVAQLVKILSEAGALEYSIIVAATASDPAPLQFLAPYAGCAMGEFFRDNGMHALI
IYDDLSKQSVAYRQMSLLLRRPPGREAFPGDVFYLHSRLLERAAKMSDQAGAGSLTALPV
IETQAGDVSAYIPTNVISITDGQIFLETELFYRGIRPAINVGLSVSRVGSAAQLKAMKQV
CGSLKLELAQYREVAAFAQFGSDLDAATQYLLNRGARLTEVLKQPQYSPISIEKQVVVIY
AAVKGYLDQIQISQILKYEQELLKSIDPSLLSAIAQQKTITEQIDSQLANFCQKFTQSFL
ATHSG

Ad blocker interference detected!


Wikia is a free-to-use site that makes money from advertising. We have a modified experience for viewers using ad blockers

Wikia is not accessible if you’ve made further modifications. Remove the custom ad blocker rule(s) and the page will load as expected.