FANDOM


&&&&&&&&&&&&&&&&&&&& BEGIN  /usr/local/www/html/proteins/Compiled_Programs/WYRM/PyMOL_highlight_conserved_residues &&&&&&&&&&&&&&&&&&&&

Successfully read 2 file paths from WYRM_file_paths.txt

generic_input                                         /usr/local/www/html/proteins/workspace/
generic_output                                        /usr/local/www/html/proteins/htdocs/results/

======================================================

Sequence file type = 3

Sequence type = 3

Got here 1
Got here 2
Got here 3
Sequence 1
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Sequence 2
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Read 2 amino_acid sequences from PIR Sequence file /usr/local/www/html/proteins/workspace/At2g07360-780-1196-1mv3A.pir.txt

======================================================

Assigned types to 1196 residues in Sequence 2-07360, 10 remain unknown
Assigned types to 116 residues in Sequence 1mv3A, 1090 remain unknown

======================================================

Successfully read 576 entries for residue match scoring matrix /usr/local/www/html/proteins/workspace/BLOSUM62.dat

Read the residue match scoring matrix /usr/local/www/html/proteins/workspace/BLOSUM62.dat

======================================================

Translated sequence file At2g07360-780-1196-1mv3A.pir.txt into sequence alignment.

======================================================

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB2 in residue ASP 270

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB3 in residue ASP 270

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HA2 in residue GLY 271

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HA3 in residue GLY 271

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB2 in residue SER 272

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB3 in residue SER 272

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB2 in residue PRO 273

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB3 in residue PRO 273

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HG2 in residue PRO 273

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HG3 in residue PRO 273

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HD2 in residue PRO 273

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HD3 in residue PRO 273

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB1 in residue ALA 274

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB2 in residue ALA 274

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB3 in residue ALA 274

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB1 in residue ALA 275

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB2 in residue ALA 275

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB3 in residue ALA 275

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB2 in residue PRO 277

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB3 in residue PRO 277

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HG2 in residue PRO 277

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HG3 in residue PRO 277

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HD2 in residue PRO 277

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HD3 in residue PRO 277

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB2 in residue GLU 278

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB3 in residue GLU 278

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HG2 in residue GLU 278

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HG3 in residue GLU 278

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom 3HG1 in residue ILE 279

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB2 in residue ARG 280

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB3 in residue ARG 280

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HG2 in residue ARG 280

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HG3 in residue ARG 280

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HD2 in residue ARG 280

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HD3 in residue ARG 280

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB2 in residue ASN 282

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB3 in residue ASN 282

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB2 in residue HIS 283

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB3 in residue HIS 283

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB2 in residue GLU 284

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB3 in residue GLU 284

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HG2 in residue GLU 284

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HG3 in residue GLU 284

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB2 in residue PRO 285

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB3 in residue PRO 285

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HG2 in residue PRO 285

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HG3 in residue PRO 285

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HD2 in residue PRO 285

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HD3 in residue PRO 285

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB2 in residue GLU 286

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB3 in residue GLU 286

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HG2 in residue GLU 286

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HG3 in residue GLU 286

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB2 in residue PRO 287

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB3 in residue PRO 287

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HG2 in residue PRO 287

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HG3 in residue PRO 287

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HD2 in residue PRO 287

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HD3 in residue PRO 287

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB1 in residue ALA 288

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB2 in residue ALA 288

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB3 in residue ALA 288

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HA2 in residue GLY 289

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HA3 in residue GLY 289

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HA2 in residue GLY 290

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HA3 in residue GLY 290

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB1 in residue ALA 291

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB2 in residue ALA 291

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB3 in residue ALA 291

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB2 in residue PRO 293

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB3 in residue PRO 293

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HG2 in residue PRO 293

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HG3 in residue PRO 293

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HD2 in residue PRO 293

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HD3 in residue PRO 293

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HA2 in residue GLY 294

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HA3 in residue GLY 294

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB1 in residue ALA 295

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB2 in residue ALA 295

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB3 in residue ALA 295

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB2 in residue LEU 297

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB3 in residue LEU 297

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB2 in residue PRO 298

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB3 in residue PRO 298

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HG2 in residue PRO 298

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HG3 in residue PRO 298

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HD2 in residue PRO 298

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HD3 in residue PRO 298

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB2 in residue LYS 299

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB3 in residue LYS 299

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HG2 in residue LYS 299

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HG3 in residue LYS 299

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HD2 in residue LYS 299

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HD3 in residue LYS 299

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HE2 in residue LYS 299

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HE3 in residue LYS 299

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HZ1 in residue LYS 299

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HZ2 in residue LYS 299

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HZ3 in residue LYS 299

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB2 in residue SER 300

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB3 in residue SER 300

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB2 in residue PRO 301

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB3 in residue PRO 301

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HG2 in residue PRO 301

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HG3 in residue PRO 301

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HD2 in residue PRO 301

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HD3 in residue PRO 301

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB2 in residue SER 302

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB3 in residue SER 302

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB2 in residue GLN 303

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB3 in residue GLN 303

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HG2 in residue GLN 303

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HG3 in residue GLN 303

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB2 in residue LEU 304

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB3 in residue LEU 304

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB2 in residue ARG 305

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB3 in residue ARG 305

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HG2 in residue ARG 305

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HG3 in residue ARG 305

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HD2 in residue ARG 305

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HD3 in residue ARG 305

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB2 in residue LYS 306

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB3 in residue LYS 306

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HG2 in residue LYS 306

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HG3 in residue LYS 306

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HD2 in residue LYS 306

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HD3 in residue LYS 306

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HE2 in residue LYS 306

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HE3 in residue LYS 306

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HZ1 in residue LYS 306

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HZ2 in residue LYS 306

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HZ3 in residue LYS 306

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HA2 in residue GLY 307

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HA3 in residue GLY 307

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB2 in residue PRO 308

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB3 in residue PRO 308

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HG2 in residue PRO 308

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HG3 in residue PRO 308

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HD2 in residue PRO 308

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HD3 in residue PRO 308

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB2 in residue PRO 309

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB3 in residue PRO 309

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HG2 in residue PRO 309

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HG3 in residue PRO 309

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HD2 in residue PRO 309

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HD3 in residue PRO 309

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB2 in residue PRO 311

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB3 in residue PRO 311

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HG2 in residue PRO 311

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HG3 in residue PRO 311

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HD2 in residue PRO 311

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HD3 in residue PRO 311

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB2 in residue PRO 312

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB3 in residue PRO 312

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HG2 in residue PRO 312

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HG3 in residue PRO 312

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HD2 in residue PRO 312

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HD3 in residue PRO 312

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB2 in residue PRO 313

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB3 in residue PRO 313

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HG2 in residue PRO 313

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HG3 in residue PRO 313

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HD2 in residue PRO 313

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HD3 in residue PRO 313

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB2 in residue PRO 314

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB3 in residue PRO 314

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HG2 in residue PRO 314

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HG3 in residue PRO 314

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HD2 in residue PRO 314

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HD3 in residue PRO 314

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB2 in residue LYS 315

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB3 in residue LYS 315

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HG2 in residue LYS 315

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HG3 in residue LYS 315

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HD2 in residue LYS 315

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HD3 in residue LYS 315

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HE2 in residue LYS 315

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HE3 in residue LYS 315

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HZ1 in residue LYS 315

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HZ2 in residue LYS 315

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HZ3 in residue LYS 315

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB2 in residue HIS 316

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB3 in residue HIS 316

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB2 in residue PRO 318

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB3 in residue PRO 318

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HG2 in residue PRO 318

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HG3 in residue PRO 318

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HD2 in residue PRO 318

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HD3 in residue PRO 318

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB2 in residue SER 319

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB3 in residue SER 319

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB2 in residue LYS 320

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB3 in residue LYS 320

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HG2 in residue LYS 320

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HG3 in residue LYS 320

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HD2 in residue LYS 320

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HD3 in residue LYS 320

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HE2 in residue LYS 320

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HE3 in residue LYS 320

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HZ1 in residue LYS 320

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HZ2 in residue LYS 320

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HZ3 in residue LYS 320

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB2 in residue GLU 321

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB3 in residue GLU 321

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HG2 in residue GLU 321

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HG3 in residue GLU 321

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB2 in residue LYS 323

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB3 in residue LYS 323

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HG2 in residue LYS 323

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HG3 in residue LYS 323

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HD2 in residue LYS 323

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HD3 in residue LYS 323

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HE2 in residue LYS 323

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HE3 in residue LYS 323

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HZ1 in residue LYS 323

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HZ2 in residue LYS 323

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HZ3 in residue LYS 323

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB2 in residue GLN 324

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB3 in residue GLN 324

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HG2 in residue GLN 324

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HG3 in residue GLN 324

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB2 in residue GLU 325

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB3 in residue GLU 325

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HG2 in residue GLU 325

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HG3 in residue GLU 325

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB2 in residue GLN 326

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB3 in residue GLN 326

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HG2 in residue GLN 326

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HG3 in residue GLN 326

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom 3HG1 in residue ILE 327

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB2 in residue LEU 328

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB3 in residue LEU 328

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB2 in residue SER 329

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB3 in residue SER 329

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB2 in residue LEU 330

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB3 in residue LEU 330

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB2 in residue PHE 331

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB3 in residue PHE 331

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB2 in residue GLU 332

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB3 in residue GLU 332

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HG2 in residue GLU 332

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HG3 in residue GLU 332

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB2 in residue ASP 333

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB3 in residue ASP 333

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB2 in residue PHE 335

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB3 in residue PHE 335

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB2 in residue PRO 337

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB3 in residue PRO 337

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HG2 in residue PRO 337

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HG3 in residue PRO 337

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HD2 in residue PRO 337

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HD3 in residue PRO 337

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB2 in residue GLU 338

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB3 in residue GLU 338

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HG2 in residue GLU 338

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HG3 in residue GLU 338

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom 3HG1 in residue ILE 339

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB2 in residue SER 340

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB3 in residue SER 340

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB2 in residue PRO 344

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB3 in residue PRO 344

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HG2 in residue PRO 344

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HG3 in residue PRO 344

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HD2 in residue PRO 344

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HD3 in residue PRO 344

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB2 in residue SER 345

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB3 in residue SER 345

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB2 in residue GLN 346

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB3 in residue GLN 346

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HG2 in residue GLN 346

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HG3 in residue GLN 346

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB2 in residue PRO 347

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB3 in residue PRO 347

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HG2 in residue PRO 347

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HG3 in residue PRO 347

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HD2 in residue PRO 347

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HD3 in residue PRO 347

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB1 in residue ALA 348

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB2 in residue ALA 348

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB3 in residue ALA 348

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB2 in residue GLU 349

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB3 in residue GLU 349

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HG2 in residue GLU 349

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HG3 in residue GLU 349

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB1 in residue ALA 350

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB2 in residue ALA 350

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB3 in residue ALA 350

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB2 in residue SER 351

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB3 in residue SER 351

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB2 in residue GLU 352

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB3 in residue GLU 352

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HG2 in residue GLU 352

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HG3 in residue GLU 352

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB1 in residue ALA 354

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB2 in residue ALA 354

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB3 in residue ALA 354

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HA2 in residue GLY 355

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HA3 in residue GLY 355

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HA2 in residue GLY 356

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HA3 in residue GLY 356

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB2 in residue GLN 358

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB3 in residue GLN 358

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HG2 in residue GLN 358

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HG3 in residue GLN 358

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB2 in residue PRO 359

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB3 in residue PRO 359

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HG2 in residue PRO 359

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HG3 in residue PRO 359

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HD2 in residue PRO 359

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HD3 in residue PRO 359

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB1 in residue ALA 360

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB2 in residue ALA 360

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB3 in residue ALA 360

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB1 in residue ALA 361

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB2 in residue ALA 361

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB3 in residue ALA 361

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HA2 in residue GLY 362

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HA3 in residue GLY 362

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB1 in residue ALA 363

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB2 in residue ALA 363

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB3 in residue ALA 363

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB2 in residue GLN 364

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB3 in residue GLN 364

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HG2 in residue GLN 364

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HG3 in residue GLN 364

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB2 in residue GLU 365

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB3 in residue GLU 365

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HG2 in residue GLU 365

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HG3 in residue GLU 365

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB2 in residue PRO 366

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB3 in residue PRO 366

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HG2 in residue PRO 366

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HG3 in residue PRO 366

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HD2 in residue PRO 366

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HD3 in residue PRO 366

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HA2 in residue GLY 367

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HA3 in residue GLY 367

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB2 in residue GLU 368

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB3 in residue GLU 368

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HG2 in residue GLU 368

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HG3 in residue GLU 368

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB1 in residue ALA 370

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB2 in residue ALA 370

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB3 in residue ALA 370

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB1 in residue ALA 371

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB2 in residue ALA 371

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB3 in residue ALA 371

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB2 in residue SER 372

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB3 in residue SER 372

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB2 in residue GLU 373

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB3 in residue GLU 373

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HG2 in residue GLU 373

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HG3 in residue GLU 373

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB1 in residue ALA 374

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB2 in residue ALA 374

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB3 in residue ALA 374

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB1 in residue ALA 375

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB2 in residue ALA 375

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB3 in residue ALA 375

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB2 in residue SER 376

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB3 in residue SER 376

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB2 in residue SER 377

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB3 in residue SER 377

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB2 in residue SER 378

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB3 in residue SER 378

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB2 in residue LEU 379

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB3 in residue LEU 379

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB2 in residue PRO 380

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB3 in residue PRO 380

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HG2 in residue PRO 380

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HG3 in residue PRO 380

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HD2 in residue PRO 380

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HD3 in residue PRO 380

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB1 in residue ALA 381

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB2 in residue ALA 381

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB3 in residue ALA 381

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB2 in residue GLU 385

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB3 in residue GLU 385

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HG2 in residue GLU 385

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HG3 in residue GLU 385

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB2 in residue PHE 387

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB3 in residue PHE 387

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB2 in residue PRO 388

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB3 in residue PRO 388

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HG2 in residue PRO 388

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HG3 in residue PRO 388

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HD2 in residue PRO 388

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HD3 in residue PRO 388

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB1 in residue ALA 389

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB2 in residue ALA 389

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB3 in residue ALA 389

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB2 in residue ASN 392

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB3 in residue ASN 392

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HA2 in residue GLY 393

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HA3 in residue GLY 393

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB2 in residue GLU 396

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB3 in residue GLU 396

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HG2 in residue GLU 396

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HG3 in residue GLU 396

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HA2 in residue GLY 397

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HA3 in residue GLY 397

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HA2 in residue GLY 398

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HA3 in residue GLY 398

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB2 in residue SER 399

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB3 in residue SER 399

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HA2 in residue GLY 400

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HA3 in residue GLY 400

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB1 in residue ALA 401

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB2 in residue ALA 401

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB3 in residue ALA 401

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HA2 in residue GLY 402

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HA3 in residue GLY 402

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB2 in residue ARG 403

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB3 in residue ARG 403

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HG2 in residue ARG 403

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HG3 in residue ARG 403

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HD2 in residue ARG 403

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HD3 in residue ARG 403

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB2 in residue LEU 404

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB3 in residue LEU 404

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB2 in residue ASP 405

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB3 in residue ASP 405

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB2 in residue LEU 406

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB3 in residue LEU 406

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB2 in residue PRO 407

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB3 in residue PRO 407

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HG2 in residue PRO 407

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HG3 in residue PRO 407

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HD2 in residue PRO 407

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HD3 in residue PRO 407

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB2 in residue PRO 408

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB3 in residue PRO 408

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HG2 in residue PRO 408

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HG3 in residue PRO 408

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HD2 in residue PRO 408

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HD3 in residue PRO 408

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HA2 in residue GLY 409

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HA3 in residue GLY 409

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB2 in residue PHE 410

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB3 in residue PHE 410

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB2 in residue MET 411

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB3 in residue MET 411

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HG2 in residue MET 411

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HG3 in residue MET 411

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HE1 in residue MET 411

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HE2 in residue MET 411

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HE3 in residue MET 411

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB2 in residue PHE 412

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB3 in residue PHE 412

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB2 in residue LYS 413

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB3 in residue LYS 413

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HG2 in residue LYS 413

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HG3 in residue LYS 413

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HD2 in residue LYS 413

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HD3 in residue LYS 413

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HE2 in residue LYS 413

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HE3 in residue LYS 413

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HZ1 in residue LYS 413

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HZ2 in residue LYS 413

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HZ3 in residue LYS 413

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB2 in residue GLN 415

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB3 in residue GLN 415

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HG2 in residue GLN 415

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HG3 in residue GLN 415

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB1 in residue ALA 416

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB2 in residue ALA 416

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB3 in residue ALA 416

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB2 in residue GLN 417

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB3 in residue GLN 417

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HG2 in residue GLN 417

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HG3 in residue GLN 417

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB2 in residue HIS 418

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB3 in residue HIS 418

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB2 in residue ASP 419

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB3 in residue ASP 419

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB2 in residue TYR 420

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB3 in residue TYR 420

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB1 in residue ALA 422

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB2 in residue ALA 422

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB3 in residue ALA 422

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB2 in residue ASP 424

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB3 in residue ASP 424

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB2 in residue ASP 426

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB3 in residue ASP 426

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB2 in residue GLU 427

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB3 in residue GLU 427

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HG2 in residue GLU 427

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HG3 in residue GLU 427

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB2 in residue LEU 428

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB3 in residue LEU 428

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB2 in residue GLN 429

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB3 in residue GLN 429

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HG2 in residue GLN 429

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HG3 in residue GLN 429

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB2 in residue LEU 430

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB3 in residue LEU 430

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB2 in residue LYS 431

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB3 in residue LYS 431

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HG2 in residue LYS 431

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HG3 in residue LYS 431

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HD2 in residue LYS 431

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HD3 in residue LYS 431

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HE2 in residue LYS 431

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HE3 in residue LYS 431

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HZ1 in residue LYS 431

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HZ2 in residue LYS 431

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HZ3 in residue LYS 431

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB1 in residue ALA 432

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB2 in residue ALA 432

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB3 in residue ALA 432

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HA2 in residue GLY 433

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HA3 in residue GLY 433

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB2 in residue ASP 434

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB3 in residue ASP 434

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB2 in residue LEU 437

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB3 in residue LEU 437

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom 3HG1 in residue ILE 439

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB2 in residue PRO 440

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB3 in residue PRO 440

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HG2 in residue PRO 440

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HG3 in residue PRO 440

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HD2 in residue PRO 440

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HD3 in residue PRO 440

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB2 in residue PHE 441

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB3 in residue PHE 441

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB2 in residue GLN 442

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB3 in residue GLN 442

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HG2 in residue GLN 442

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HG3 in residue GLN 442

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB2 in residue ASN 443

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB3 in residue ASN 443

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB2 in residue PRO 444

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB3 in residue PRO 444

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HG2 in residue PRO 444

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HG3 in residue PRO 444

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HD2 in residue PRO 444

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HD3 in residue PRO 444

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB2 in residue GLU 445

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB3 in residue GLU 445

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HG2 in residue GLU 445

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HG3 in residue GLU 445

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB2 in residue GLU 446

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB3 in residue GLU 446

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HG2 in residue GLU 446

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HG3 in residue GLU 446

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB2 in residue GLN 447

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB3 in residue GLN 447

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HG2 in residue GLN 447

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HG3 in residue GLN 447

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB2 in residue ASP 448

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB3 in residue ASP 448

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB2 in residue GLU 449

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB3 in residue GLU 449

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HG2 in residue GLU 449

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HG3 in residue GLU 449

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HA2 in residue GLY 450

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HA3 in residue GLY 450

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB2 in residue TRP 451

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB3 in residue TRP 451

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB2 in residue LEU 452

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB3 in residue LEU 452

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB2 in residue MET 453

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB3 in residue MET 453

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HG2 in residue MET 453

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HG3 in residue MET 453

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HE1 in residue MET 453

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HE2 in residue MET 453

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HE3 in residue MET 453

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HA2 in residue GLY 454

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HA3 in residue GLY 454

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB2 in residue LYS 456

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB3 in residue LYS 456

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HG2 in residue LYS 456

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HG3 in residue LYS 456

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HD2 in residue LYS 456

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HD3 in residue LYS 456

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HE2 in residue LYS 456

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HE3 in residue LYS 456

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HZ1 in residue LYS 456

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HZ2 in residue LYS 456

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HZ3 in residue LYS 456

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB2 in residue GLU 457

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB3 in residue GLU 457

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HG2 in residue GLU 457

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HG3 in residue GLU 457

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB2 in residue SER 458

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB3 in residue SER 458

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB2 in residue ASP 459

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB3 in residue ASP 459

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB2 in residue TRP 460

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB3 in residue TRP 460

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB2 in residue ASN 461

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB3 in residue ASN 461

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB2 in residue GLN 462

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB3 in residue GLN 462

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HG2 in residue GLN 462

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HG3 in residue GLN 462

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB2 in residue HIS 463

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB3 in residue HIS 463

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB2 in residue LYS 464

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB3 in residue LYS 464

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HG2 in residue LYS 464

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HG3 in residue LYS 464

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HD2 in residue LYS 464

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HD3 in residue LYS 464

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HE2 in residue LYS 464

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HE3 in residue LYS 464

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HZ1 in residue LYS 464

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HZ2 in residue LYS 464

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HZ3 in residue LYS 464

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB2 in residue LYS 465

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB3 in residue LYS 465

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HG2 in residue LYS 465

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HG3 in residue LYS 465

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HD2 in residue LYS 465

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HD3 in residue LYS 465

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HE2 in residue LYS 465

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HE3 in residue LYS 465

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HZ1 in residue LYS 465

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HZ2 in residue LYS 465

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HZ3 in residue LYS 465

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB2 in residue LEU 466

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB3 in residue LEU 466

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB2 in residue GLU 467

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB3 in residue GLU 467

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HG2 in residue GLU 467

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HG3 in residue GLU 467

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB2 in residue LYS 468

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB3 in residue LYS 468

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HG2 in residue LYS 468

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HG3 in residue LYS 468

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HD2 in residue LYS 468

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HD3 in residue LYS 468

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HE2 in residue LYS 468

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HE3 in residue LYS 468

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HZ1 in residue LYS 468

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HZ2 in residue LYS 468

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HZ3 in residue LYS 468

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB2 in residue CYS 469

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB3 in residue CYS 469

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB2 in residue ARG 470

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB3 in residue ARG 470

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HG2 in residue ARG 470

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HG3 in residue ARG 470

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HD2 in residue ARG 470

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HD3 in residue ARG 470

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HA2 in residue GLY 471

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HA3 in residue GLY 471

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB2 in residue PHE 473

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB3 in residue PHE 473

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB2 in residue PRO 474

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB3 in residue PRO 474

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HG2 in residue PRO 474

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HG3 in residue PRO 474

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HD2 in residue PRO 474

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HD3 in residue PRO 474

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB2 in residue GLU 475

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB3 in residue GLU 475

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HG2 in residue GLU 475

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HG3 in residue GLU 475

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB2 in residue ASN 476

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB3 in residue ASN 476

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB2 in residue PHE 477

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB3 in residue PHE 477

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB2 in residue GLU 479

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB3 in residue GLU 479

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HG2 in residue GLU 479

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HG3 in residue GLU 479

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB2 in residue ARG 480

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB3 in residue ARG 480

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HG2 in residue ARG 480

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HG3 in residue ARG 480

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HD2 in residue ARG 480

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HD3 in residue ARG 480

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB2 in residue PRO 482

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HB3 in residue PRO 482

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HG2 in residue PRO 482

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HG3 in residue PRO 482

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HD2 in residue PRO 482

Error in function WYRM_assign_PDB_Atom_type()
Unable to assign atom HD3 in residue PRO 482

>1MV3.pdb  Made from 3107 ATOM records in 1MV3.pdb
DGSPAATPEIRVNHEPEPAGGATPGATLPKSPSQLRKGPPVPPPPKHTPS
KEVKQEQILSLFEDTFVPEISVTTPSQPAEASEVAGGTQPAAGAQEPGET
AASEAASSSLPAVVVETFPATVNGTVEGGSGAGRLDLPPGFMFKVQAQHD
YTATDTDELQLKAGDVVLVIPFQNPEEQDEGWLMGVKESDWNQHKKLEKC
RGVFPENFTERVP

======================================================

Best alignment:
1MV3.pdb   147  AQHDYTATDTDELQLKA   163
                A +D+TA   DEL L A
2-07360   1141  ALYDFTAGGDDELNLTA  1157

======================================================

Highlighted IDENTICAL residue ALA  416  index1  147  path 1141  %Seq 100.00
Highlighted IDENTICAL residue ASP  419  index1  150  path 1144  %Seq 100.00
Highlighted IDENTICAL residue THR  421  index1  152  path 1146  %Seq 100.00
Highlighted IDENTICAL residue ALA  422  index1  153  path 1147  %Seq 100.00
Highlighted IDENTICAL residue ASP  426  index1  157  path 1151  %Seq 100.00
Highlighted IDENTICAL residue GLU  427  index1  158  path 1152  %Seq 100.00
Highlighted IDENTICAL residue LEU  428  index1  159  path 1153  %Seq 100.00
Highlighted IDENTICAL residue LEU  430  index1  161  path 1155  %Seq 100.00
Highlighted IDENTICAL residue ALA  432  index1  163  path 1157  %Seq 100.00
Highlighted 9 residues for visualization

Wrote PyMOL macro into file /usr/local/www/html/proteins/htdocs/results/At2g07360-780-1196-1mv3A.pir.txt.1MV3.pdb.conservation.pml

===============================================================================

The program

/usr/local/www/html/proteins/Compiled_Programs/WYRM/PyMOL_highlight_conserved_residues At2g07360-780-1196-1mv3A.pir.txt PIR amino_acid 1MV3.pdb _ 100.0 BLOSUM62.dat 

completed successfully.

@@@@@@@@@@@@@@@@@@@@ END  /usr/local/www/html/proteins/Compiled_Programs/WYRM/PyMOL_highlight_conserved_residues @@@@@@@@@@@@@@@@@@@@


Ad blocker interference detected!


Wikia is a free-to-use site that makes money from advertising. We have a modified experience for viewers using ad blockers

Wikia is not accessible if you’ve made further modifications. Remove the custom ad blocker rule(s) and the page will load as expected.