FANDOM


>gi|42568981|ref|NP_178746.2|	   1196 residues, 50 /line  SH3 domain-containing protein [Arabidopsis thaliana]
---------------------------------MAESSGTTLMDLISAD-----------
----------------------------------PTPVPAQSTSSSASSTASQPTSASAS
SSSHLHHPMSTKTTLGEKKSKRATLMQIQNDTISVAKAALNPV-KANIMPQRQRQKKKPV
SYSQLARSI--------HELAATLDQKSSQKQL----VNHVFPKLAVYNSVDPSLAPSLL
MLNQQCEDRNVLRYVYYYL----ARILSDT------------------------------
------------------GMTPGGGIPTPNWDALADIDAGGGV-TRADVVPRIVNQLT--
NEATNSEFEFHARRLQALKA----------------------------------------
-----------------LTYSPSGNSELLSKLYEIVFG----------------------
--------------------ILEKVGDVPH------------------------------
------------------------------------------------------------
-----------------------------------------------KRKKGVFGTKGGD
KESIMRSNLQYAAMSALRRLPLDPGNPLFLHRAAQGVFFADPVA----------------
----VRHSLEILSELATRDPYTV-AM--TLEKLASPTGA---------------------
-----------------------------LQDILHMNDVLARVSLARLCHSISRARALDE
RPDIRSQFNSILYQLLLDPSERVCYEAILCILGKHDNTERMDE-RAAGWYRLTREILKLP
EAPSLSSK------DKSNKTKRPQPLIKLVMRRLESSFRSFSRPVLHAAARVVQEMGKSR
AAAFAMGLQDIDESVHVNAFSDALD--DAETNESSHPEGIRRTSSISAGPGRSDTIASLL
AALMEVVRTTVACECVYVRAMVIKAL-----IWMQSPDESL------------DELKSII
ASELSD----PGWPAALVNDVLLTLHARFKATPD-------------MAVILLEI-----
---------------------------ARIFATK------VPGKIDADVLQLLWK-----
------------------------------------------------------------
---------------------------------------------------------TCL
-----------VGAGPDGKHTALEA-VTIVL-DLPP-----------------------P
QPGSMAG-----LTSIDRVSASDPKSALALQKLVQ-AAVWFLGENANYAASEYAWESATP
PGTALMMLDA-------------------DKMVAAASSRNPTLAGALTRLQRC-----AF
SGSWEVRIVAIQALTTIAIR-SGEPFRLQ-------IYEFLYTLAEGGVQSQLSEM----
---------HLSNGEDQGASGTGLGV--LITPMLKVLDEMYV---GQDELIKDIRHHDNA
NKEWKDEELKKLYENHERLLDFVSMFCFIPRAKYLPLGPISAKLIDTYRTKHNITASTGS
T------DPAVVA-T---GISDLIYESTQ--PAPAASN----SSGLDDDLVNAWAANLGD
D------------GLLGNNAPAMSRVNEFIAGV-GTDAPDVE-EENVFSRPSVGYDDMWA
KTLLETSELEEEDAR---------------------------------------------
-SGSS------------SPDSAGSVESSISSHF------GGMNYPSLFSSKPSSQATAKS
GGSKYQSTYEGYGSPIREEPPPPYSYSEPQSRESFENPVAGSGSRSYES---DDEEPR-K
STG-TRF----GTALYDFTAGGDDELNLT-------------------------------
AEEELEIEYE-VD---GWFYVKKKRPGRDGKMAGLVPVLYV-------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------------------NQ------------
-----S
>gi|109123258|ref|XP_001100995.1|	   715 residues, 50 /line  PREDICTED: myosin IF [Macaca mulatta]
----------------------------MGSK----------------------------
------------------------------------------------------------
---------------------------------ERFHWQSHNV-KQSGVDDMVLLPQITE
DAIAANLRK--------RFMDDYIFTYIGSVLI----SV------NPFKQMPY----FTD
REIDLYQGAAQYENPPHIY----ALTDNMYRNMLI---------------DCENQCVI--
----------------ISGESGAGKTVAAKYIMGYISKVSGGGN-KVQHVKDIILQSN--
------------PLLEAFGN----------------------------------------
-----------------AKTVRNNNSSRFGKYFEIQFSRGGEPD------GGKISNFLLE
KSRVVMQNENERNFHIYYQLLEGASQEQRQNLGLMTPDYYYY------------------
-LNQSDTYQVDGTDDRSDFGETLSAMQVIG---IPPSIQQ------------LVLQLVAG
ILHLGNISFCED-------GNYARVES-------VDLL---AFPAYL-------------
------------------------------------------------------------
--------------LGIDSGRLQ-EK--LTSRKMDSRWGGRS------------------
--------------------ESI-DVTLNVEQAAYTRDALAKGLYARLFDFL--------
------------------------------------------------------------
------------------------------------------------------------
---------VEAIN-----------------------RAMQ-KPQEEYSIGVLDIYGFEI
FQKNGFEQFCINFVNEKLQQIFIELT-----LKAEQEEYVQEGIRWTPI----QYFNNKV
VCDLIENKLSPPGIMSVLDDVCATMHATGGGADQ-------------TLLQKLQAAVGTH
EH-FNSWSAGFVIH-----------HYAGKVSYDVSGF----------------------
---------------------------------------CERNRDVLFSDLIELMQT--S
EQAFL-RMLFPEKLDGDKKGRPSTAGSKIK------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------VGLGCM--------------------
------------------------------------------------------------
------------------------------------------------------------
--DRNGVPPSARGGPLPLEIMSGG-SSHRPPRGPPSTSL-----GASRRPR-AQLPSEHN
TEFLNVPDQGMAG----MQRKRSVGQ---------------RPVPGVGR---PKPQPR--
-TH-GPR----CRALYQYVGQDVDELSFN-------------------------------
VNEVIEILMEDSS---GWWKG--RLHGQE----GLFPGNYV-------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------------------EK------------
-----I
>gi|147898703|ref|NP_001086041.1|	   1096 residues, 50 /line  MGC81789 protein [Xenopus laevis]
----------------------------MGSK----------------------------
------------------------------------------------------------
---------------------------------ERYHWQSQNV-KQSGVDDMVLLSKITE
DAIVENLKK--------RYSDDYIFTYIGSVLI----SV------NPFKQMPY----FTE
REIELYQGAAQYENPPHIY----ALTDNMYRNMLI---------------DGENQCVI--
----------------ISGESGAGKTVAAKYIMGYISKVSGGGN-KVQHVKDIILQSN--
------------PLLEAFGN----------------------------------------
-----------------AKTVRNNNSSRFGKYFEIQFSRGGEPD------GGKISNFLLE
KSRVVSQNENERNFHVFYQMIEGASDEQRQNLGIMTADYFFY------------------
-LNQSETYKVEGTDDKKDFYEMLEAMKVIG---VSAEEQQ------------MVLQIAAG
ILHLGNISFQEQ-------GNYAKVEC-------HDIL---DFPAYL-------------
------------------------------------------------------------
--------------LGIQKERLN-DK--LTSRKMDSKWGGRS------------------
--------------------ESI-TVTLNVEQASYTRDALSKALYSRVFDFL--------
------------------------------------------------------------
------------------------------------------------------------
---------VESIN-----------------------KAMQ-KPYEEYSIGVLDIYGFEI
FQKNGFEQFCINFVNEKLQQIFIELT-----LKAEQEEYVAEGIRWTPI----EYFNNKI
VCDLIENKLNPPGIMSVLDDVCATMHATSGGADQ-------------TLLQKLQAAVGTH
EH-FSNWNLGFVIH-----------HYAGKVSYYVEGF----------------------
---------------------------------------CERNRDVLFIDLIELMQS--S
ESQFIAQSLFPERLDSDKKSRPTTAGSKIKKQ---AND----LVNTL--MKCTPHYIRCI
K-PNE------TKRPKDWEESRVKH-QVEYL-GLKE-----------------------N
IRVRRAG-----FAYRRVFNKFLQRYAILTQET--------------WP----RWRGDER
QGVQHLLRSVNMDSDQYQMGKSKVFVKNPESLFLLEEMRERKFDTFARTIQKAWRRYIAR
R--------------------KYEQMREE-------ASNILYGFKE--------RR----
---------RNSI--NRNFVGDYLGM--EDRPELRQFMTKR----ERIDFADS-------
-----VSKYDRRFKSIKRDLILSPKYLYLIGREKVKKGPEKGQIKEVLKKKVETMNIQSI
SLSTRQDDFFILH-E---VDHDTLMESVFK-TELISLMCKRYEEITSRKLRLNFTDTLQM
RVKKEGWG---GGGTRNLQFTRGQGEIAMQKAGGKTLVVSIGDGLPKNSK---PTRKGAP
ESRG--------------------------------------HRAPPSRSAPAPP---SS
GTFRNGAPQFPKGT---ARNPSSA-QSSRQPRAPPSAAL-----PKQAAPRRSRVPSDQN
MDFLNVPDQGVAG----VQRKKSVSH---------------RPPPAVGR---PKPQSK--
-PA-GPR----CKAIYQYLGQDVDELSFN-------------------------------
VNDVIDIILEDPS---GWWKG--RLHGKE----GLFPGNYV-------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------------------QK------------
-----I
>gi|126323797|ref|XP_001376236.1|	   1124 residues, 50 /line  PREDICTED: similar to MYO1F variant protein [Monodelphis domestica]
MQLVNKWNGGLTQAQITEERSQPASIFHLGSK----------------------------
------------------------------------------------------------
---------------------------------ERFHWQSHNV-KQSGVDDMVLLPQINE
DAIVSNLKK--------RFLDDYIFTYIGSVLI----SV------NPFKQMPY----FTD
REIELYQGAAQYENPPHIY----ALTDNMYRNMLI---------------DCENQCVI--
----------------ISGESGAGKTVAAKYIMGYISKVSGGGD-KVQHVKDIILQSN--
------------PLLEAFGN----------------------------------------
-----------------AKTVRNNNSSRFGKYFEIQFSRGGEPD------GGKISNFLLE
KSRVVSQNENERNFHIYYQLLEGASQEQRQNLGIMTPDYYYY------------------
-LNQSDTYKVDGTNDLNDFHETLNAMQVIG---IPSNVQQ------------LVLQIVAG
ILHLGNISFCEE-------GNYARVEC-------TDLL---AFPAYL-------------
------------------------------------------------------------
--------------LAIDSGRLR-DK--LTSRKMDSRWGGRT------------------
--------------------ESI-NVTLGVEQAAYTRDALAKGLYARLFDFL--------
------------------------------------------------------------
------------------------------------------------------------
---------VEAIN-----------------------RAMQ-KPQEEFSIGVLDIYGFEI
FQRNGFEQFCINFVNEKLQQIFIELT-----LKAEQEEYVQEGIKWSPI----QYFNNKI
VCDLIENKLNPPGIMSVLDDVCATMHATGDGADQ-------------TLLQKLQGAVGCH
EH-FNSWNSGFVIH-----------HYAGKVSYDVNGF----------------------
---------------------------------------CERNRDVLFSDLIELMQS--S
EHAFI-RMLFPEKLDSEKKGRPSTAGSKIKRQ---ANN----LVDTL--KKCTPHYIRCI
K-PNE------TKRPRDWEESRVKH-QVEYL-GLKE-----------------------N
IRVRRAG-----FAYRRVFSKFLQRYAILTPET--------------WP----RWYGDER
QGVQHLLRSVNMDPDQYQMGRSKVFVKNPESLFLLEEMRERKFDGFARTIQKAWRRHVAV
R--------------------RYEQMREE-------ASNILLNKKE--------RR----
---------RNSI--NRNFVGDYLGL--ESRPELRQFLTKR----ERVDFADS-------
-----ITKYDRRFKPIKRDLILTHKYVYVIGREKVKKGPEKGQIQEVLKKKIEIQTLRGV
SLSTRQDDFFILH-E---AGADSFLESVFK-TELISLLCKRFQELTHNVLTLTFEDTLQF
RVKKEGWG---GGGSRTITFSRGPGEVATLKASGKTLLVSISDGLPKNSK---PTKKGPA
QGQR--------------------------------------RRPAPSRGAPAPS----R
GPTRNGAPHMARGGPSPLEQMSMG-GGPSSQRSPPATAL-----GVSRRPH-KRPPSEHN
MEFLNVPDQGMAG----MQRKRSIGQ---------------RPVPGVGR---PKPQPR--
-NS-GPR----CRALYQYVGQDVDELSFN-------------------------------
VNEVIDILLEDPS---GWWKG--RLHGQE----GLFPGNYV-------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------------------EK------------
-----I
>gi|45383938|ref|NP_990585.1|	   1099 residues, 50 /line  myosin IF [Gallus gallus]
----------------------------MGSK----------------------------
------------------------------------------------------------
---------------------------------ERFHWQSHNV-KQSGVDDMVLLAKISE
EAIVENLKK--------RFMDDYIFTYIGPVLI----SV------NPFKQMPY----FTD
REIELYQGAAQYENPPHIY----ALTDNMYRNMLI---------------DGENQCVI--
----------------ISGESGAGKTVAAKYIMGYISKVSGGGD-KVQHVKDIILQSN--
------------PLLEAFGN----------------------------------------
-----------------AKTVRNNNSSRFGKYFEIQFSRGGEPD------GGKISNFLLE
KSRVVSQNEHERNFHVYYQLIEGASQEQRQNLGIMSPDYYYY------------------
-LNQSDTYQVEGTDDRSDFLETMNAMQVIG---IRGEDQQ------------LVLQIVAG
ILHLGNISFREE-------GNYARVEN-------ADSL---AFPAYL-------------
------------------------------------------------------------
--------------LGIDRDRLN-DK--ITSRKMDSKWGGRS------------------
--------------------ESI-TVTLNVEQAAYTRDALAKGLYARVFDFL--------
------------------------------------------------------------
------------------------------------------------------------
---------VESIN-----------------------RAMQ-KPYEEYSIGVLDIYGFEI
FQKNGFEQFCINFVNEKLQQIFIELT-----LKAEQEEYVQEGIKWTQI----QYFNNKV
VCDLIENKLNPPGIMSVLDDVCATMHATGEGADQ-------------TLLQKLQAAVGTH
EH-FNSWSSGFVIH-----------HYAGKVSYDVNGF----------------------
---------------------------------------CERNRDVLFTDLIELMQS--S
EYAFI-RMLFPEKLDADKKGRPTTAGSKIKKQ---AND----LVNTL--MKCTPHYIRCI
K-PNE------TKKPRDWEESRVKH-QVEYL-GLKE-----------------------N
IRVRRAG-----FAYRRIFHKFLQRYAILTPET--------------WP----SWRGDER
QGVQHLLRSVNMDPDQYQMGRSKVFVKNPESLFLLEEMRERKFDGFARVIQKAWRRHIAI
R--------------------KYEQMREE-------ASSILYNFKE--------RR----
---------RNSI--NRNFVGDYLGM--EERPELRQFLAKR----ERIDFADS-------
-----ITKYDRRFKPIKRDFILTPKYFYLIGREKVKKGPEKGQIKEVLKKKVEIQAVSGV
SLSTRQDDFFILH-E---KDAYNFLESIFK-TELVSLLCKRYEELTRSKLRLNFQDTLQF
RVKKEGWG---GGGTRTVTFTRGQGDVAALKAGGKTLTVSIADGLPRNSK---PTRKEVM
QSKG------------------------------------GSRRPPPSRGVPPAP----Q
GTYRNGAPQFPRGD-GHAKRDTYT-TPQKQARAPPATALPPQ--NASRRSK-ARPPSEQN
MEFLNVPDQGVAG----MQRRRSVGQ---------------RPPPA-SR---PKPQPK--
-AA-VPR----CQALYQYIGQDVDELSFN-------------------------------
VGDVIDILLEDIS---GWWKG--RLHGRE----GLFPGNYV-------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------------------QK------------
-----I
>gi|62651832|ref|XP_234942.3|	   1098 residues, 50 /line  PREDICTED: similar to myosin IF [Rattus norvegicus]
----------------------------MGSK----------------------------
------------------------------------------------------------
---------------------------------ERFHWQSHNV-KQSGVDDMVLLPQITE
DAIVSNLRK--------RFMDDYIFTYIGSVLI----SV------NPFKQMPY----FTD
REIDLYQGAAQYENPPHIY----ALTDNMYRNMLI---------------DCENQCVI--
----------------ISGESGAGKTVAAKYIMGYISKVSGGGD-KVQHVKDIILQSN--
------------PLLEAFGN----------------------------------------
-----------------AKTVRNNNSSRFGKYFEIQFSRGGEPD------GGKISNFLLE
KSRVVMQNENERNFHIYYQLLEGASQEQQQNLGLMTPDYYYY------------------
-LNQSDTYKVEGTDDRSDFNETLNAMQVIG---IPTSVQQ------------LVLQLVAG
ILHLGNISFCEE-------GNYARVES-------VDLL---AFPAYL-------------
------------------------------------------------------------
--------------LGIDSGRLQ-EK--LTSRKMDSKWGGRS------------------
--------------------ESI-DVTLNVEQAAYTRDALAKGLYARLFDFL--------
------------------------------------------------------------
------------------------------------------------------------
---------VEAIN-----------------------RAMQ-KPQEEYSIGVLDIYGFEI
FQKNGFEQFCINFVNEKLQQIFIELT-----LKAEQEEYVQEGIRWTPI----EYFNNKI
VCDLIENKLNPPGIMSVLDDVCATMHATGGGADQ-------------TLLQKLQAAVGTH
EH-FNSWSAGFVIH-----------HYAGKVSYDVSGF----------------------
---------------------------------------CERNRDVLFSDLIELMQS--S
DQAFL-RMLFPEKLDVDKKGRPSTAGSKIKKQ---AND----LVSTL--KKCTPHYIRCI
K-PNE------TKRPRDWEESRVKH-QVEYL-GLRE-----------------------N
IRVRRAG-----FAYRRQFSKFLQRYAILTPET--------------WP----RWRGDER
QGVQHLLRAVNMEPDQYQMGSTKVFVKNPESLFLLEEMRERKFDGFARTIQKAWRRHIAV
R--------------------KYEEMREE-------ASNILLNKKE--------RR----
---------RNSI--NRNFVGDYLGL--EERPELRQFLAKR----ERVDFADS-------
-----VTKYDRRFKPIKRDLILTPKCVYVIGREKVKKGPEKGLVREVLKKKLEIQALRGV
SLSTRQDDFFILQ-E---EAADSFLESIFK-TEFVSLLCKRFEEAARRPLPLTFSDMLQF
RVKKEGWG---GGSTRNVTFSRGTGDLAVLKAGSRALTISIGDGLPKSTK---PTRKGLA
QGRP------------------------------------RRSAQAPTRAAPGPP----R
GLNRNGVPPSSQVRSLPMEITSGR-SSQRPPRGPPSSTL-----GASRRPR-ARPPSEHN
TEFLNVPDQGVAG----MQRKRSIGQ---------------RPVPGVGR---PKPQPR--
-TH-GPR----CRALYQYIGQDVDELSFN-------------------------------
VNEVIEILMEDSS---GWWKG--RLHGQE----GLFPGNYV-------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------------------EK------------
-----I
>gi|115709813|ref|XP_782519.2|	   1118 residues, 50 /line  PREDICTED: similar to amoeboid myosin I [Strongylocentrotus purpuratus]
------------------------------------------------------------
------------------------------------------------------------
---------------------------------MAYHWQSQGR-KTSGVEDMVLLSKIQE
GAIVENLKK--------RFMDDLIYTYIGPVLI----SI------NPFKQMPY----FTE
KEVDMYQGAAIYENPPHVY----ALTDDMYRNMLI---------------EYENQCVI--
----------------ISGESGAGKTVAAKYIMAYIAKVSGGGA-TVQHVKEVIIQSN--
------------PLLEAFGN----------------------------------------
-----------------AKTVRNNNSSRFGKYVEIQFTRAGAPD------GGKITNFLLE
KSRVVSQNTDERNFHIFYQLLCGANHQQKENLGLTTPDYYFY------------------
-LNQSGSYKVDGLDDVKEYKDTLNAMSVIG---ISEDDQE------------NVLSCVAG
ILHLGNIVFVEK-------DNYAVIHD-------DEFL---DFPSYL-------------
------------------------------------------------------------
--------------LGLDKEALR-KK--LISRRMDSKWGGKA------------------
--------------------EHI-EVTLNTEQAAHTRDALAKAVHSRLFDFL--------
------------------------------------------------------------
------------------------------------------------------------
---------VSSIN-----------------------GAMQ-KQKVEITIGVLDIYGFEI
FQQNGFEQFCINFVNEKLQQIFIELT-----LKAEQEEYVAEGIKWKKI----DYFNNKI
VCDLIESKV-PPGVMCILDDVCATMHAVSDGADE-------------KLLQKMNSAVGTH
QH-YGVLSGGFIVH-----------HYAGQVRYTVEGF----------------------
---------------------------------------CERNRDVLFTDLIELMQS--S
ENSFF-MTLFPEKIAGQAKSRPTTASSKIKTQ---ANK----LVDKL--MQCTPHYIRCI
K-PNE------TKRPQDWEEKRVYH-QVEYL-GLKE-----------------------N
IRVRRAG-----FAYRREFDKFLRRYAILTPET--------------WP----RWGGDVK
SGVNHLLRAVNMDTDEFQLGKTKVFIRKPESLFLLEEQRERKFDYHARIIQKAFRQFNAQ
K--------------------YYLRLKQQ-------ASDILFDKKE--------RR----
---------RYSL--NRNFVGDYIGF--EHNVSLQALVARR----ERIEFADK-------
-----VNKYDRRFKVTKRDLLLSGRNIYLIGREQIKKGPEKGQIRDVVKRKIPLNHIHSV
SLSTLQDDMFVLHVS---EEYDSILESTFK-TEFLTVLNKKFQETLQQKLMVNFNDSIEF
SVKKEGWG---GGGTRTVRFAQGQGDTAVLKPSSKILTVSIGSGLPRNSR---PGLRDVK
VTSKDRQAGNRGN--------SNRGNSNRGNG-------HVSRRPAPSQPAPGKPTAPYA
LVQKRGGPTSPTKG-GMKRTSSRR-KSGEQPHL------PKG--GAQIFAK-QFKNVINS
QDYLQTPDAGVSG----QKRRTIKGS---------------RPAPGAGR---PKPKPQPP
APS-RPK----CRTIYPYDAGDTDELSFG-------------------------------
EGETIEIILEDAS---GWWRG--KLRGRE----GLFPANYI-------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------------------EK------------
-----I
>gi|125821644|ref|XP_682849.2|	   1106 residues, 50 /line  PREDICTED: hypothetical protein [Danio rerio]
----------------------------MGSR----------------------------
------------------------------------------------------------
-------------------------------GHYRYHWQSHNV-KQSGVDDMVLLSKINE
DAIVENLKK--------RYMDDYIFTYIGPVLI----SV------NPFKQMPY----FGE
KEIEMYQGAAQYENPPHIY----ALADNMYRNMMI---------------DRENQCVI--
----------------ISGESGAGKTVAAKYIMGYISKVSGGGP-RVQHVKDIILQSN--
------------PLLEAFGN----------------------------------------
-----------------AKTVRNNNSSRFGKYFEIQFSSGGEPD------GGKISNFLLE
KSRVVMRNPGERSFHIFYQLIEGASGDQKSSLGITSLDYYTY------------------
-LNQSGSYKVDDINDKHDFQETLHAMDVIG---ISGIDRT------------MVLQIVAG
ILHLGNINFREA-------GNYAAVEN-------DEFL---AFPAFL-------------
------------------------------------------------------------
--------------LGIDQERLK-EK--LTSRKMDGKWGGKS------------------
--------------------ESI-DVTLNVEQACFTRDALSKALHSRVFDYL--------
------------------------------------------------------------
------------------------------------------------------------
---------VESIN-----------------------KAMV-KEHQELNIGVLDIYGFEI
FQKNGFEQFCINFVNEKLQQIFIELT-----LKAEQDEYVQEGIRWTQI----EYFNNKI
VCDLIESKINPPGIMSILDDVCATMHAKGEGADQ-------------TMLQKLRMQINNH
EH-FNSWNQGFIIH-----------HYAGKVSYDAEGF----------------------
---------------------------------------CERNRDVLFTDLIELMQS--S
EIAFI-RALFPENLNAEKKGRPTTAGSKIKKQ---AND----LVSTL--MKCTPHYIRCI
K-PNE------TKKPKDWEESRVKH-QVEYL-GLKE-----------------------N
IRVRRAG-----YAYRRIFRKFLNRYAILTKES--------------WP----TWRGDEK
QGVLHLLRSVNMDQDQYQLGHTKIFIKAPESLFLLEETRERKFDGYARTIQTAWRKYCAR
K--------------------KYVQMREE-------ASDLLLNKKE--------RR----
---------RHSL--NRNFVGDYLGM--DDRPELRQFMGKR----EKIDFADK-------
-----VNKFDRRFKSIKRDLILTPKSVYLIGREKVKQGPEKGLVKEVLKRKIDVEKILAV
SLSTLQDDFMILH-E---DEYDSLLECVFK-TEFISLLARRYEERTQRKLPLKYSNTMEM
KLKKEKWGPWNAGGSRQVQFMQGQGDVAVLRPSNKMLQVSIGPGLPKNSR---PTKKGIT
QSQP---------------------NRSRT------------HHHTPTRAAPGPPVAHQN
GGLKNAN----HRNSQHHNNQRPTSENTARPFL------PTNVSQLKERGS-RHAPQQPN
LDFLRVPDQGAAG----AHRQST--N---------------RPAPGGGR---PKPAPKP-
KPQ-VPQ----CKALYAYDAQDTDELSFN-------------------------------
ADDIIEIIKEDAS---GWWTG--RLRGKQ----GLFPNNYV-------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------------------TK------------
-----I
>gi|148694246|gb|EDL26193.1|	   1051 residues, 50 /line  myosin IE [Mus musculus]
----------------------------MGSK----------------------------
------------------------------------------------------------
-------------------------------GAYRYHWQSHNV-KHSGVDDMVLLSKITE
SSIVENLKK--------RYMDDYIFTYIGSVLI----SV------NPFKQMPY----FGE
KEIEMYQGAAQYENPPHIY----ALADSMYRNMII---------------DRENQCVI--
----------------ISGESGAGKTVAAKYIMSYVSRVSGGGP-KVQHVKDIILQSN--
------------PLLEAFGN----------------------------------------
-----------------AKTVRNNNSSRFGKYFEIQFSPGGEPD------GGKISNFLLE
KSRVVMRNPGERSFHIFYQLIEGASPEQKQSLGITSMDYYYY------------------
-LSLSGSYKVDDIDDKRDFQETLHAMNVIG---IFSEEQT------------LVLQIVAG
ILHLGNISFKEV-------GNYAAVES-------EEFL---AFPAYL-------------
------------------------------------------------------------
--------------LGINQDRLK-EK--LTSRQMDSKWGGKS------------------
--------------------ESI-HVTLNVEQACYTRDALAKALHARVFDFL--------
------------------------------------------------------------
------------------------------------------------------------
---------VDSIN-----------------------KAME-KDHEEYNIGVLDIYGFEI
FQKNGFEQFCINFVNEKLQQIFIELT-----LKAEQEEYVQEGIRWTPI----EYFNNKI
VCDLIESKVNPPGIMSILDDVCATMHAVGEGADQ-------------TLLQKLQMQIGSH
EH-FNSWNQGFIIH-----------HYAG-------------------------------
------------------------------------------------------------
-----------------------------KKQ---AND----LVSTL--MKCTPHYIRCI
K-PNE------TKKPKDWEESRVKH-QVEYL-GLKE-----------------------N
IRVRRAG-----YAYRRVFQKFLQRYAILTKAT--------------WP----VWRGDEK
QGVLHLLQSVNMDSDQFQLGRSKVFIKAPESLFLLEEMRERKYDGYARVIQKTWRKFVAR
K--------------------KYVQMREE-------ASDLLLNKKE--------RR----
---------RNSI--NRNFIGDYIGM--EERPELQQFVGKR----EKIDFADT-------
-----VTKYDRRFKGVKRDLLLTPKCLYLIGREKVKQGPDKGVVKEVLKRRIEVERILSV
SLSTMQDDIFILH-E---QEYDSLLESVFK-TEFLSLLAKRYEEKTQKQLPLKFSNTLEL
KLKKENWGPWSAGGSRQVQFHQGFGDLAILKPSNKVLQVSIGPGLPKNSR---PTRRNTV
TSRG---------------------YPGGT------------KNNYPMRAAPAPPGCHQN
GVIRNQFVPPPHAFGNQRSNQKSLYTSMARPPL------PRQQSTG---SD-RLSQTPES
LDFLKVPDQGVAG----VRRQTS--S---------------RPPPAGGR---PKPQPKP-
KPQ-VPQ----CKALYAYDAQDTDELSFN-------------------------------
ANDIIDIIKEDPS---GWWTG--RLRGKQ----GLFPNNYV-------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------------------TK------------
-----I
>gi|41055355|ref|NP_956930.1|	   1096 residues, 50 /line  hypothetical protein LOC393609 [Danio rerio]
----------------------------MGSK----------------------------
------------------------------------------------------------
---------------------------------EKYHWQTQNV-KVSGVDDMVLLSKITE
DAITDNLKK--------RYMDDYIFTYIGPVLI----SV------NPFKQLPY----FTD
REIELYQGAAQYENPPHIY----ALADNMYRNMMI---------------DSENQCVI--
----------------ISGESGAGKTVAAKYIMSYISKVSGGGP-KVQHVKDIILQSN--
------------PLLEAFGN----------------------------------------
-----------------AKTVRNNNSSRFGKYFEIQFSRGGEPD------GGKISNFLLE
KSRVVSQNNGERNFHIYYQLLKGATKEQRENLGVTTPDYYFY------------------
-LNQSDTYTVEDVNDKKEFEDTMNAMSVVG---LSMDAQD------------SVLQIVAG
ILHLGNIAFREE-------GNYAVVES-------EDFL---AFPSYL-------------
------------------------------------------------------------
--------------LGINQDGLK-SK--LTSRIMDSKWGGKT------------------
--------------------ETI-SVTLNTEQASFTRDALSKALYSRLFDYL--------
------------------------------------------------------------
------------------------------------------------------------
---------VDAIN-----------------------KAMQ-KDREELNIGVLDIYGFEI
FQKNGFEQFCINFVNEKLQQIFIELT-----LKAEQEEYVQEGISWTPI----EYFNNKV
VCDLIESKLNPPGIMSILDDVCATMHAKGEGADQ-------------TLLQKLQSQIGTH
EH-FNSWNKGFVVH-----------HYAGKVSYDVSGF----------------------
---------------------------------------CERNRDVLFSDIIELMQS--S
EFAFI-KGLFPENIEAEKRGRPTTAGSKIKKQ---ANT----LVQTL--MKCTPHYIRCI
K-PNE------TKKSRDWEESRVKH-QVEYL-GLRE-----------------------N
IRVRRAG-----YAFRRIFKKFLHRYAILTRET--------------WP----QWRGDEK
QGVLHLLKSVNMDSDQYQLGKTKIFIKAPESLFLLEEMRERKYNGYARVIQQAWRKHIAV
R--------------------KYVRMREE-------ASDLLLNKKE--------RR----
---------KNSL--NRNFVGDYIGT--DNHPEIRQFVGRR----ERIDFADV-------
-----VVKYDRRFKSVKRDLILTPKFLYLIGREKVKQGPEKGQIREVLKRKIEVEKIQSV
SLSTLQDDIFILH-E---DQYDSVLQSVFK-TEFLSLLYKRFEEKTKKKLPLKFNNLLEF
KVKKGGWGPFASAGSRQIQFQMGQGDDAVLKPSSKILTVSIGSGLPKNTR---PTRRDNR
KS-------------------SFMGNQNRSA---------------GQYSREAPKSA---
GRGR-GQPAVRHSLLRQ-------QSTMDQPTL------PRL--QGSVRSQ-RESQVYTD
MGFMKVPDQGVAG----MHRRRSKEY---------------KPLPGSGR---PKPSPKP-
VPR-TPR----CKALYAYDAQDTDELSFQ-------------------------------
PDDIIEILSEDPS---GWWQG--RLRGKE----GMFPGNYV-------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------------------EK------------
-----I
>gi|58331893|ref|NP_001011082.1|	   1093 residues, 50 /line  myosin IF [Xenopus tropicalis]
----------------------------MGSK----------------------------
------------------------------------------------------------
---------------------------------ERYHWQTQNV-RQSGVDDMVLLSKITE
EAIMENLKK--------RYMDDYIFTYIGPVLI----SV------NPFKQLPY----FTD
REIEMYQGAAQYENPPHIY----ALADTMYRNMLI---------------DGENQCVI--
----------------ISGESGAGKTVAAKYIMGYVSKVSGGGP-KVQHVKDIILKSN--
------------PLLEAFGN----------------------------------------
-----------------AKTVRNNNSSRFGKYFEIQFSRGGEPD------GGKISNFLLE
KSRVVSQNSGERSFHIFYQLLEGASAEDKENLGVTSPDYYFY------------------
-LNQSAVYHVDDVSDKKEFAETMLAMDVVG---LGPDTQT------------SVLQIVAG
ILHLGNVAFTES-------GNHAVVES-------QDFL---AFPAYL-------------
------------------------------------------------------------
--------------LGIDQARLQ-DK--LTSRKMDSKWGGKS------------------
--------------------EVI-DVTLNAEQACFTRDALAKALYTRLFDFL--------
------------------------------------------------------------
------------------------------------------------------------
---------VEAIN-----------------------KAMR-KDTEEYNIGVLDIYGFEI
FQKNGFEQFCINFVNEKLQQIFIELT-----LKAEQEEYVQEGIHWNPI----EYFNNKV
VCDLIESKVSPPGVMSILDDVCATMHAKGEGADQ-------------TLLQKLQSAIGSH
EH-FNSWNRGFIIH-----------HYAGKVSYDVSGF----------------------
---------------------------------------CERNRDVLFVDLIELMQS--S
EIPFI-RERFPENLNAEKKGRPSTAGSKIKKQ---AND----LVQTL--MKCTPHYIRCI
K-PNE------TKKPRDWEDSRVKH-QVEYL-GLRE-----------------------N
IRVRRAG-----YAYRRVFQKFLHRYAILTRET--------------WP----QWRGDEK
KGVMHLLRSVNMDSDQYQLGRTKVFIKAPESLFLLEEMRERKYDNYARVIQKAWRKHTAV
R--------------------KYIRMREE-------ASSIVLNQKE--------RR----
---------RNSI--NRNFVGDYIGM--DGRPELRQFVGRR----ERIDFADV-------
-----VTKYDRRFKTLKRDLVLTPKFLYLIGREKVKQGPDKGQIKEVLKRKIELENIQSV
SLSKLQDDFIILH-E---GAYDSALEGVFK-TEFLSLLYKRYEEKTHRKLPIKFGLQLEF
KVKKEGWAPWGAAGTRQIQFQTGIGDMALTKANGKVLIVTIGPGLPPNSR---PTRKDNR
KSQY------------------------------------MGSAPAGNQRAN-------G
GNKKSSRPPMLQR-----MSFTS-RQSVEQPTL------PRQ--GASPRA--KAPPTQAN
LDFMNVPDQGAAG----IHRRRSKEV---------------KPIPGGGRSK-PAPAPKP-
QPS-LPR----CRALYAYDAQDTDELSFN-------------------------------
ANDELEIVREDPS---GWWQG--RIRGRE----GLFPGNYV-------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------------------EK------------
-----L
>gi|109505234|ref|XP_225644.4|	   1014 residues, 50 /line  PREDICTED: similar to Nebulette (Actin-binding Z-disk protein) [Rattus norvegicus]
-------------MKVPVS-----------------------------------------
------------------------------------------------------------
-------------------------------GDVKEETEEENVEEEEKPEDEVFLKPVVE
DLSMELARKCTELISDIHYKEDYRKSKDKCTSVTDTPTL------NHVKNISA----FIS
E--TKYKGTIKADLSNCLYKDMPATIDSVFAREVS---------------QLQSE-VA--
----------------YKQKHEAEKGLSDYAHMKEPPEVRHAME-VNRHQSNISYRKDVQ
GTHTYTAEMDRPDIKKATQI----------------------------------------
-----------------SKIISNAEYKKGQGIVNKEPSVIGRPDFEHAVEASKLSSQVKY
KEKFDNEMKGKG--HHYNPLGSASFRQHQLATVLASDVKYKK------------------
-DVQTMHEPVSDLPNLLFLDHALKASRMLSGWEYKKNFEENKGSYH------FDAEAPEH
LHHRGNATLQSQ-------VKYREEYEKNKGKTMLDFV---ETPSYQ-------------
------------------------------------------------------------
--------------SSKEAQKMQSEK--VYKEDFEKEIKGRSSLDLDKTPAFLHVKHISN
LMREKEYKKDLENEIKGKGMELS-SEVLDIQRAKRASEMASEKEYKK--DLE--------
------------------------------------------------------------
------------------------------------------------------------
---------LEIKG-----------------------KGMQ-IDADTLEI----------
----------------------------------------------QRVKRAAKIASEKD
YKRDLETEIKGKGMQVS-TDTLDVQRA-KRASEM-------------ASQKQYRKDLENE
IK-GKGMQVNVDIPDMLRAKRASEIYSQKKYKDEAEKM----------------------
---------------------------------------LSNYSTVAVTPEIQRIKT--T
QQNIS-NVSYKEEVRAGTAVRNTPEIERVKKN---QHN----ISSVK--RKEGIKHATAI
SDPLE------LKRVTEKPEGLQRF-Q---------------------------------
-------------------------YKEPTYKA--------------TP----VTMTPE-
----------------------------------------------IERVRRNQEQLSAV
K--------------------HKGELKQA-------TSILDLPGLK--------RV----
--RENQKTISNVY--YKGQLGRATAL--SVTPEMERVKKNQ----ENIS-----------
-----SVKYTQDHKQMK------GRPCVILDTPALRHVKEAQNHVSMVKYHEDFEKTKGR
GFTPVVD--------------DPVTERVRKNTQVVSDAAYK-------------------
-----------GVQPHVVEMDRRPGIIVDLKVW-RTDPGSIFDIDPLEDN---IQSRSLH
MLS------EKAS--------QYQSRLSRS------------------------------
----HSGSTFGTGLGDDKSEI--------------SELYPSFSCCSEVTRPSDEGAPVLP
GAYQQSHSQGYGY----MHQT----------------------------SV-SSVRSMQH
SAN-LRT----YRAMYDYSAQDEDEVSFR-------------------------------
DGDYIVNVQPIDD---GWMYGTVQRTGRT----GMLPANYI-------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------------------EFV-----------
-----N
>gi|116501864|gb|EAU84759.1|	   1172 residues, 50 /line  hypothetical protein CC1G_00278 [Coprinopsis cinerea okayama7#130]
----------------------------MANTTEPETYLAVLKASYDY------------
------------------------------------------------------------
-----------------------------------DPQSSDEV-AIKEDQVLFLVERTDE
DWWKVKVKG--------DSQDD-----DGPVGL----VP---------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------AAYVEQAEHSSLVKVLYDYDAAAPGELSVKEDDILRLFE---------TD----
---------GD-----------WILAQSHTADGAGYVPGNY----VEDTASDDQPE----
-----------------------------------------------PTTASHIVIPDSP
PRPVSTYIDPADR-VASHKITADDIKTWSV-SEIDKKG----KKKKGTLGIGNGSLFFAS
ESDK-----AAVQKWQTSDVLEVSSDKAKHVQI-EVGGPN--------------------
-------------------------------------------------------PVSLH
FHAGS------------KDNAEEIIAKTESSKS------LSTTAPSGSPSTPRRLPPAMS
SGHKDGKQKSNVTF------------------DSAPQIIPPAPAVESDD---EDIPQQ-H
EQE-FEN----ATALYDFTADGDDELSVS-------------------------------
EGERLVVLERDSD---DWWKCR-NMRGQE----GVVPASYLEL-IDDSQSTGADNAEVRR
PVEEEEERRRAEEEERQERERAEREEAERLQREEQLRKKEEASRLQKEEVLRKKKEAARL
QEEEALRKKREAQEKARVAAAEAERQRRKEARKVTTPPPQSPPASVTSPSKSTSSNSKKS
QELTRPPPDKTRIWHDRTGQFRVEAAFLGFNNGKLRLHKVNGVIVEVPAEKMSVEDMRHV
EKLMAKKQRGPNGVLSDDDVPLGVVAGVSSRPPAVPKKKAPTIDWFDFFLSAGCDVDDCT
KYASAFERDKIDETLLTDITDSTMRSLGLREGDIIRVKKAIEKRKPTDNLIKPSPYIQEQ
IKKDEELARQLQAQENQGRKTPPNLFAAGPGGALKANVRRGRPQPKGTLPLDNVDIRTLS
NASDAIQRTSSPQTAAPNARPSSTPAVEAPPRSSSATVPASSGFEDDAWAPRPSSAKPST
TAATATTPRAPSAPPAQETAPQPTATTTAPTAQVTSAPTAPAPPPPAASTSPKPLAQTTE
NDIFQQLERLKNLRTTASPPAQQMQQPTVTASPPIVQNSASFPVSAGMGMGHSPVPMGQI
SQQQPSLSPAPSLNNGPRGPFAPVPANQGLLQPLIPTQTGFNSFVPTRPPAFNNNPSPAP
QLNTLQPMHTSLSPSSMSPMLPQQTGMLMGNSLVAQPTGMPMNQGLMSQPTGMP------
--------MNQGLLAQPTGMPMNNGFGLQNSSGFGQLQPNPTGFNPSMNSGNFNNFSNIP
PVPPLPSTQVKDTSPASVFASMKSGTFEDESAPRSADVYDPFRNPLQAQPTGWMGQGYGQ
GGMGFR
>gi|119584080|gb|EAW63676.1|	   725 residues, 50 /line  sorbin and SH3 domain containing 3, isoform CRA_d [Homo sapiens]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------MARIPGVGRASASPSWEKKEE----
-------------------------------------------------SESDVVLL---
------------------------------SPKDPDRGHAEEQLACPESSHLDPSMQGPP
RSLRAGLSLDDFIPGHLQSHI-----GSSSR------GTRVPVI------RNGGSNTLNF
QFHD-----PAPRTVCNGGY-------TPRRDASQHPDPAWYQTWPGPGSKPSAST----
---------------KIPAS--QHTQNWSA---TWTKD----------------------
----------SKRRDKRWVKYEGIGPV-------DESGMPIAPRSSVDRPRDWY-RRMFQ
QIHR------------------KMPDLQLDWTFEEPPR---------DPRHLGAQQRPAH
RPGPATSSSGRSWDH---------------------------------------------
--------------------------SEELPRSTFNYRPGAFSTVL--------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------------------------QPSNQVLRRREKVDNVWTEES
WNQFL-QE-----LETGQRPKKPLVDDPGEKP---SQPIEVLLEREL--AELSAELDKDL
R-AIE------TRLPSPKSSPAPRRAPEQRP-----------------------------
-PAGPASAWSSS---YPHAPYLGSARSLSPHKMAD-GGSPFLGRRDFVYPSSTRDPS---
------------------------------------------------------------
ASNGGGSPARREEKKRKAARLKFDFQAQSPKELTLQKGDIVYIHKE--------VD----
---------KN-----------WLEG--EHHGRLGIFPANY----VEVLPADEIPK----
------------PIKPPTYQVLEY------------------------------------
--------------------GEAVAQYTFK-GDLEVEL------------SFRKGEHICL
IRKV-----NEN---WYEGRITGTGRQGIFPAS---------------YVQVSREPRLRL
CDDGPQLPTSPRLTAAA----------------------RSARHPSSPS-ALRSPADPTD
LGGQT------------SPRRTGFSFP---------------------------------
--TQEPRPQTQNLGTPGPALSHSRGP---------------SHPLDLGT---SSPNT--S
QIH-WTP----YRAMYQYRPQNEDELELR-------------------------------
EGDRVDVMQQCDD---GWFVGVSRRTQKF----GTFPGNYV-------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------------------AP------------
-----V
>gi|149746352|ref|XP_001492014.1|	   726 residues, 50 /line  PREDICTED: similar to sorbin and SH3 domain containing 3 [Equus caballus]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------MARIPGVGRSSASPSLENKEE----
-------------------------------------------------HEGDVALL---
------------------------------SREDPDRGHTVEQLAHPESSDLDPRMQAPP
CSLPTGLSLDDFIPGHLWAHL-----GSSSR------GTQVPVI------RNGGSNTLNF
QFHD-----PAPRTVCNGYF-------PPRRDASRHPDPAWYQTWPGPGSRPSGSQ----
---------------KTPAS--QHPQDWSA---TWTKD----------------------
----------SKRRDKRWVKYEGIGPV-------DESGMPIAPRSSVDSPRDWY-RRMFQ
QIHR------------------KMPDLQLDWTLEEAPK---------DSRRPGLQQRPAT
RPGQASCLSGRSWDL---------------------------------------------
--------------------------AEEFPRSTFSHNPGAPSSLL--------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------------------------QTPNQVPRRREKVDNIWTEDS
WNQFL-QE-----LETGQKPKKPLVDEPVEQP---SQPIEVLLEREL--AKLSAELDKDL
R-AIE------TRQPSPKVRPAPRLRPRHRPCGIRT-----------------------A
TPRPPASAWSSS---APNALYLCPSRPLSPHRMAD-GGSPFLGRRDFVYPSTARDPS---
------------------------------------------------------------
ASERGGSPARKEEKKRKAARLKFDFQAQSPKELTLKKGDIVYIHKE--------VD----
---------KN-----------WLEG--EHHGRLGIFPANY----VEVLPADEVPK----
------------PIKPPTYQVLEY------------------------------------
--------------------GEAVAQYTFK-GDLEVEL------------SFRKGERICL
IRKV-----NEN---WYEGRISGTGRQGIFPVS---------------YVQVCREPRGRV
CDDGPQPPASPRL----------------------------ARHPSSPL-APRGPADPTD
WRGQT------------SPRHAGCSIS---------------------------------
--TQEPRPQTQNLGTPGPAPSHPGGS---------------SRPLDLGT---SSPST--T
QIH-WTP----YRAMYQYRPQNEDELELQ-------------------------------
EGDRVDVMQQCDD---GWFVGVSRRTQKF----GTFPGNYV-------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------------------AP------------
-----V
>gi|21410287|gb|AAH30933.1|	   680 residues, 50 /line  Sorbs3 protein [Mus musculus]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------------------------------------------------------MQ---
-GLPAGLSLDDFIPGHLRTHI-----GSSSR------GTRVPVI------RNGGSNTLNF
QFHD-----PAPRTVCNGCP-------PPRRDGSLNPDPAWYQTWPGPGSRPSMSP----
---------------KPPAS--QHAQNWSA---TWTKD----------------------
----------SKRQDKRWVKYEGIGPV-------DESGMPIAPRSSVDSPRDWY-RRMFQ
QIHR------------------KMPDLQLDWTLEDPPKVVSARASSAEPRHLGTLQRPAS
RPGTTETSSGRNWNH---------------------------------------------
--------------------------SEETSRNTFNYNFRPSSSGL--------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------------------------HPPNQVPRHREKVENVWTEDS
WNQFL-HE-----LETGHKPKKPLVDDPVEKP---AQPIEVLLEREL--AKLSAELDKDL
R-AIE------TRLPSPKNSQAPRR-PLEQP-GLEQ-----------------------Q
PSARLSSAWRPN---SPHAPYFSSSRPLSPHRMADGGGSPFLGRRDFVYPSSAREPS---
------------------------------------------------------------
ASERGSSPSRKEEKKRKAARLKFDFQAQSPKELSLQKGDIVYIHKE--------VD----
---------KN-----------WLEG--EHHGRLGIFPANY----VEVLPADEIPK----
------------PIKPPTYQVLEY------------------------------------
--------------------GDAVAQYTFK-GDLEVEL------------SFRKGERICL
IRKV-----NEH---WYEGRITGTGRQGIFPAS---------------YVQINREPRLRL
CDDGPQLPASPNPTTTA----------------------HLSSHSH-PS-SI--PVDPTD
WGGRT------------SPRRSAFPFP---------------------------------
ITLQEPRSQTQSLNTPGPTLSHPRAT---------------SRPINLGP---SSPNT---
EIH-WTP----YRAMYQYRPQNEDELELR-------------------------------
EGDRVDVMQQCDD---GWFVGVSRRTQKF----GTFPGNYV-------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------------------AP------------
-----V
>gi|73994046|ref|XP_534577.2|	   882 residues, 50 /line  PREDICTED: similar to SH3 domain protein 4 [Canis familiaris]
--------------------------MHTAFLPRNLW-----------------------
------------------------------------------------------------
---------------------------------------------------CLLASRCSQ
RDWRRHGEL--------KQSPECPGPPLPAAPV----PS------AFPLGEQAALCS---
---ESPRGAGQRARVPRAL----SSRPTPGQPPLLLAWLPPPPLPPGAPAQRPNKQPI--
----------------VPLGASTGSLQAGARRSLFPGSLSSHP-AGLTPSHSCPLLPD--
------------PKVEPRGHRWPEPSWSFPSSFLPCRGRTEEQLAHPEPSNLDPSMQAPP
CSLPAGLSLDDFIPGHLRAHR-----GSSSR------GARVPVI------RNGGSNTLNF
QFHD-----PAPRTVCNGYF-------PQRRDASRHPDPAWYQTWPGPGSRPSGSQ----
---------------KTPAS--QHPQNWSA---TWTKD----------------------
----------NKRQDKRWVKYEGIGPV-------DETGMPIAPRSSVDSPRDWY-RRMFQ
QIHR------------------KMPDLQLDWNFEESPKVPSSCAASTDSRHPGPQQRPVA
RPGQASSLSGRSWNP---------------------------------------------
--------------------------SEEFPRSTFNCNPGAPSSLH--------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------------------------QTPKQVPKRQEKADNVWTEDS
WNQFL-QE-----LETGQKPKKPLVDDPVEKP---SQPIEVSPAGQLPWAKTETQSSDPL
Q-SHTVCLCIPSTWDSAWHTVCPQR-CVEYM-SPDQ-----------------------S
SSRERSGQWRLAWACAPSLPFTQAQAPCFHWSMSWG--------GGSRTPSQPRPPD---
------------------------------------------------------------
ATERGASPVRKEEKKRKAARLKFDFQAQSPKELTLKKGDIVYIHKE--------VD----
---------KN-----------WLEG--EHHGRLGIFPANY----VEVLPADEIPK----
------------PIKPPTYQVLEY------------------------------------
--------------------GEAVAQYTFK-GDLEVEL------------SFRKGERICL
IRKV-----NEN---WYEGRISGTGRQGIFPAS---------------YVQVCREPRLRI
SDDGPQLPASPRLTTTA----------------------HLARHSSSPL-TPHSPGDPTD
WGSRT------------SPRRTGFSFP---------------------------------
--TQEPRAQTQGLSTPGSTLSHPGDS---------------SRPLDLGT---PTTT---T
QIH-WTP----YRAMYQYRPQNEDELELQ-------------------------------
EGDRVDVMQQCDD---GWFVGVSRRTQKF----GTFPGNYV-------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------------------AP------------
-----V
>gi|119608323|gb|EAW87917.1|	   762 residues, 50 /line  formin binding protein 1, isoform CRA_b [Homo sapiens]
----------------------------MIHSLLPPKGGRAL------------------
------------------------------------------------------------
----------------------------------------------RRPRLLLPRAILLW
SGGEEEPPR--------RPRAR--------------------------------------
------------------S----CEPEEAARTPGF---------------PPSRGSRG--
----------------AKGSPGR--------------------GTREPRPPRGAPLRV--
----PCTMSWGTELWDQFDN----------------------------------------
-----------------LEKHTQWGIDILEKYIK----------------------FVKE
RTEIELSYAKQ---------LRNLSKKYQPKKNSKEEEEYKY------------------
TSCKAFISNLNEMNDYAGQHEVISENMASQ---IIVDLAR--------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------------------------------------------------------YVQEL
KQERKSNFHD--------------------------------------------------
-------------------GRKAQQHIETCWKQLESSKRRFERDC-KEADRAQQYFEKMD
ADINVTKADV--EKARQQAQIRHQMAEDSKADYSS-------------------------
-ILQKFNHEQHEYYHTHIPNIFQKIQ----------------------------------
------------------------------------------------------------
------------------------------------------EMEERRIVRMGESMKTYA
EVD---------------------------------------------------------
------------------------------------RQ----VIPII--GKCLDGIVKAA
E-SID------QKNDSQLVIEAYKS-GFEPP-GDIEFEDYTQPMKRTVSDNSLSNSRGEG
KPDLKFG-----GKSKGKLWPFIKKNK---------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------------------------GATPED-F
SNLPPEQRRKKLQQKVDELNKEIQKEMDQRDAITKMKDVYLKN-----------------
-------------------------------------------------------PQMGD
PASL-----DHKLAEVSQNIEKLRVETQKF----EAWLAEVEGRLPARSEQARRQSGLYD
SQ----------------------------------------------------------
------------------------------------------------------------
-------NPPTVNNCAQDRESPDGSYTEEQSQESEMKVLAT----DFDD---EFDDEE-P
LPA-IGT----CKALYTFEGQNEGTISVV-------------------------------
EGETLYVIEEDKG--DGWTRI-RRNED----EEGYVPTSYVEV-CLDKNAKACSL-----
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------RPCPPAQPGPPRGGQVSPAPTPMARW
PGEVHTGSRIPARLVDSPVSTGHE------EPTPVLPITF--------------------
--------------------------------------------------------LSLR
TVDHALVHGECGS-------------------PHSSTMGS----PANGDDRDLQELLTSP
SQVDHSPLHEDVKR----------------------------------------------
------------------------------------------------FF---------K
MG---F
>gi|28972273|dbj|BAC65590.1|	   684 residues, 50 /line  mKIAA0554 protein [Mus musculus]
------------------------------------GAGRAR------------------
------------------------------------------------------------
----------------------------------------------CGGRCCCFLGPFCS
ARSDER--L--------RARAR--------------------------------------
------------------G----GAGRGKRRAFRI---------------HKVRRAAA--
----------------IAGEGGR------------------------------RPLPG--
----PCTMSWGTELWDQFDN----------------------------------------
-----------------LEKHTQWGIDILEKYIK----------------------FVKE
RTEIELSYAKQ---------LRNLSKKYQPKKNSKEEEEYKY------------------
TACKAFLSTLNEMNDYAGQHEVISENMTSQ---ITVDLMR--------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------------------------------------------------------YVQEL
KQERKSNFHD--------------------------------------------------
-------------------GRKAQQHIETCWKQLESSKRRFERDC-KEADRAQQYFEKMD
ADINVTKADV--EKARQQAQIRQQMAEDSKADYSL-------------------------
-ILQRFNQEQWEYYHTHIPNIFQKIQ----------------------------------
------------------------------------------------------------
------------------------------------------EMEERRIVRIGESMKTYA
EVD---------------------------------------------------------
------------------------------------RQ----VIPII--GKCLDGIVKAA
E-SID------QKNDSQLVVEAYKS-GFEPP-GDIEFEDYTQPMKRTVSDNSLSSSK-EG
KPELRFG-----GKSRGKLWPFIKKNKLMSLLT---------------------------
-------SPHQPPPPPPASASPSAVPNGPQSPKQPKEPLSHRFNEFMTSKPK--------
------------------------------------------------------------
-------------------------------------IHCFRSLKRGLSLKLGVTPED-F
SNFPPEQRRKKLQQKVDDLNREIQKETDQRDAITKMKDVYLKN-----------------
-------------------------------------------------------PQMGD
PASL-----DQKLTEVTQNIEKLRLEAQKF----EAWLAEVEGRLPARSEQARRQSGLYD
GQ----------------------------------------------------------
------------------------------------------------------------
-------THQTVTNCAQDRESPDGSYTEEQSQESEHKVLAP----DFDD---EFDDEE-P
LPA-IGT----CKALYTFEGQNEGTISVV-------------------------------
EGETLSVIEEDKG--DGWTRI-RRNED----EEGYVPTSYVEV-YLDKNAKG--------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----S
>gi|29893586|gb|AAP06840.1|	   1143 residues, 50 /line  unknown protein [Oryza sativa (japonica cultivar-group)]
------------------------------MASGQDSSSTTLMDLITSD-----------
----------------------------------PSAVPAGGASSHQQSSSS---AAAAA
AGGALGRPAPAP---ADRKSKRGTLSQIQNETISAAKAL------NKALPQRNRKKK---
----------------------ATRLKSSQRQL----VNSVFPKLAVYNSVDPSVAPSLL
MLHQQCEDRNVLRYVYYYL----ARILSDNG-----------------------------
----------------AQGLSAAGGIPTPNWDALADIDAVGGV-TRADVVPRIVDQLS--
AESTSDDVEFHARRLAALKA----------------------------------------
-----------------LTSSSTSNSEMLEKLYEIVFG----------------------
--------------------ILEKVADTKQ------------------------------
------------------------------------------------------------
-----------------------------------------------KRKKGIFTKQGGD
KESIIRSNLQYASLSALRRLPLDPGNPAFLHRAVQGVEFSDPVA----------------
----VRHALSIASEIAVRDPYSV-AM--ALGKNAQPGGA---------------------
-----------------------------LQDILHLHDVLARVYLAKLCHSISRARVLDE
RPDIKSQYSSLLYQLLLDPSDRVCFEAILCVLGKVDNTESTEE-RAGGWIRLTREILKLP
EAPSVASKGILSKSEKSSKARRPQPLIKLVMRRLESSFRSFSRPVLHAAARVVQEMGKSR
AAAYSLGA--YDEAANLQSYSDNVESLDSDLNENSQPEATRKANPLSNGHGGMDTIAGLL
ASLMEVVRTTVACECVYVRAMVIKAL-----IWMQNPHESF------------EELKSII
ACELAD----PAWPSSLLNDVLLTLHARFKATPD-------------MAVTLLEI-----
---------------------------ARIFATK------VPGKIDADVLQLLWKV----
------------------------------------------------------------
---------------------------------------------YF--MKETPISVTCL
-----------VGAGPDGKHTALEA-VTIVL-DLPP-----------------------P
QPGSMSG-----FASVDMVSASDPKSAMALQRLVQ-AAVWFLGENANYAASEYAWESATP
P----------------------------------ASSRNPTLASALTRLQRC-----AF
SGSWEIRIAAVQALTTIAIR-SGEPYRLQ-------IYEFLHALALGGVQSNFSEL----
---------QLSNGENQGASGTGLGS--LISPMLKVLDEMYR---AQDDLARDIRQHDNS
KQEWNDDELKKLYETHERLLDFVSLFCFVPRAKYLPLGPTSAKLIDIYRNRHNISTSSGL
S------DPAV-A-T---GISDLMYEPKDV-PKEATLI----QTGIDPDLAMAWAAGLED
D-------------VWENNAPAVDKVKDFLAGA-GTDAPDVDDEEYMNSRPS--------
---------DDDGRS---------------------------------------------
-SGGS------------SPESTGSVETSISSHF------SGMNYPSLFSSKPSGY-----
---------GASQQTIREE-PPSYSTSVLQKRESFENPLAGRGGRSFGS---HEDEDR-S
SGN-PQS----GKALYDFTAGGDDELSLT-------------------------------
AGEDVEIEYE-VD---GWYYVKKKRPGRDGKTAGLVPVLYV-------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------------------N-------------
-----S
>gi|50551935|ref|XP_503442.1|	   1228 residues, 50 /line  hypothetical protein [Yarrowia lipolytica]
----------------------------MAVTKR------------AGR-----------
----------------------------------RAQGGTQPAKGA--------------
------------------------------QGVKKATFESGKK-REVGVSDLTLLSKVSE
EAINENLKK--------RFENGTIYTYIGHVLI----SV------NPFRDLGI----YTD
AVLESYKGKNRLEVPPHVF----SIAESMYYNMKS---------------YSENQCVI--
----------------ISGESGAGKTEASKRIMQYIASASGGSSSNIQKIKDMVLATN--
------------PLLEAFGC----------------------------------------
-----------------AKTLRNDNSSRHGKYLEIQFNNQAEPV------GANITNYLLE
KGRVVGQIRNERNFHIFYQFAKAASENYRSTFGIQPPEAYTY------------------
-TSASGCTSVNGINDEAEFKETLAAMNLIG---LTQAEQD------------NLFKLLAA
ILWIGNMSFVEDK------DGNAAIAD-------VSVP---NFVAYL-------------
------------------------------------------------------------
--------------LEVDAESVV-KA--VTQRIMETSRGGRR------------------
--------------------GSVYEVALNIAQATSVRDALAKGIYNNLFDWI--------
------------------------------------------------------------
------------------------------------------------------------
---------VERVN-----------------------QSLRAPQDAARTIGILDIYGFEI
FESNSFEQICINYVNEKLQQIFIQLT-----LKTEQDEYVREQIAWTPI----NYFNNKI
VCDLIEEK-RPPGIFAALNDACATAHADPNAADE-------------NFIQRMS-MVGQN
PH-FEQRQRKFVIK-----------HYAGDVTYDVKGI----------------------
---------------------------------------TDKNKDQLLKDILILLQK--S
GNPFL-VSLFPDPVNTDNRRRPPTASDKIKKS---AND----LVTTL--SAAQPSYIRTI
K-PNQ------NRSPTEYDEKAVLH-QVKYL-GLQE-----------------------N
VRIRRAG-----FAYRQTFEKFVERFMLLSGKT--------------SYAGDYIWQGSAY
DATLCILRDAGIPQTEYQMGTTKVFIKTPETLFALEHMRDMWWHNMAARIQRAWRRYLAY
KTECAIKIQRFWRLKRGLDGLKEIQFRDS-------GHKLLGGRKE--------RR----
---------TYSLIGYRRFQGDYLGC--NNGSGFGDFLMKQIGVTDKVFFSC--------
RGQLQQSRLGRSSVRVPRTFILTKNNFYVVAQQIHQ-----KQLVVTNEYTIPVRNITHM
SMSNLRDDWFCLN-QASSPYGDQLMWCVFK-TELAVQL-----RVVKPGVDIRIGPQIDY
FKKQ-----GKKASVKFQKTTTLQTKFDMY----KSGSVQVPPGAPPNSVSK-ETPRGRA
KGSRGGAPSRPAARG----NAAHTPTPGAAALGYQQHQ-PGSAQPASPRARKAPPPAPNS
RGNGH------------AESAQPQAYNNLQPHY------QSLVNP-------RSGQGQQQ
QQHHQAYQQPTAAQPAATSYSP-AP-----AKAAPPPPPPA------------PPAAP-A
APA-EPT----YKALYDYVANGLNQLSIS-------------------------------
AGEQVLISVKEDQ---GWWLAKRMD----GSEEGWTPAAYLEE-V--Q-GGAAAP-----
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------PPAAPTAGGAS-------------AG
ASLAEAL-----------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------KQKQQSNQTLGAGIADAIKA----------------R--TGRPADDDD
DD---W
>gi|83765477|dbj|BAE55620.1|	   1261 residues, 50 /line  unnamed protein product [Aspergillus oryzae]
----------------------------MGHSRRPVGGEKKSRGFGRSK-----------
----------------------------------VADVGDGRQAGK--------------
------------------------------PQVKKATFETTKK-KDIGVSDLTLLSKISN
EAINDNLKL--------RFEHDEIYTYIGHVLV----SV------NPFRDLGI----YTD
NVLDSYRGKNRLEVPPHVF----AVAESSYYNMKS---------------YKDNQCVI--
----------------ISGESGAGKTEAAKRIMQYIASVSGGSDSSIQQTKDMVLATN--
------------PLLESFGN----------------------------------------
-----------------AKTLRNNNSSRFGKYLELEFNANGEPV------GANITNYLLE
KSRVVGQIANERNFHIFYQFTKAAPQKYRDMFGVQQPQSYLY------------------
-TSRSKCFDVPGVDDNAEFRDTLNAMGVIG---MSEAEQD------------NVFRMLAA
ILWIGNVQFAEDD------SGNAAISD-------QSVV---DFVAYL-------------
------------------------------------------------------------
--------------LEVDPAQVN-KA--LTIRIMETARGGRR------------------
--------------------GSVYEVPLNTVQALAVRDALSKAIYFNLFDWI--------
------------------------------------------------------------
------------------------------------------------------------
---------VERVN-----------------------QSLTAREPVANSIGILDIYGFEI
FEKNSFEQLCINYVNEKLQQIFIQLT-----LKAEQDEYAREQIQWTPI----KYFDNKV
VCSLIEDK-RPPGVFAALNDACATAHADSGAADN-------------TFVGRLN-FLGQN
PN-FENRQGQFIVK-----------HYAGDVSYSVEGM----------------------
---------------------------------------TDKNKDQLLKDLLNLVGS--S
GNQFV-HTLFPNQVNQDDKRRPPTASDKIKAS---AND----LVATL--MKAQPSYIRTI
K-PND------NKAPREYNVGNVLH-QIKYL-GLQE-----------------------N
VRIRRAG-----FAYRQTFNKFVERFYLLSPKT--------------SYAGDYTWTGDAE
SGARQILKDTSIPAEEYQMGITKVFVKTPETLFALEAMRDRYWHNMAIRIQRAWRNYLRY
RIECAIRIQRFWRRT--TGGLELLKVRDQ-------GHQVLQGRKE--------RR----
---------RMSLLGSRRFLGDYLGI--GNKGGPGEMIRNG----AGISGSDDI--LFSC
RGEVLISKFGRSSKPSPRILVLTNRHVYIVAQILVN-----NQLQISAERTVPIGAIKAV
STSNLKDDWFSLI--IGGQEPDPLINCVFK-TEFFTHL----QTALRGQLNLKVSENIEY
NKKP-----GKLATVKAIKDPAASPNVDTY----KSHTIHTSPGEPPSSVSK-PTPKAKQ
VA------ARPVTKG----KLLRPGGPGGGPSKL-------ASRPAS-RPTPKPQPLPQS
QPAT----------------------------------------A-------QPIPAPQP
AAVPRPVPQPVAAAAASHTRNASSG-----SVRAPPPPP---------------PASP-P
APK-KAT----AKALYDFTSAQSNELDIR-------------------------------
AGDVVQIVSKEGN---GWWLCMNMA----TSVQGWTPQAYLEE-QVAP-TPKPAP-----
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------PPPPPAAPRASPVPSANGAA----AT
AAAAKAKPAPPAPPAKRPNMAGRKAVP---APPPAPRDSA--------------------
--------------------------------------------------------VSMN
SQD---------------------------------------------------------
------------------------------------------------------------
--S--SGGSGRGTPNSTSNASLAGGLAEALRA----------------RQHAMQGKHDDD
DE---W
>gi|66812584|ref|XP_640471.1|	   877 residues, 50 /line  hypothetical protein DDBDRAFT_0204260 [Dictyostelium discoideum AX4]
---------------------------MSELSESGSYNSYNSLS----------------
------------------------------------------------------------
------------------------------AGSPLPLQEIFNG-AETKCQSHYLQSRINT
NYEQVKQQL--------KESAEKKNSSKIYSSL----QH------LTYYKVEKDLLETIL
RIIDITDDKKTLRLAYYFL----GEISQFKHLINN---------------STEIKNITTI
FNKEMQHKDISRK----VVSLKTTASVAPNDVL---------------------------
------------------------------------------------------------
--------------------------------------IDANIL------DVI-------
------------------SGILRKVGEDPDKT----------------------------
------------------------------------------------------------
-----------------------------------------------QKKKGFF-TRATT
DLGRERSLLQYSCFVACRNR--YKNNPSLFMPIVEGIKCVDPVG----------------
----ARHAVSLTLNYALENPSTV-AA--TTKRFIPLLKANK-------------------
-----------------------------GKEAVYLVDPFARRNFIKLCGHL--------
------------------------------------------------------------
------------------------------------------------------------
---------AATPS-----------------------PIGNVI---------------TM
ENKDFFQSLCQSVMDAHLSVAFYAIN-----VLSRFSWPTLESAHIDAI----QFDS---
---------ELPHFESLAFQTSLIV----GICNK-------------MRIGFNTYSIGAY
SN-YSMQHGHHHLH-----------HYHQGGSGTVGGS----------------------
-------------------------------------VPSSSSSSSSSSNITTSALS--S
GSSSN-SSLSSQQLLLVQQQQQQLLHQQSNPFLHLACK----LISVL--SQSY---VKYS
Y-PKD------STTQ---------------------------------------------
------------------------------------------------------------
---QPIIGDWSFDEKQYQHQSVYPYHHNLSPFTGLPN-----------------------
------------------------------------------------------------
------------------------------------------------------------
-------------------------------------------------PISNNNNSSNN
TKDQSTTTTTS----TTSSSSNSIHPFSSL-TQLILNL----L-----------------
------------------------------------------------------------
-NISPSISIRIQALKALVWLCPSNLDQSKLYLETFRSQLRDPYHPTHLFK----------
----------------------------------------------------ELFL----
-----ELYKRIIATPILSPMILELVYDWIDIIPSKCDTSLVCEIW--------------K
TIV-EFGKVF-ANEKLLASIFKILDRIVHPDFRVLAMEIQKDIIKFLGEYSN---QITFE
QPSRFEQCKSRSG---SNQQQHLSN----MSLNSIIQRLQQYS-IF--------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------SPWQIRLESIDSLAKIA-----------------------------
------------------------------------------------------------
-----------------------------------FQSSTVVKVHIYNFLTLLPNESHG-
--------------WTTVKSNTSIIVNTLDQLLTCRAKWLPLFKSSDLSQNQIKD-----
------------LKNDHTNLCLQIGLFFDQLSFDYLPLGIESKKYLGS------------
-----K
>gi|85099966|ref|XP_960877.1|	   1384 residues, 50 /line  hypothetical protein [Neurospora crassa OR74A]
-------------------------MDSQPNKRRSIFGLATNLFRGS-------------
---------------------------------------------S--------------
------------------------------APADDSDSMTESP-QQNGATKAQSVPRIDF
NSATHESPA--------KRASDAQLASRKLIGR----PQ------GPSSKLAQSFTSTDF
TELSSAPQKKITFHTASAA----GATRRMPG---------------------DNPYKSPS
FTSTAKGPVVNGNGAKAASFSGTGTSTAPSNIFR--------SGTPSLYQRSGGTAFA--
------------PRIVPGGL----------------------------------------
-----------------KSSLPQSTPGRTSR------GTTAELL------GAVPVNTELF
KMRI-----PEPPHHLTGELLAKEVPDDPNRAGSIYADEFLAHYCPPDLDEQQKKQFFCI
LDLRRLKYAADEIFTKKDWK--INILNFAK---EYEKSRS------------LIMLRYGL
YE--FKTVRASEEVKKEWRQKHGIAES-------EEEA---SASSNLKTPAGSK-RKAEE
DLSPIDGALKASTTAGNKRP--RAPEPTSPSPIKQKPKRKASTVGSPDEAQPAKLQKASG
TPTKASSATKSVFESIVNNTQTA-AAKKAATGAAKAATTNS-------------------
-----------------------------APKSVFETGPKAPASSENIFGHL--------
-------------SDSKSSNDDANADSDAETASNVDDDEDEHEAQRDGSTSTGVAIPQFG
LGSQAAVNGGSGASSDAEGSFQGRSIFDRITR--GSDGQPIRKPVQDGKSDLFSATLKED
RALGTTHEQASSPA-----------------------PVNNTW---------------NT
ETPIKFSSGPSNLFGAATSKPAVSSNLFGAPVAKKAEEPAQDSAPKSLF----GVPSKKA
DEPVTEAP-KAPAASVFSFGTKTTD----TAASKPSLFGTPAPSAPEPAVTNSIFSSGPS
TPLFGQAKDKQESK-----------ETTQAPSSLFGTKPAEPATTEASKPSVLQSNMLFG
SAP--------VASEPPKTQATSLFTKPAAAETQSTQAPASSSFGASASKPATSSLF---
GSATN-PPGADEP-------------------------------------------AAKK
V-AFG------STET---------------------------------------------
------------------------------------------------------------
---KPAASIFNFGSTIPAADAATPETKGLFGTTNGATPVTETKN-----LFGVSTTPAPA
------------------------------------------------------------
------------TEVKSFFGGTSIGV--PATQTQTLFGNTS-------------------
-----------------------------ASATETK-----SLLGNATAPATETKNLFGN
TSTTAPAETKS----LFGSASTSSAPSDS-------------K-----------------
------------------------------------------------------------
-PLFGATTSQPEASKPLFGASSSQPEASKSLFGATSSQ-PESSKPASIFG----------
----------------------------------------------------SNNLAPAP
VSASSSFTFGSTAAPATSQPVPAATSSFTFGSGSPAPTPQPSTSFSFGA---TPASQP-S
QPE-QNGNIFGANTSFTFSAGGNDGAAINNPFATGGAATPTSSSFTFGQNSGTSAPFVFG
QSSQNTPSITFGGAQDSTQQNGSSN----MFAFGGQQPSGGGS-MF--------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------------------------NLAPPVGGTSTGTDSP----KT
FGGASSLATTPAVGTPEPVAAESKDAQGTHADGDEAPQEQ--------------------
--------------------------------------------------------ISLV
EGG-----------------------------PGEEDESVVYEVRAKAYKLVAPEDDDD-
---EGSKEKKKPSVWKTQGVGPLRLLKHKNTGAVRMLMRVEPRGNIALNKIILPNFTYKP
EAS--APKNIKITTATDDGKGLETWMLTTKT-------TQALADALEEHKKANEKK----
-----D
>gi|111060868|gb|EAT81988.1|	   755 residues, 50 /line  hypothetical protein SNOG_10594 [Phaeosphaeria nodorum SN15]
------------------------------------------------------------
-----------------------------------MEVDIAPQFGAELK---------V-
---------------------------------------SGGISWLDDIQQFYRERSAIE
KEYSAK---LSALAKKYYEKKARKQSS---LSVGDTP-----------------------
-------------------------------------------------------TVTPG
SLESASMTTWGVQLSTLESRA----------------------TEHEQFAGALVT-----
--------------------QLADPLKTLATRYEELRKLHGDY-----AAKLEKERDSQY
TELRKQKGKYDSVCQEV---------------------ENRRKKSDGAFDHGKAKARNAF
EQQQIEMRNVKNTYLISINV---------------------------------TNKQKEM
YYHEYVPELLDSLQDLSETRVN----KLNSIWLLAANIETQTLSRSTEYLKHLSAEIPRN
NPLLDSMMFVRHN------------AGGWQEPGD--------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---FQFEPSPVWLD-------------------------DGNLAVDDAATTFLRNVLTKT
KASLGEHR------RELDKKRKEVESAKAVRRNIREGKDK-RDE-----VDVVRAVFAIQ
EAMHEIERQKVSAEVEVSTITSVVG------DVSIGARNHNFKSQTFKIPTNCDLCGDRI
WGLSAK------------------------------------------------------
---------------------GFDCKDCGYTCHSKCEMKVPADCP---------------
--------------GEQTKEEKKK-------------------------LKDERQKAAHT
V-TS-------TNGA-ATGSHAELPKLGRSDTINSMNTLSSGYS-ATAHRSVSGMSPAAA
ED---PPAEKKAP-----------------------------------------------
------------------------------------------------------APAP--
--V-PGARRNRMIAPPPAQYIKDDDDMP--------------------------------
------------------------------------------------------------
--------PPTPKSNEVKGRMLYGYEENGEGELTVPEGREVTILE---------PDGRSL
SNLSPMFQILLGASLTRDYTDGSGWMKVRSGSKEGLVPTSY----VEVLAATP-------
------------------------------------------------PTTAS-TFSS-S
TRPDSTYSASSAS-----------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------TTNLHAAVAGKK---KGPAVAPKR-G
AKK-LKY----VEALYDYTAQSDAEHSMA-------------------------------
EGDRFVLINMEAG---DGWADV-ERDGVV----RSVPANYVQQ-V---------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------
>gi|119191604|ref|XP_001246408.1|	   733 residues, 50 /line  hypothetical protein CIMG_00179 [Coccidioides immitis RS]
------------------------------------------------------------
----------------------------------MSQAEVDPHFGAELRDAFKPVNAWV-
---------------------------------------SNGISWLDEIQQFYRERSAIE
KEYASK---LTALCRKYHDRKSKKSSS---LSVGDTP-----------------------
-------------------------------------------------------AMTPG
SLESASLTTWTTQLSAIEAQA----------------------AERNKFGADLEF-----
--------------------RIAEPLKQIAVKYEELRKNHGEW-----SGKLEKERDSSY
NDLKKVKGKYDGVCQEV---------------------ENRRKKMESAFDHGKAKAQNAY
QQQLLEMNNVKNTYLIAINV---------------------------------TNKLKER
YYYEYVPELLDGLQDLNETRVA----KLNSIWTLAAQLEKSLISKTDEQIAHVISEIPRN
DPKLDSMMFIRHN------------VANWQEPQD--------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---MQFEPSPVWHD-------------------------DATMVIDEAAKIFLRNLLTKS
KSQMKEMK------GEADKKRREVENAKRVRQSIRDGKDK-RDE-----VEVVRAIFSMQ
EDLHQFNRKQLTAEVETSTITSVVG------DLSLGAKNHNFRPQTFKIPTNCDLCGERI
WGLSAK------------------------------------------------------
---------------------GFDCRDCGYTCHSKCEMKVPAECP---------------
--------------GEQSKEEKKK-------------------------LKAERQEAANE
T-RP-------YKAATTTSSTAELPALSRRDT---MNSLSSGYA-ASATRSTSALSSQTT
DT---GPTELPAT-----------------------------------------------
-----------------------------------------------------VSPAQ--
--KPTALRKHRIVAPPPDQYVSAPPPIS--------------------------------
------------------------------------------------------------
------NGGTASRPSEPRGKMLYPYQANGEDEISVDEGQDVVIVE---------PD----
--------------------DGSGWMRVRTGSSTGLIPASY----VESTASQE-------
------------------------------------------------P----------E
GRPESMYSVSSTS-----------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------L---ANSLAHKR---RGPAVAPKR-G
AKK-LQY----VVALYDYEARTEAEWSMT-------------------------------
EGDKFVLINRDSG---NGWADV-EKGGVT----KCVPANYIEDAS---------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------
>gi|115433272|ref|XP_001216773.1|	   735 residues, 50 /line  conserved hypothetical protein [Aspergillus terreus NIH2624]
------------------------------------------------------------
----------------------------------MATPDAAPHFGAELK---------V-
---------------------------------------LHGITWLDEIQQFYRERSAIE
KEYAAK---LTALCRKYYDRKAKKTST---LSVGDTP-----------------------
-------------------------------------------------------SMTPG
SLESASLTTWTTQLTAVESHA----------------------TERDKFANDLVV-----
--------------------QVAEPLKQAAAQYEELRKCHVDF-----HAKLEKERDSSY
HDLKKMKGKYDGACQEV---------------------ETRRKKMESSFDHSKPKAQAAY
QQQILEMNNVKNTYLISINV---------------------------------TNKMKER
FYHEYVPELLDGLQDLNETRVT----KLNSVWSLAAQLEKNSLAKSMDHMSHLLQEIPRN
VPSLDSLMFLRHN------------VTQSQEPPN--------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---VGFEPSPVWHD-------------------------DETLVTDETAKVFLRNLLSKS
KTQVRELR------VESDQKRREVENARKIRENIKQGRDN-RNE-----VEVVRSIFFLQ
GTLHEVDRKKLTAEVETSTIMSAVG------DLSLGAQNHNFKSQTFKIPTNCDLCGERI
WGLSAK------------------------------------------------------
---------------------GYDCRDCGYTCHSKCQMKVPAECP---------------
--------------GEQSKEEKKK-------------------------LKAERQEQASA
T-PT-------LDLEPTTTNSSAAPSLTRQNT---MNSLSSGYA-VSANRSLSNVNQAPA
NP-AELPGQTATP-----------------------------------------------
-------------------------------------------------AA--PQETKPA
PA-----RRNRILAPPPAQYVAPPPVTE--------------------------------
------------------------------------------------------------
-----S-----PRTSEPRGKMLYAYQAGGADEVTVQEGDDVTIVE---------PD----
--------------------DGSGWMRVRVGTQEGLVPASY----VEALPAAAA------
---------------------------------------------APSPVPSA-SPGL-P
ERPGSTYSNSSAS-----------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------LAGSG--AGGKR---VGPAVAPRR-G
AKK-LQY----VEAMYDYEARSDMEWSMA-------------------------------
EGDRFVLINRDSG---DGWADV-ERGGVT----KSVPANYIQE-V---------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------
>gi|119497847|ref|XP_001265681.1|	   737 residues, 50 /line  actin polymerization protein Bzz1, putative [Neosartorya fischeri NRRL 181]
------------------------------------------------------------
----------------------------------MATADVAPHFGAELKDAFKPVNNWV-
---------------------------------------SNGIQWLDEIQQFYRERSAIE
KEYAAK---LTTLCRKYYDRKAKKISS---LSVGDNP-----------------------
-------------------------------------------------------SMTPG
SLESASLTTWTTQLTAVESHA----------------------AERDKFASELVA-----
--------------------QVAEPLKQAAAQYEELRKCHVDF-----HAKLEKERDSSY
SELKKAKGKYDGACQEV---------------------EARRKKMESSLDHGKSKAQAAY
QQQILEMNNIKNMYLISINM---------------------------------TNKMKEK
YFHEYVPELLDGLQDLNETRVT----KLNSVWSLAAQLEKASLSKSMDHMSHLLNEIPRN
VPHLDSLMFLRHN------------VTQVQEPPN--------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---MVFEPSPIWHD-------------------------DESMITDETAKVFLRNLLSKG
KTQVRDLR------VESDQKRREVDNAKRVRENVRQGKDN-RNE-----VEVVRSIFFLQ
EALHETDRKRLAAEVETSTIMSVVG------DLSLGAKNHNFKSQTFKIPTNCDLCGERI
WGLSAK------------------------------------------------------
---------------------GFDCRDCGYTCHSKCQMKVPAECP---------------
--------------GEQTKEEKKK-------------------------LKVERQEQAGA
M-PA-------LDITP-SNGTSAAPSLTRQNT---MNSLSSGYA-ASTNRSLSNVTSQPA
SA-TE----PAAP-----------------------------------------------
-------------------------------------------------AE--TKPAVAA
P------KRNRILAPPPAQYVSAPAPSE--------------------------------
------------------------------------------------------------
-----S-PSAPAKSGEPRGKMLYPYQAGGADEITVQEGDDVDIVE---------PD----
--------------------DGSGWMRVRTGSREGLVPASY----VEVVPTTS-------
------------------------------------------------PAPTA-SPGF-T
DRPGSTYSNSSAS-----------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------LAGSM---APKR---VGPAVAPRR-G
AKK-LQY----VEALYDYEARSDMEWSMA-------------------------------
EGDRFVLVNRDSG---DGWADV-ERGGVT----KSVPANYIQE-V---------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------
>gi|145256123|ref|XP_001402430.1|	   800 residues, 50 /line  hypothetical protein An10g00370 [Aspergillus niger CBS 513.88]
----------------------------MGGSTWPDRQPEAVRYGHLSPLPIALQPFQPR
LATIPGSPIPPYPPSGCTDYGAHTVANGCSARGRMATPDVAPHFGAELK---------V-
---------------------------------------SNGIGWLDEIQQFYRERSAIE
KEYAAK---LTALCKKYYDRKAKKISS---LSVGDTP-----------------------
-------------------------------------------------------SMTPG
SLESASLTTWSTQLSAVEAHA----------------------TERDHFGNDLLV-----
--------------------HVAEPLKQAATQYEELRKCHVDF-----HAKLEKERDSSY
SDLKKAKGKYDGACQEV---------------------EARRKKMESSFDHSKPKAQAAY
QQQILEMNNVKNTYLISINV---------------------------------TNKMKER
FYHEYVPELLDGLQDLNETRIT----KLNSLWTMAAQLEKNYLSKSMDHMANLINEIPRN
VPHLDSLMFLRHN------------VTQSQEPAN--------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---LAFEPSPIWHD-------------------------DDALITDEAAKVFLRNLLSKS
KTQVRELR------VEADSKRREVENARRVRENIRQGTDK-RNE-----VEVVRAIFFQQ
ESLHEVDRRRLTAEVETSTIMSAVG------DLSLGARNHNFKSQTFKIPTNCDLCGERI
WGLSAK------------------------------------------------------
---------------------GFDCRDCGYTCHSKCEMKVPAECP---------------
--------------GEQTKEEKKK-------------------------LKAERQEQANT
A-PAP------LDLEP-TTSSSTAPSLTRKDT---MNSLSSGYA-VSANRSMSNATQSPT
TTAAELPTP---------------------------------------------------
-----------------------------------------------------VAETKPA
PA-----RKNRILAPPPAQYISGPPAND--------------------------------
------------------------------------------------------------
-----STPALSSKANEQHGKMLYAYQAGGADEVTVQEGDDIVILE---------PD----
--------------------DGSGWMRVRFGSEEGLVPASY----VEAGPAPS-------
------------------------------------------------PVPSA-SPGFTA
DRPGSTYSNSSAS-----------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------LTGGGGAGGNKR---VGPAVAPRR-G
AKK-LQY----VEALYDYEARSDMEWSMV-------------------------------
EGDRFVLVNRDGG---DGWADV-ERGGVT----KSVPANYIQE-V---------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------
>gi|83771978|dbj|BAE62108.1|	   744 residues, 50 /line  unnamed protein product [Aspergillus oryzae]
------------------------------------------------------------
----------------------------------MATPDVAPQFGAELKDAFKPVNNWV-
---------------------------------------SHGVQWLDEIQQFYRERSAIE
KEYAAK---LTALCRKYQDRKAKKIST---LSVGDTP-----------------------
-------------------------------------------------------TMTPG
SLESASLTTWTTHLTTVEAHA----------------------GERDQFATNLLV-----
--------------------QVAEPLKLAATQYEEIRKSHVEF-----HAKLEKERDAAY
GDLKKAKGKYDGVCQEV---------------------EGKRKKMENSFDHSKPKAQAAY
QQQILEMNNVKNSYLISINV---------------------------------TNKLKER
FYHEYVPELLDSLQNLNEMRVS----KLNSLWSLAAQLEKSSLSKSMEHMAHLLNEIPRN
VPHLDSLMFLRHN------------VSQSQEPPN--------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---MTFEPSPVWHD-------------------------DEALVTDETAKVFLRNLLSKS
KTQVRELR------VEADQKRRDVETSKRIRENIQQGKDN-RSE-----VEVVRSIFYLQ
GALHEVERKKLTAEVETSTIMSVVG------DLSLGAKNHNFKSQTFKIPTNCDLCGERI
WGLSAK------------------------------------------------------
---------------------GFDCRDCGYTCHSKCQMKVPAECP---------------
--------------GEQNKEEKKK-------------------------LKAERQEQANA
T-PH-------LDLEPTTTGSSAAPSLTRKDT---MNSLSSGYA-VSANRSLSNAASQPA
LA---NPTESAAP-----------------------------------------------
-------------------------------------------------SPVPEAAATPA
PVQETKPKRNRVLAPPPAQYVKAPPVAE--------------------------------
------------------------------------------------------------
-----T-----TKPSEPRGKMVYPFQAGGADEITVQDGDDVTILE---------PD----
--------------------DGSGWMRVRAGSAEGLVPASY----VEPAPAAS-------
------------------------------------------------VAPAT-SPGM-A
ERPGSTYSTSSAS-----------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------LAGSA---VGKK---VGPAVAPRR-G
AKK-LQY----VEALYDYEARSDMEWSMV-------------------------------
EGDRFVLVNRDGG---DGWADV-ERGGVT----KSVPANYIQE-V---------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------
>gi|150415395|gb|EDN10748.1|	   758 residues, 50 /line  conserved hypothetical protein [Ajellomyces capsulatus NAm1]
------------------------------------------------------------
----------------------------------MTDVDTSPHFGSELRDAFKPVNAWV-
---------------------------------------SNGIAWLEEVQQFYRERSAIE
KEYAAK---LTGLCRKYHERKAKKSSS---LSVGETP-----------------------
-------------------------------------------------------SLTPG
SLESASLTTWTTQLSAIEAEA----------------------ADRDRFGSDLLF-----
--------------------QVAEPLKQAAVRFEELRKNHVDY-----AGKLEKERDSTY
SDLKKVKGKYDGACQEV---------------------ENRRKKTESSFDHGKQKAQVAY
QQQTLEMNNVKNTYLISINV---------------------------------ANKLKEK
YYYEYVPELLNGLQDLNETRVS----KLNSIWMLAAQLEKNTLTKCDQHVSHLISEIPRN
EPWLDSTMFIRHN------------MTNWQDPAD--------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---MQFEPSPVWHD-------------------------DATMITDETSKVFLRNTLVKS
KAQAKELK------AEADKKRKEVENAKKLRKNIRDGKDN-RDE-----AEVVRAIFAMQ
EDLHLLDRKRLTAEVEISTIISVVG------DLSFGAKNHNFRSQTFKIPTNCDLCGERI
WGLSAK------------------------------------------------------
---------------------GFDCRDCGYTCHSKCEMKVPAECP---------------
--------------GEQTKEEKRK-------------------------LKIERQEAASS
R-AS-------VDIASPTNGASELPTLSRRDT---MNSLSSGYA-ASAARSVSVLST-PQ
V-AEEGPTELPES-----------------------------------------------
---------------------------------------------------APSTTTKP-
---ATAPRRNRIVAPPPAQYISAPPPPADQGEADGGGGG---------------------
------------------------------------------------------------
--GGGRSRGLSVKSNEARGKMMYPYDANGEDEITVEEGREVIIVE---------PD----
--------------------DGSGWMRVRAGSRSGLVPASY----VEVIFTP--------
-----------------------------------------------PPALSP-KPGL-P
DRPGSTYSNSSAS-----------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------LAS---SVAGKR---RGPAVAPKR-G
AKK-LQY----VVALYDYEARSDAEWSMA-------------------------------
EGDRFVLVNRDSG---NGWSDV-EKGGQT----KSVPANYIEE-V---------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------
>gi|39972033|ref|XP_367407.1|	   759 residues, 50 /line  hypothetical protein MGG_07332 [Magnaporthe grisea 70-15]
------------------------------------------------------------
----------------------------------MADTEVAPTFGAELKDGFKPANAWV-
---------------------------------------GHGIAWIDDLQQFYRERAAIE
KDYSAK---LAALAKKYYEKKSKKSAV---LSVGDTP-----------------------
-------------------------------------------------------AMTPG
SLESASITTWTTQLNTVERRA----------------------EEHSRYANELIN-----
--------------------RVATPMQAFQTKFDELRKRHAEF-----ADKLEKERDSSY
SELRKVKGKYDNVCQEV---------------------ESKRKKTESAFD--KAKAQSNY
QQQIHEMNNAKNTYIIAINV---------------------------------TNKQKEK
YYHEYVPEVMDGLQDLSEFKTI----KINELWTLASTLESGLLKSSGEMIDHQTEEIARN
LPHLDSMMYMRHN------------IGAWQEPSD--------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---KMFEPSPVWHD-------------------------DDSMVVDEPAKVYLRNVLNKS
KSQLGDLR------REVDKKRREVESMKRVKQNVRNGTDK-KDE-----VAVVNSIFAMQ
EDLHQVERKRITAEVETSTITSAVG------DVTLGAKNHNFKSQTFKIPTNCDLCGERI
WGLSAK------------------------------------------------------
---------------------GFDCRDCGYTCHSKCEMKVPAECP---------------
--------------GEQSKEDRKK-------------------------LKAERQEAANT
L-LKPSASTTHKKTPSSTEGMAELPALSRSDT---MNSLSSGYA-ASAHRSISGARSP--
--AEEMPPG---------------------------------------------------
-----------------------------------------------------EAPAAPK
PA--NTLRKNRVIAPPPAAYISELPGSSP-------------------------------
------------------------------------------------------------
--ANGSSGIGAGKTPEQKGKMLYGFDANGEGELTVPAGRDLVILE---------PD----
--------------------TGSGWIKVRAGYKEGLVPATY----VELAPAGAPSA----
------------------------------------------TVIAPPPVMAPQHTGA-S
GRPGSIYSNSGSS-----------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------IGGTA--PAVKK---KGPAVAPRR-G
AKKAVRH----VDVMYDYTAQSDAEHSIV-------------------------------
EGERLVLIKEDPG---DGWAEV-EKGGLT----KSVPASYLQL-V---------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------
>gi|46137691|ref|XP_390537.1|	   736 residues, 50 /line  hypothetical protein FG10361.1 [Gibberella zeae PH-1]
------------------------------------------------------------
----------------------------------MAEVDVMPTFGSELKDGFKPANVWL-
---------------------------------------GHGIAWLDEIQQFYRERAAIE
KEYSAK---LMALSKKYFEKKNKRTAQ---LSVGETP-----------------------
-------------------------------------------------------AMTPG
SLESASLTTWATQLTTLESRA----------------------GEHDKYANNLVS-----
--------------------QVAEPLKFFGGRFEELRKRHSDY-----ATKLEQERDSQY
AALAKTKGKYDNVCQEV---------------------EAKRKKTESHFD--KAKTQNAY
QQQILEMNNAKNTYIIAINV---------------------------------TNKQKEK
YYHEYVPEVMDSLQDLSEFKTT----KLNSFWTIATNIESEMLQQSNGMVQHQGNEILRN
LPHLDSMMYIQHN------------MGAFNEPAD--------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---KHFEASPVWHD-------------------------DGTMVVDETAKVFLRNVLGKS
KSQLGELR------REVDKKRREVEGVKQLKQRVREGKEK-KDE-----VEVVRALFQMQ
ENLHAIDRQRLTAEVETSTITSVVG------DVTLGAKNHNFKGQTFKIPTNCDLCGERI
WGLSAK------------------------------------------------------
---------------------GFDCRDCGYTCHSKCEMKVPPDCP---------------
--------------GEQTKDERKK-------------------------LKAERQDAANN
KLLKPSATMTS-----VHSNNSDAPELTRSNT---MTSLSSHSARPSISGSISAQLTP--
--TEETPPEVARP-----------------------------------------------
-------------------------------------------------SV--SSTAT--
---SGTAPKRRIMAPPPTAYIKDSGANET-------------------------------
------------------------------------------------------------
---------NGGAKEEKRGKMIYPFEATGEGELTVQDGRDVVLLE---------PD----
--------------------DGSGWVKVRAGYKEGLVPTSY----VEFTTVTIPS-----
------------------------------------------------------APAP-S
ARPSSTYSTSTTS-----------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------S----LTQSNKK---KGPAVAPKR-G
AKK-LRY----VEALYEYAAQAETEHSMA-------------------------------
EGERFVLVQEDPG---DGWVEV-EKAGVT----GSVPASYVQA-V---------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------
>gi|85103499|ref|XP_961527.1|	   724 residues, 50 /line  hypothetical protein [Neurospora crassa OR74A]
------------------------------------------------------------
-----------------------------------------------MQDGFKPANVYV-
---------------------------------------ANNIAFFDDVQAFFRERSAAE
KRYSAE---LSAIAKKYYDKKAKKSTS---LSVGDTP-----------------------
-------------------------------------------------------TMTPG
SLESASMTTWSTILTKLELVA----------------------SEHDRLANEFVT-----
--------------------KIAEPIKEVAIKLDAQRKRQVEY-----AEKLEKEKEAQY
AALQKVKTKYDSVCQDV---------------------ESKRKKSESAFD--KAKAQSSF
QHQLQEMNNMKNTYLIAINV---------------------------------TNKQKEK
HYHEFLPEVMDNLQDLAEFRTM----KLNGFWSEATQLEFSMLQNCSGEVDHMAKEIVRN
EPQLDSMMYMQHN------------TGAFQEPPD--------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---KVFEPSPVWHD-------------------------DDSMVTDEPAKIYLRNVLNKS
KGQLGELR------REVDKKRREVETTKRAKQRVLEGTEQTQDE-----FLVLTQLFLQQ
EDLHQVDRKRLTAEVETSTITSAVG------DVTLGAKSHNFKSQTFKIPTNCDLCGERI
WGLSAK------------------------------------------------------
---------------------GFDCRDCGYTCHSKCEMKVPAECP---------------
--------------GELNKEERKK-------------------------YKQERQELANT
L-LKPSTSS---------SHVNEMPDLTRSNT---VSSVRSGYA-ASAQRSISGPISP--
--GDDAPPDVPNT-----------------------------------------------
-------------------------------------------------R-PPAASPEP-
---SSVPRKNRILAPPPPAFMSEVPGSAS-------------------------------
------------------------------------------------------------
---------NGGGHQEQKAKMLYTFEAGGEGELSVLEGRELVVLE---------PD----
--------------------TGSGWTRVRAGYKEGNVPTSY----VEILPPTTPTA----
------------------------------------------LV--------PQHTGQ-S
GRPPSTYSNSGSS-----------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------IA-----ASTKK---KGPAVAPRR-G
AKK-LQY----VEALYDYQAGSDTEHSMT-------------------------------
VGERFVLIKEDQG---DGWAEV-EKGGVT----KSVPANYVQT-V---------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------

Ad blocker interference detected!


Wikia is a free-to-use site that makes money from advertising. We have a modified experience for viewers using ad blockers

Wikia is not accessible if you’ve made further modifications. Remove the custom ad blocker rule(s) and the page will load as expected.