Fandom

Proteins Wiki

At2g07090.1/MSA

< At2g07090.1

47,923pages on
this wiki
Add New Page
Talk0 Share
>gi|3805759|gb|AAC69115.1|	   159 residues, 50 /line  hypothetical protein [Arabidopsis thaliana]
-------------------------------MSSS-------------------SVT---
--SRVARER--------------------------------------------G-VAG--
ERGVPS-KC---L-C--G--S-EVTIFVSKTQENQGRPF-----FRCVRNRDVNTW--TT
KRDGHLFKWVEDPV--FEE-VEDALPR-----L-------AI---VAN-----------E
ISKVKAE--------------T-----------------------NEMLNQIQE------
----------------------LKEEAIARKKE---LVK---------------------
-----------CKEWL--------------------------------------------
-----------YVCFLLLCV----I-TIVVA--YVMFGQG-----------------NQK
KLSI----G------Y
>gi|116831258|gb|ABK28583.1|	   155 residues, 50 /line  unknown [Arabidopsis thaliana]
-----------------------------------------------MSNQSTSSFG---
--STGPRGRGKV------------------------------------------------
-VGVPK-RC---W-C--G--E-GVVALISKSDMNPCRRY-----YRCGFTAK---H--RL
RNDEHTFKWVDEAL--LNE-IETLIDK-----T-------RE---IEQ-----------E
LKELRTE--------------R-----------------------MVFERMVSE------
-------------KLEIKIENEVLEKVEEALSE---AKA---------------------
-----------SSKKM--------------------------------------------
-----------MIVMVIGCM----I-LLGIT--KFV------------------------
--------G------G
>gi|15230758|ref|NP_189655.1|	   125 residues, 50 /line  unknown protein [Arabidopsis thaliana]
-----------------------------------------------MSNLSTSSTG---
--STGPRGRGRV------------------------------------------------
-VGVPK-RC---W-C--G--E-GIVALTSKSDSNPYRRY-----LRCGFAAA---N--KL
RNDEHTFKWVDDAL--IND-LDKLNAK-----I-------EE---VEQ-----------Q
------------------------------------------------------------
-------------------------KVDDALAE---SKE---------------------
-----------GNKKM--------------------------------------------
-----------MIVVVIGCM----I-MIGLS--KLV------------------------
---------------G
>gi|124360277|gb|ABN08290.1|	   157 residues, 50 /line  hypothetical protein MtrDRAFT_AC155889g38v2 [Medicago truncatula]
MPCRKR-LVFVGILPRR-------VIYF-------------------YLEGTPVQGT---
--H--MVLQCTVVN----------SKT---------------------------------
SSGMLP-TC---H-C--G--L-PIVIYIANTRQNKGRRF-----LKCCNW--------MK
NNTCDLLIWDDLLA--AGT-RP--MVA------------------VTS-----------K
MSIVGSR--------------E-----------------------VSFRRDVES------
----------------------KEKKS-----N---C-----------------------
------------------------------------------------------------
-------------------A----I-VMQGV--YELKKDK-----------------WKK
NLLVEKKKV------E
>gi|125544223|gb|EAY90362.1|	   147 residues, 50 /line  hypothetical protein OsI_011595 [Oryza sativa (indica cultivar-group)]
-------------------------MAI-------------------YCSDRSSGSS---
--H--PTNRAPIPT--------RVGPY---------------------------------
DYQPAV-MC---Q-C--G--A-KAARWISWSVDNPGQRY-----YRCRNR----------
GVGCNFFDWYDPAT--SSF-LRELLND------------------LRE-----------A
VLSLRRE--------------K-----------------------NELQRCVEE------
----------------------LRPKVQEQCIE---L-----------------------
------------------------------------------------------------
-------------------G----V-AMNEV--AQLRLVA-----------------AEN
EANMAAMRA------I
>gi|22328328|ref|NP_680587.1|	   140 residues, 50 /line  unknown protein [Arabidopsis thaliana]
-----------------------------------------------MSSSSVSVSS---
--G---------------------VDG---------------------------------
ARGFPV-NC---A-C--G--A-DVTIFTSKSQDNPGRPF---------------------
-SGGDLFKWVEDVV--QEE-VVDALEK-----F-------GI---IAN-----------E
LNKIKSE--------------A-----------------------KELHVMLQE------
----------------------LKEEAELGKKK---FRK---------------------
-----------WKVCL--------------------------------------------
-----------TMCFVWLCL----I-TIAIV--YVMFGNK-----------------KKQ
EFVM----L------Y
>gi|46805992|dbj|BAD17266.1|	   171 residues, 50 /line  hypothetical protein [Oryza sativa (japonica cultivar-group)]
-----------------------------------------------MEASYTSGGG---
--RCAISRRCRVP-----------LVA---------------------------------
PSIPEL-KC---A-C--G--H-AVAVQTSNTPRNPRRRW-----LQCPG----------E
NCRCALWIWED-LL--NEY-VEEMLSK-----E-------YIRVQVTH-----------G
IDEIGGIEPLRSIPSIGNFAAH-----------------------DDVAGELAI------
----------------------FRGTSTSW------------------------------
--------------VV--------------------------------------------
-----------VAGAISLAP----V-VVAGA--APIAVGK----LRF----------ADN
GEWGMGNRD------G
>gi|125544854|gb|EAY90993.1|	   183 residues, 50 /line  hypothetical protein OsI_012226 [Oryza sativa (indica cultivar-group)]
-------------------------MAS-------------------SRSEGSSVSS---
--R-H-TSASPILY--------RVGPL---------------------------------
EYEPAV-AC---R-C--G--N-KAVRWISRISDNPGRWY-----FKCVNAR---------
SGGCDYFAWVDGPL--SSF-LREVLND------------------LRD-----------E
VWKLRRE--------------K-----------------------GDFPAAVEEGRFAQS
ELV-LARNELATSRKAVGEKEAIVGVLKDTNSR---LEF---------------------
-----------ERYSH--------------------------------------------
--GGSMRIDPGVLAFLDGAG----P-ADVFF-----------------------------
------FSG------S
>gi|125591382|gb|EAZ31732.1|	   215 residues, 50 /line  hypothetical protein OsJ_015215 [Oryza sativa (japonica cultivar-group)]
-------------------------MEN-------------------IYTNIPPPHN---
--T-RDRGDIALPFRRTGGRVGRTCDTASLPQPGRAAAWWRAVVR----GPK-A-VARRH
GAGPQR------S-C--G--A-AARDHAGRTGSFLGEPRDGSNIVPFFLYIE-------Q
DGGCTFWSWYEPET--TPY-LRQVLND------------------LHN-----------V
VRGLKEE--------------K-----------------------SILRASLVSARAQID
ELTAVHNGDVADWTRKLKEKDDLACELRARVVQ---LEE---------------------
-----------GRKLL--------------------------------------------
------------LLIVAGLV----L-LIVAL-----------------------------
------WLR------G
>gi|56202011|dbj|BAD73518.1|	   150 residues, 50 /line  hypothetical protein [Oryza sativa (japonica cultivar-group)]
-------------------------------MSSA------------TLFSRASPSR---
--V-G-----------------RVCEV---------------------------------
SELPLV-KCPFCN-V--D--S-MIVERTCKKQDNFNRKF-----YRCLRGQN-------S
GAQCKFFMWQGEYA--V---------W------------------LVK-----------E
GVLHAWT--------------D-----------------------CNAQRTQVEVPDSLN
A--------------SMGGVNDTIEKMRSELKK---AMS---------------------
-----------TIRVA--------------------------------------------
------------GIILVTAV----V-VFVAM-----------------------------
------NAM------K
>gi|77553870|gb|ABA96666.1|	   119 residues, 50 /line  hypothetical protein LOC_Os12g09690 [Oryza sativa (japonica cultivar-group)]
-------------------------MAS-------------------SYSECSSTSS---
--H-P-TNRAPIPP--------HVGPF---------------------------------
EYHPVV-MC---K-G--G--A-KAARWISWGVDNPSRRY-----HKCHNQRE-------K
---AELEHFVDELR----------------------------------------------
-----TK--------------E-----------------------EEQCAEITAARHELA
A----------------LRLVASKD----EAKI---IGL---------------------
-----------KPKI---------------------------------------------
-------------FDIS-------------------------------------------
----------------
>gi|92868390|gb|ABE78395.1|	   147 residues, 50 /line  Zinc finger, GRF-type [Medicago truncatula]
-------------------------MGG-ARMGKN------------NYNNRYSSSS---
--S-M-YN----------------------------------------------------
DDVREL-QC---W-C--P--R-IYVVRRANTVNNPGRLF-----YVCPLHKD-------D
CENCNFFAWVDEAE--E-------LGY------------------FKN-----------N
DAGHGRN--------------A-----------------------RLIEKPNDRGREEVW
R----------------ARLMDKVDCVGSELRL---IKL---------------------
-----------LIGV---------------------------------------------
-------------FCLIELF----K-MLLYC-----------------------------
------AKS------M
>gi|116831656|gb|ABK28780.1|	   166 residues, 50 /line  unknown [Arabidopsis thaliana]
-----------------------------------------------MSCNSR-------
-----------------------NSSGESGG----------CNSGMI-SNAEAG-GFK--
SRGFPV-KC---K-C--G--L-DVVMFTSSTAKNPGRPF-----FRCKSCE---------
--DDHLFKWVEDCM--YEE-VIDALPK-----I-------SS---IDN-----------E
IINAKAE----------VAVEI-----------------------ANLKELMIELKEDGM
-------------W---------------SKRE---IQRWK---KMTKV-----------
------------------------------------------------------------
--------------CLV---CLCFS-VIAIV--ISMFYKK-----------------KTQ
KFVL----G-----YG
>gi|125558950|gb|EAZ04486.1|	   149 residues, 50 /line  hypothetical protein OsI_025718 [Oryza sativa (indica cultivar-group)]
-----------------------------------------------MGTRSS-------
------------------------------------------------GSSSSAQRRR--
SDLPLI-KC---P-C--CRVK-NIVELTATTDANRGRIF-----FTCPDHEK---D----
GSGCNFWYWEEGYV--KYL-ERKGYI------------------------------ADKE
LRDVKHM----------SE---------------------------RKKAVNNEDGGED-
--------------------------------------EVK---KLMLSLVSI-------
---GLEIV--QILKGMLV------------------------------------------
--------------GFI---LLIV-ALVCLV--LAVWL----------------------
---------------K
>gi|2598591|emb|CAA75590.1|	   221 residues, 50 /line  MtN20 [Medicago truncatula]
------------------------------------------------------------
------------------------------------------------------------
----AP-TC---D-C--E--A-KCVIFISRTKKNPDRPF-----FRCPYYGQI--R----
KTHCDYFMWEDDFI--ASQ-AAMVELQ-----E-------TT---IERKMEAMIIQMNKD
MKAMKIQ----------INK--------------------------DMEAKINELKRDTE
-------------YK----------FNILEREI---EAMTF---QISADVVAFDIKHFFG
WFEGLEMI--LFFESRLKLSIDKVVFDLSVSLGVDLWKKEWVVPCIF-YEWHSNPLLRTF
RYFGVVFFSFFQRSTID---VLELG-LVCVL--FIIK-----------------------
---------------C
>gi|44889954|gb|AAS48495.1|	   128 residues, 50 /line  polyprotein [Banana streak virus]
------------------------------------------------------------
-------QR------V-NDVVKRYEDWLSKG----------------YRLHQINVLTL--
SEEPVF-KC---G-C--N--K-PAKLKISRTSRNPDREF-----YSCE------------
TNTCFTWVWKDQID--SFV-QEKIR-----------------------------------
-----------------------------------------------WEKKLEEISEDSL
-------------WE----------ELLREQEN---LRAEQ---EYLIE-----------
--DALDLL--DISN----------------------------------------------
------------------------------------D-----------------------
---------------D
>gi|44894456|gb|AAS48725.1|	   142 residues, 50 /line  ribonuclease H [Banana streak virus]
-----------------------------------------------------LSRLVQT
LLQGWQHQH------L-NGILLALEELYQKPNPEVAKKIGQIIMKVLEKPAGIQINMI--
TEGPKL-RC---A-C--G--K-DAEIAVSHTSRNPDRPF-----NKCQ------------
RNLCHIWIWKDLVD--DYF-QNLTA-----------------------------------
-----------------------------------------------WNRISEEHR----
--------------R----------EMAREEGQ---NLEEE---DYWGE-----------
------------------------------------------------------------
------------------------------------------------------------
---------------C
>gi|89257458|gb|ABD64950.1|	   180 residues, 50 /line  GRF zinc finger  containing protein [Brassica oleracea]
-----------------------------------------------MGEIINPVRDSSS
ILFDFVLKN------LDSHLSFFEYRMMSSG----------------CEDSSVNT-MG--
ILGIPE-QC---G-C--G--R-RTGIYTSKTKVNPGRTF-----FRCPTF----------
-QNDHLYKWVDEAV--YEE-VQDALPK-----V-------EC---FAS-----------D
VMKIKME----------IE---------------------------SMKTVEEDLKEDVR
-------------K---------------ACNE---LKKLN---VIMKV-----------
------------------------------------------------------------
--------------GFS---VVCLGVLICLV--LIMFDKA-----------------DGL
SMN-----------SY
>gi|46391026|dbj|BAD15969.1|	   184 residues, 50 /line  hypothetical protein [Oryza sativa (japonica cultivar-group)]
-----------------------------------------------MAGRGSPIRSTSS
-----------------------------------------------GCSFQRTRAAA--
SSAPWL-RC---A-C--G--K-AAAVNKSNTPRNPGRRW-----IQCGK------E----
PKCCSLWIWEDLLN--EYV-EEMVAYS-----H-------AG---EDDGLRDMLRQLAEE
HKEERSR----------MQGLV-----------------------EANHRQMQSIYQQLN
-------------D---------------SKKK---CEQLK---KMLKE-----------
---------------------------EKCSRSR--------------------------
----------------Q---LYVMLFLLAII--MYFYDKS-----------------GSS
RYKL----ILCVYSKS
>gi|15241848|ref|NP_198209.1|	   156 residues, 50 /line  unknown protein [Arabidopsis thaliana]
-----------------------------------------------MSYISG-------
-----------------------NSY----------------------PRIQDG-GRW--
ERGFPS-KC---E-C--G--L-DVVIYTSASKTNPGRPF-----FRCPTKQ---------
--DDHLFKWVEDGV--YEK-VADALPK-----F-------SI---IDS-----------E
INNAKSE----------VTIEI-----------------------EVLKAMVEELKEEGM
-------------W---------------TKRE---IKKWK---WMSTL-----------
------------------------------------------------------------
--------------SLV---CLGFI-VMVLVLGILMFGNI-----------------KKE
KLVL----G------Y
>gi|15240958|ref|NP_198102.1|	   187 residues, 50 /line  unknown protein [Arabidopsis thaliana]
-----------------------------------------------MNSSSE-------
-----------------------TS-------------------------------VG--
GRGIPT-KC---V-C--G--L-GVTKFTSKSQDNPGRPF-----FRCISKRD---P----
SSWKNKKDWVEDAV--YEE-VEDVLPN-----L-------GI---MAN-----------E
IVKARSE----------VNEIV-----------------------NELSASIQELKEDAM
-------------C---------------SKME---IRKLK---VLVKVSL---------
---SVSIV--VRVSVVLV----------------------SVVACVVLASLVLASSVFVV
RVSAVVAYAMTERPVI-------------------LARLE-----------------IRP
M---------FVFGQT
>gi|15218581|ref|NP_175059.1|	   153 residues, 50 /line  unknown protein [Arabidopsis thaliana]
-----------------------------------------------MSSSSA-------
---------------------------------------------------TSG-VVG--
DRGVPC-KC---V-C--G--L-SVTVFTSKSQDNSGRPF-----FRCISKRDAKTW--TN
NRNGHLFKWVEEAV--FEE-VEDALPR-----L-------AV---IAN-----------E
INKAKSE--------------A-----------------------LELKAMIQEILEEAL
-------------I---------------NKMQ---IRRNW---CGLKLGF---------
------------------------------------------------------------
-------------------VWLFVI-TIVIV--YVLFGQD-----------------NEK
KLVA----G------Y
>gi|116831339|gb|ABK28622.1|	   176 residues, 50 /line  unknown [Arabidopsis thaliana]
-------------------------MGL-HS----------------YTQPSESSQHSES
PTSYGLV------------------------------------------YPSQP-STP--
ILGIPR-RC---Y-C--G--G-IVVLASSSSEDN--RQF-----YQCEKREA---R----
-PGRHLVKWLDESL--VDK-IAALKCS-----V-------RE---QDE-----------H
IKFVV------------------------------------------TGSNGERIDPPYM
-------------WDRLDLYQQEIKSLQHQVGL---LERS--------------------
---PRTII--DQVHS---------------------------------------------
--------------CPPHIILVLVI-LVPIV--AFVLGTY--------------------
--------M------G
>gi|125536286|gb|EAY82774.1|	   151 residues, 50 /line  hypothetical protein OsI_036733 [Oryza sativa (indica cultivar-group)]
-----------------------------------------------MSQGSSRAPVVVR
PP---SR----------------------------------------------F-PLG--
PSGIPL-IC---CP---S--C-GKGVEEYKSKKQGGRIF-----FKCPDNEQ---Y--D-
PNSCSFFKWIDSYLKMIEG-MDLYTPE-----D-------GV---VGD-----------D
FAAPIAH--------------V------------------------VPAHLDADGDKEVT
-----------------GKMATGGKMDVMQMLV---LINL--------------------
---GQLVV--M----F--------------------------------------------
-----------V----ALCV----M-FL--------------------------------
---------------K
>gi|15224644|ref|NP_180064.1|	   142 residues, 50 /line  unknown protein [Arabidopsis thaliana]
------------------------MMAQ-RSLFQCE-----------SSVDEELDRMEIR
TLTRYGE----------------------------------------------N-RRR--
DKGVPI-EC---DC---N--A-KVVVVTSLDPVTTGKLF-----FSCPYEIS---D--GP
GQGCGFKRWWTVAL--CDE-FDMIKEE-----T-------TE---MKK-----------D
LEAANKR--------------V--------------------------ESLAEKIFLMEK
-----------------KFETLEKKYE---------------------------------
------------------------------------------------------------
------------------SL----N-KY--------------------------------
---------------L
>gi|53370694|gb|AAU89189.1|	   163 residues, 50 /line  hypothetical protein LOC_Os03g44600 [Oryza sativa (japonica cultivar-group)]
-----------------------------------------------MEGGSS-------
--SSSTN----------------------------------------------R-RKG--
NGRLPLIKC---PCC--D--CETIIRRAANTPENKGRIF-----YTCPCHQR---D----
GIGCRFWYWEEQYEEYLIN-TGHLASR-----A-------VH---IQS-----------P
CSAVRVQ--------------T--------------------------NAMVQQGAQPYI
-------------ENDAEQIAKQIKLLVRRMNL---LIDI--------------------
---GRDIV--ALLRCV--------------------------------------------
-----------V----AACV----V-VAVTN--MYAFFRS--------------------
---------------G
>gi|125538960|gb|EAY85355.1|	   153 residues, 50 /line  hypothetical protein OsI_006588 [Oryza sativa (indica cultivar-group)]
-----------------------------------------------MASSSL-------
--ASACT----------------------------------------------R------
RNKVPLILC---LSC--E--NKTVVKRTSKTVSNLDRIF-----YTCPDHEK---D----
GSGYNFWFWEEGYMKYLKK-NGLIAGE--------------------------------E
AADVNAQ--------------V-------------------------AASLKNAGQ----
-------------LDETEVLREDDDELKQTLIT---AVSI--------------------
---GRELV--VVLKNM--------------------------------------------
-----------LVLGWLGVA----V-LVCIL--VVLMM----------------------
---------------K
>gi|48717079|dbj|BAD23767.1|	   147 residues, 50 /line  hypothetical protein [Oryza sativa (japonica cultivar-group)]
-----------------------------------------------MASAST-------
--SLLSS------------------------------------------------RRR--
RLVVPLITC---PSC--N--VKTIVRCTAKTDANRGRIF-----YTCPDHEK---D----
GSGCNFWYWEEGYINYLKR-NGFIVGQ-----D-------GT---YGK-----------T
AQN---------------------------------------------------------
-------------VDLDEDAFVRQDEIEKKLIA---VVPI--------------------
---GREIL--LAVKGM--------------------------------------------
-----------LVLGLFGVV----I-LVCIL--VVLLM----------------------
---------------K
>gi|15240374|ref|NP_198604.1|	   154 residues, 50 /line  unknown protein [Arabidopsis thaliana]
-----------------------------------------------MSNSSGATSG---
--ASNVG----------------------------------------------Q-RRR--
FVGVPK-MC---WC---G--A-TISALMSKSASNPYRRY-----YRCAYAAT---H--KL
VDDNHTFKWVDEAL--LDE-IERLTRR-----T-------AA---LEE-----------T
MSQITTE--------------N-----------------------MEHQKMVFEKMQMKL
---------------EREIV----ESVEEELLE---SKS---------------------
-----------SMKKM--------------------------------------------
-----------SIAVIVGCM----I-MLGLS--KVI------------------------
---------------G
>gi|125582557|gb|EAZ23488.1|	   173 residues, 50 /line  hypothetical protein OsJ_006971 [Oryza sativa (japonica cultivar-group)]
------------------------MAAS-GSSTVRG-----------SHVEGSMLRHPRH
ASSSSTG------------------------------------------Q--IR-FTP--
SSLLPLVYY---PDC--G--E-QIVRYVSRSKKNPNRVY-----YKCSNRTE---R----
NAPCDFWYWKECYQKYLID-HGLLNGD--------------A---SRE-----------E
IKGDSSE--------------E-----------------------D--------------
---------------EVEDLGSK-----KKLID---VVLM--------------------
---MRSEV--KQQTLY--------------------------------------------
-----------LKIAAFGIVVFGAV-LLGMI--AVVVAKG--------------------
--------F------L
>gi|22327446|ref|NP_680366.1|	   142 residues, 50 /line  unknown protein [Arabidopsis thaliana]
-----------------------------------------------MSFKSSSNVQ---
----------------------------------------------------EG-VSG--
NRGFPSK-------------------SLRERCRHPHIKF-----EEEPRKTL---L--PL
SNISRYFVYEE-IVDAIPR-INTIGSE-----I-------SI---AKS-----------E
V---AVE--------------I-----------------------AELKGLIQEMKEDER
-------------WN---------------------------------------------
----KMEL--KRWKSM--------------------------------------------
-----------TGLCLV---CLSLS-VIAIL--IIMFYKN-----------------KNR
KLVL----G------Y
>gi|89257531|gb|ABD65021.1|	   107 residues, 50 /line  hypothetical protein 26.t00076 [Brassica oleracea]
-----------------------------------------------MSASSS-------
--TTGGR----------------------------------------------R-RVR--
TLGIPS-KC---W-C--G--V-GITELISKTNQNPYRRY-----YRCIYAAS---L--RL
ENNNHVFKWVDEAF--TDE-IQQLDCQ-----P-------KM---LK-------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------IKISGGCVILAV---VLVL--GIMMYK---------------------
---------------K
>gi|11994786|dbj|BAB03176.1|	   159 residues, 50 /line  unnamed protein product [Arabidopsis thaliana]
---------------------------MKNKHTFIQFDN-EY------------------
------YSE-------------EHEC-----------------------------PIV--
TLNHP------------H--P-KLVEIVERRVPMQ-IGV-----FQSNVFVDEE-----Y
ESRNHLIQWWDQAV--TEE-LEKVNHSLDSALRQGQLACN-H---ALE-----------S
IRETVH---LMQGEIETLKERSKDETGDG-------------------------------
---------------------------------ELIAERSDGNFRESPEKS------P--
--------------FR--------------------------------------------
--------------------LIGEE-SDNF------------------------------
---D----F------F
>gi|15224450|ref|NP_178577.1|	   165 residues, 50 /line  unknown protein [Arabidopsis thaliana]
---------------------------MPYSYSQPSTSE-AS------------------
------W-----NS--------GEAN-----------------------------ADA--
NWGVPV-KC---F-C--G--K-PVKLEVCKTGYRQDDRV-----YKCPMLKDEE-----Y
ESRNHLIQWWDQAV--TEE-LEKVNHSHYSALRHGQLACN-H---ALE-----------F
VQEIVR---LMQGEIETLTERLLAK-----------------------------------
---------------------------------EVEIDRLRALLSTWESYD------V--
--------------FY--------------------------------------------
--------------------VIEDV-LWHYVMF---------------------------
--LD----F------M
>gi|15230678|ref|NP_190122.1|	   126 residues, 50 /line  unknown protein [Arabidopsis thaliana]
---------------------------MPISFNGSSDSS-PS------------------
------EKSDGFDY--------YNAI-----------------------------RDG--
NWGIPT-KC---Y-C--G--R-DVEKGNVVGGNLHGKTR-----FRCPLNLTE-------
VDGEHLQKWWEEAI--EEE-FSKYYSRKDKR-EEGPPAWQVP---MFE-----------P
IHEKIR---IMNDRITDLE-----------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------T
>gi|89257569|gb|ABD65058.1|	   172 residues, 50 /line  GRF zinc finger containing protein [Brassica oleracea]
---------------------------MAQSSNSFT------------------------
-------------------------------------------------------IDN--
KKEKVV-VC---N-C--N--F-EAKVLQAWTVDNPGRRF-----YTCEGRRVSN-----G
YQTCNFFRWYDVEK--PH-------GWQYTALLGA-----KN---VMR-----------Q
QREEIS---NLQNQVRELSLENVRIGGAVRLENESSGQTPPDSDL--NCEACETLRGEIL
-------------V---------------LTERSMVYRNVLITLAVGFTVV------I--
--------------CV--------------------------------------------
--------------------FMGIL-K---------------------------------
---------------W
>gi|125543298|gb|EAY89437.1|	   179 residues, 50 /line  hypothetical protein OsI_010670 [Oryza sativa (indica cultivar-group)]
------------------------------------------------------------
--------------------------MD--YQ-----------------------P----
----PV-FC---D-C--K--A-KAARWISWSVDNPGRRY-----FKCRDARA--------
GGSDFFFAWCDGPT--SNF-LRELLNDLR------------D---TVM-----------S
LRTDKR---HLQQEVEDCRARLEEE---------RTRFEAARKEMVAVREIVQDNLAKLT
-------------A---------------LKAR---ISKCGLFVRSGCGVV------CQK
LNVGSDECVEQNGSLF--------------------------------------------
--------------------IIDSQ-LVPKLNFVLN----------------------PS
HAIY----I------W
>gi|125552136|gb|EAY97845.1|	   181 residues, 50 /line  hypothetical protein OsI_019078 [Oryza sativa (indica cultivar-group)]
------------------------------------MSS-SMSDGSS-------------
--STRESKASPVPY--------RVGPLE--YQ-----------------------P----
----AV-MC---R-CRPP--A-KAARWISWSTDNPGRRY-----YKCQNARGLKWGFFLQ
QGGCDFWAWYDGPT--SSF-IRELLNDLR------------D---RVN-----------S
LRRENE---VMRKEVEQSRDKVEVQ---------SKVID-------DARGVVAVKNAEIM
-------------C---------------LKAR---NHK---------------------
--------LEKERKVF--------------------------------------------
--------------------VICVV-SCMFVLFVVL------------------------
--FG----K------K
>gi|44894454|gb|AAS48724.1|	   138 residues, 50 /line  ribonuclease H [Banana streak virus]
------------SLIKATTEVLQKENPISRSRLALCISR-ALG--------NK-------
--YQVDFI--------------------TWEQ-----------------------P----
----QL-KC---A-C--G--E-NAVLLTSHTSRNPGRRF-----YRCGT-----------
-NTCHVWYWADL-I--EDY-IAQLS-NLQ------------N----LD-----------S
GQADDE---GWAYQTEDLIN-PE---------------------------------DLAN
-------------S---------------DIDD---PPE---------------------
--------DSDLFH----------------------------------------------
------------------------------------------------------------
---------------R
>gi|77407540|ref|ZP_00784363.1|	   181 residues, 50 /line  hypothetical protein SAI_2423 [Streptococcus agalactiae H36B]
MFYKTSNRKWNVSNLLSFSLQVKEDMGLDYSYTQPSLSE-EYGDNSADSGYSQ-------
--MEADILLDQTEI--------ESARRQYPPQ-----------------------PEV--
EFGFPK-EC---Y-C--G--G-EPLVATSYTRNDPGRRY-----YTCENI---------D
DGDCHVWKWWDVAA--TEE-IRALSRHCG------------Q----LS-----------D
K-VDYL---TCVSDYDTQLNQVK---------------------------------ELHY
-------------E---------------AEQK---LVS---------------------
--------LERIRI----------------------------------------------
------------------------------------------------------------
---------------T
>gi|89257681|gb|ABD65168.1|	   154 residues, 50 /line  hypothetical protein 40.t00055 [Brassica oleracea]
-------------------------MGQDYSYSQSSSSD-EYDITSLIQAEAE-------
--LYGDEAESNY-H--------IAEPLQYQPQ-----------------------PEC--
DEGIPR-IC---Y-C--G--G-DPVVAISSTAKDPGRRY-----FTCPNV---------D
DGDCHIWKWWDVAI--TEE-MREFQT-------------------QLR-----------Q
LKDQGF---ECEQKLEELQ----RS---------KSDRPTNIANMLGIREDVH-------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---D----K------R
>gi|4115932|gb|AAD03442.1|	   160 residues, 50 /line  T4B21.8 gene product [Arabidopsis thaliana]
-------------------------MST----------N-SYYSSASSSGF---------
-------------------------------------------------------RVC--
PPGVPS-KC---W-C--G--E-EIITFTSKTKENPYRRF-----YRCAIAMK-------R
ENEEHLFKWVDEAL--LDE-IKMVNEKCK------------R---VVE-----------N
ISDLRM---NVMANMELLNKNAKQM----------------------EEELIKKMEGELL
-------------T---------------MKEN---VEELGHVMAKSALKT---------
------------------------------------------------------------
---------------------VGVA-VVIVASIVWL------------------------
--WG----R------V
>gi|15225743|ref|NP_178758.1|	   143 residues, 50 /line  unknown protein [Arabidopsis thaliana]
------------------------------------------------------------
-----------------------M-------------------------------GDR--
GRGIPS-RC---R-C--G--E-DVVLRTSKTVKNPRRLF-----YACRCGEEN-------
-GSGHLFRLTDEVM--VEE-MEDILPK-----I-------DE---LEG-----------A
SLTLQKGLQALEFEMETLAMET-----------------------RTCEAVVCGYEKELL
-------------G---------------LEKE---IQGCKIELRGLKKIL------V--
------------------------------------------------------------
--------------------CKVLM-TLVYVFVL--------------------------
----------------
>gi|15230015|ref|NP_189602.1|	   139 residues, 50 /line  unknown protein [Arabidopsis thaliana]
------------------------MDRLCES------------DPWYDEMKSA-------
--KRIMQQL-------------EE-------------------------------VAM--
MEEIPI-IC---P-C--G--G-RILDIISEKDGDKGKRY-----YECTDYKND-------
-GL-HIQKLWDKAM--VEE-VNRLREQ-----V-------DN---HHQ-----------K
IQSLEYSNQEVLSEFDEI-------------------------------------QKKMG
-------------T---------------LWRV-------RNYW----------------
------------------------------------------------------------
----------------------VCV-NLISVFVL--------------------------
----------------
>gi|37903377|gb|AAP48903.1|	   191 residues, 50 /line  RNase H-like protein [Saccharum hybrid cultivar CP65-357]
------------------------MKNMAASYSQDAQLDLVLPDAPVDASASR-------
--SEHSSQLASSNW--------RS-------------------------------VIQ--
NSPPDL-LC---G-C--G--R-PAIRRTAETAKNNGRIF-----RTCPACK---------
-------IWIWQDL--LDSYVNALISYCRDASI-------DS---LQS-----------E
LESSRLLISEKQAQISRL-------------------------------------EKQLE
-------------T---------------LQPL---ISKYTEQS----------------
------------------------------------------------------------
----------------------RSI-AQASIPSSLFFLEACSLRHQRRRVNENQGGANFK
RSYW----S------D
>gi|15230792|ref|NP_189669.1|	   156 residues, 50 /line  zinc ion binding [Arabidopsis thaliana]
-----------------------------------------------MSSNSE-------
--NSIA---STQS----------V-------------------------------SRW--
GRGLPS-KC---H-C--G--L-DVVIYTSTYAKNPGRPY-----FRCPTRKDD-------
----HLFKWVEDGT--YEV-VVDSWPK-----L-------SV---MDS-----------E
LSAAKSEV----------AVEL-----------------------EALQAMVKELKEKVM
-------------R---------------SERE---NQIWK---LMIKLCC------F--
------------------------------------------------------------
--------------------CLAFT-IIVIVFGILMFPKI-----------------NEQ
RLFL----G------Y
>gi|30692217|ref|NP_850895.1|	   139 residues, 50 /line  unknown protein [Arabidopsis thaliana]
-----------------------------------------------MSSSSL-------
--TS-------------------G-------------------------------VVR--
ERGVPS-KC---V-C--G--L-GVTIFTSKMQETQDDHS-----SAALANEIR-------
----AC-----GLA--KKR-NEDALPR-----I-------DI---IAN-----------E
VSKGKSET-------------------------------------NVVKEQIQELKEEAL
-------------L---------------RKKE---LHKCI---WCLKVCF------V--
------------------------------------------------------------
--------------------WLFVI-TIVVVYG--MFGQG-----------------NQK
KLAI----G------Y



Ad blocker interference detected!


Wikia is a free-to-use site that makes money from advertising. We have a modified experience for viewers using ad blockers

Wikia is not accessible if you’ve made further modifications. Remove the custom ad blocker rule(s) and the page will load as expected.