Fandom

Proteins Wiki

At2g06555.1/MSA

< At2g06555.1

47,922pages on
this wiki
Add New Page
Talk0 Share
>gi|22325512|ref|NP_671788.1|	   159 residues, 50 /line  unknown protein [Arabidopsis thaliana]
------------------------------------------------------------
--------------------------------------------MSLPVG----LL----
------------------------------------------------------AGERLN
MTF---------------------------------------------------------
---SCLPTSFTIKIK-KTNSSLSMF---------------------------GES-----
SRLIKVSAKKKAK--------------------LSS-VEQESLKRPIGVKAAKA-SAKS-
------------------------------------------------------------
----------------KEKD--------------------LTVKERLSKHKLLDSLLNRS
-NGLSDMEIQ-IKNSLIQEYLSGS------NVFVSENEYSDFLLEASDVGKERRCGVLML
ECRVV
>gi|116830513|gb|ABK28214.1|	   156 residues, 50 /line  unknown [Arabidopsis thaliana]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------MKLAYEIYFNDTKKNFTLDHAWRELRYDQKWCEA---T
SRKGDKNAKRKKCGDG--N--ASS---Q----PIHV-EDDSVMSRPPGVKAAKA-KARKS
ATIKEGKKPATVKDDSG-------------------------------------------
----QSVEHFQNLWELKEKDW--------------------DRKEKQSKHQQLERLLSKT
-EPLSDIDLF-LKNKLITDLWS-G------------------------------------
-----
>gi|15242740|ref|NP_198302.1|	   301 residues, 50 /line  unknown protein [Arabidopsis thaliana]
------------------------------------------------------------
----------------------------------MDDMNPFY-QSSGFMD----LLQSQQ
ED-M----SQFASGSTEVPAFSSQLSEEGSELEGSEDEVKPKQS---ISRKKWTAKEDIV
LVSAWLNPSKDPVIGNDQQ---------AYVAASPSLDGLPKREHAKCKQRWGKVNKSVT
KFVACYKTTTTHKTSGQSEDDVMKLAYEIYFNDTKKNFTLDHAWRELRYDQKWCEA---T
SRKGDENAKRRKCGDG--N--ASS---H----PIHV-EDDSIMSRPPGVKAAKA-KGRKS
AIVKEGKKPATVKDDSG-------------------------------------------
----QSVEHFQNLWELKEKDW--------------------DRKEKQSKHQQLERLLSKT
-EPLSDIDLF-LKNKLITDLWS--------------------------------------
-----
>gi|11994605|dbj|BAB02659.1|	   203 residues, 50 /line  unnamed protein product [Arabidopsis thaliana]
------------------------------------------------------------
-----------------------------------------------------------M
EN-R----------------------------------------LPKCCKDRW-------
----------------------------------------------------SKISEGCC
KFVGSYVATTKEKTSGENDNDVMNFAHHSFHTDYKTKLTLEHVWREVMFDQKWCS-----
SNALNVPAKQRKQNE------SVG---D----HVTV-DLEGYQTRPIDVKAAKA-KAKGK
A-----KTRLTVEGDAN-------------------------------------------
----NTMTDMQYIWGIKEKNLIFK------EKPLNGKEKFLSEKNKLSNERLLESLLTKN
-ESVSDIELA-LKHKLITNMLS--------------------------------------
-----
>gi|15231533|ref|NP_189720.1|	   272 residues, 50 /line  unknown protein [Arabidopsis thaliana]
------------------------------------------------------------
----------------------------------MDSSNSYS-HQRSFLD----LFTSQE
EN-QVLAPIQYACFSPSIDVGSSEV------QWANDPSKVEQPIVNKKSRRKWGLTEDVV
LSNAWLNT--------------------------------------------SKDHVGCC
KFVGSYVATTKEKTSGENDNDVMNFAHHSFHTDYKTKLTLEHVWREVMFDQKWCS-----
SNALNVPAKQRKQNE------SVG---D----HVTV-DLEGYQTRPIDVKAAKA-KAKGK
A-----KTRLTVEGDAN-------------------------------------------
----NTMTDMQYIWGIKEKNLIFK------EKPLNGKEKFLSEKNKLSNERLLESLLTKN
-ESVSDIELA-LKHKLITNMLS--------------------------------------
-----
>gi|15231980|ref|NP_189733.1|	   239 residues, 50 /line  unknown protein [Arabidopsis thaliana]
------------------------------------------------------------
-----------------------------------MAVKSVQ-NKINAYP----PFMGSE
KQ-RIHHRRRDVVKEKSHGGSVLAL------KQFRQD-------PQCRLRGRW-------
----------------------------------------------------HQID----
--MGSYVAATKEKTSGQNDNDVLNFSHQSFYTDYKPKFTLEHAWREVRVDQKWCS-----
SNALNVPAKRRKQNE------SVG---D----HVTI-DLEGDQTRPIGVKATKG-KA---
------KAKLTLEGDAN-------------------------------------------
----NTMTEMQYIWGIKEKDLAFK------EKLLNGKEKFLSEKKKLRKERLLESLLTKN
-ESVFDIELA-LKHKLITDMLS--------------------------------------
-----
>gi|15226698|ref|NP_179211.1|	   311 residues, 50 /line  unknown protein [Arabidopsis thaliana]
------------------------------------------------------------
----------------------------------MD-PYPYS-HGSGFVN----LLTSQQ
EV-HTLETNPCD----DVPIFSTQCTDSPSL-----EEHVPKVK---RERMKWSAKEDMV
LVSSWLNTSKDAVIGNEQKANTFWSRIAAYYDASPQLNGLRKRMQGNIKQRWAKINDGVC
KFVGSYEAASREKSSGQNDNDVISLAHEIFNNDYGYKFPLEHAWRVLRHDQKWCS-----
--QASVMSKRRKCDKAAQP--STS---Q----PPSH-GVEEAMSRPIGVKAAKA-KAKKT
VT------KTTTVEDKG-------------------------------------------
----NAMLEIQSIWEIKQKDWELR------QKDREQEKEDFEKKDRLSKTTLLESLIAKK
-EPLTDNEVT-LKNKLIDFLLE-H------------------------------------
-----
>gi|15228231|ref|NP_190352.1|	   302 residues, 50 /line  DNA binding [Arabidopsis thaliana]
------------------------------------------------------------
-------------------------------------MDPYS-HGSSFMN----LLTSQQ
EA-HNLETNPYD----D--------DVSPNQ-----AAHTPKVK---RERRKWSAGEDLV
LVSAWLNTSKDAVIGNEQKGYAFWSRIAAYYGASPKLNGVEKRETGHIKQRWTKINEGVG
KFVGSYEAATKQKSSGQNDDDVVALAHEIY-NSEHGKFTLEHAWRVLRFEQKWLSA---P
STKATVMSKRRKSDK---A--STS---Q----PQTH-EAEEAMSRPIGVKAAKA-KAKKA
VS------KTTTVEDKG-------------------------------------------
----NVMLEIQSIWEIKQKDWELR------QKDREQEKEDFEKQERLSRTKLLESLFTKK
-EPLTDIEVA-LKNKLINEMLSNS------------------------------------
-----
>gi|15235196|ref|NP_192107.1|	   302 residues, 50 /line  DNA binding [Arabidopsis thaliana]
------------------------------------------------------------
----------------------------------MDSYNPFS-QASGFMD----LLHSQQ
ES-HNNETNQYEVGSSEIPVFGTQRCQESHE-----ERYASRVA---IARKKWAAKEDIV
LISAWLNTSKDPVVGNEQKAPAFWKRIASYVAANPDLDGVPKRASAQCKQRWAKMNELVM
KFVGCYATTTNQKASGQTENDVMLFANELFENDMKKKFSLDHAWRLLRHDQKWLIS---N
APKGKGIAKRRKVRVGTQA--ASS---Q----PIDL-EDDDVMRRPPGVKAAKA-KAKKT
---------PTVKGEEV-------------------------------------------
----NSVEHLTSLWDLKERDW--------------------DRKDKQSKNQMLESLLSRT
-EPLSECDLV-LKKKLIEELFS--------------------------------------
-----
>gi|30681793|ref|NP_850029.1|	   391 residues, 50 /line  myb family protein [Arabidopsis thaliana]
MEILS--RLPLKSLARFHCVSK--LWASMFGSPYFKNLFLTRSSAKPRLLFALVEKGDVK
EESCGVWSFFSSLQLDNLYEESSSTLVAA-----AEFHGKFS-PNNHYLPVLWTCCNSQQ
ES-HNNETNQYEVGSSEIPVFGTQRCQESHE-----KRYASRVA---IARKKWAAKEDIV
LISAWLNTSKDPVVGNEQKAPAFWKRIASYVAASPDLDGVPKRASAQCKQRWAKMNELVM
KFVGCYATTTNQKASGQTENDVMLFANELFKNDMKKKFSLDHAWRLLRHDQKWLIS---N
APKGKGIAKRRKVRVGTQA--ASS---Q----PIDL-EDDDVMRRPPGVKAAKA-KAKMT
---------PTVKGEEV-------------------------------------------
----NSVEHLTSLWDLKEKDW--------------------DRKDKQSKNQMLESLLSRT
-EPLSECDLV-LKKKLIEELFS--------------------------------------
-----
>gi|4314368|gb|AAD15579.1|	   300 residues, 50 /line  hypothetical protein [Arabidopsis thaliana]
------------------------------------------------------------
------------------------------------MADEQV-VLP----VLWTCCNSQQ
ES-HNNETNQYEVGSSEIPVFGTQRCQESHE-----KRYASRVA---IARKKWAAKEDIV
LISAWLNTSKDPVVGNEQKAPAFWKRIASYVAASPDLDGVPKRASAQCKQRWAKMNELVM
KFVGCYATTTNQKASGQTENDVMLFANELFKNDMKKKFSLDHAWRLLRHDQKWLIS---N
APKGKGIAKRRKVRVGTQA--ASS---Q----PIDL-EDDDVMRRPPGVKAAKA-KAKMT
---------PTVKGEEV-------------------------------------------
----NSVEHLTSLWDLKEKDW--------------------DRKDKQSKNQMLESLLSRT
-EPLSECDLV-LKKKLIEELFS--------------------------------------
-----
>gi|15236452|ref|NP_192567.1|	   99 residues, 50 /line  unknown protein [Arabidopsis thaliana]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------MSKRRKCDEAAEC--SNP---Q----PLSH-GIDEAMHRPIGVYLQRR-KKTI-
------SKPTTTEDEEK-------------------------------------------
----A----SQSMWEIKKKDNEM--------------------KEGLSKNKMLDSLLLKT
-EPLFDTNVLSMTNK---------------------------------------------
-----
>gi|42573664|ref|NP_974928.1|	   106 residues, 50 /line  unknown protein [Arabidopsis thaliana]
------------------------------------------------------------
-----------------------------------------M-DTGGFVD----EESDGS
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------------QASAQS--SSS---Q----AVS--HSDEAMSRPSGVKAAKAAKAKRT
------------------------------------------------------------
------LSVIKSMWEIKQKEF--------------------ELNEKLSKKTLLETLLRKT
-APLSDLEMA-LKNKLITDILSNA------------------------------------
-----
>gi|62321525|dbj|BAD95009.1|	   342 residues, 50 /line  glutathione transferase-like [Arabidopsis thaliana]
------------------------------------------------------------
------------------------------------------------------------
--------------------TIGEKSDDPNL-----VQNTTDRR---KHRRKWSRAEDAI
LISAWLNTSKDPIVDNEHKACAFWKRIGAYFNNSASLANLPKREPSHCKQRWSKLNDKVC
KFVGCYDQALNQRSSGQSEDDVFQVAYQVYTNNYKSNFTLEHAWRELRHSKKWCSLYPFE
NSKGGGSSKRTKLNNGDRVYSSSS---NPESVPIALDEEEQVMDLPLGVKSSKQ-KEKKV
AT------IITIEEREADSGSRLENLWVLDEEEQVMDRPLGVKSLEQKENKVAPKPTIEE
REAADSRSRLENLWALKEKEEREADSRSRLENLWALKEKDIEEQKKLTRMEVLKSLLGRT
TDQLSEKEDI-LKNKLIDEML---------------------------------------
-----
>gi|89257448|gb|ABD64940.1|	   380 residues, 50 /line  hypothetical protein 24.t00018 [Brassica oleracea]
MATSLSIGGSLVSLSLFLGVSS--LDGDETPSRCL----------------SSKH-----
-DGDGELSRWISSNGKGINQVFGTKLIAIQRVLEMD-SNPFM-HTGNFVD----LLSQQS
IS-FANYEDISTLSSSQL----------PSL-----HRDDVGER---RERKTWTPTDDIL
LISSWLNTSKDPVVSNEQKAGTFWKRVAAYFNASPKAAGGEERTPNNCKQRWHKINDLVC
KFCGAYEAATREKTSGCNENDVLKRAHEIYHNNLKKKFTLEHAWKELRNDQKWCEV---A
SARNEGSSKKRKCEDAEVSSA----------------FQPSESKRPADVKASKA-RGKAT
-----------VAEEA--------------------------------------------
-----LTNGFQSMWDIKQKDL--------------------EVKERLSKMKILESLIAKT
-EPLAEYEEA-LKKKLISDLMWSQVSRSGALCYGVKSHGVYCRVEQSESG----------
----V
>gi|89257510|gb|ABD65000.1|	   302 residues, 50 /line  hypothetical protein 26.t00020 [Brassica oleracea]
------------------------------------------------------------
----------------------------------MD-SHPYS-KSANFVE----LLNSQQ
ENVFAFSQDSVDLSASQLPGFCFKATEASNL-----VQETAAQR---KERRKWTPVDDVV
LISAWLNTSKDPVIGNEQRCGTFWKRIATYFAASPKVAGTEQGEWSHCKQRRQKINYLVN
KFCGAFEAASREKSSSQNENDVLKLAHEIFYNNHKKKINLEHAWIELYNDQKWCEL---S
SSKTQGSAKRRKCDDGAQSS--SSHMNE----TTTA-EDDQERNRPPGVKAAKG-HDKKK
M-------------AER-------------------------------------------
----KALSEFQDMWSIKKEDM--------------------AMKERLSKMKPLDSLLAKQ
-VPLAEYEEA-LKKKLINELLL-N------------------------------------
-----
>gi|89274229|gb|ABD65633.1|	   260 residues, 50 /line  hypothetical protein 23.t00050 [Brassica oleracea]
MKRKSRVGETR--LSLPKSISPSSDSLSTATHVAIKY----------------------T
DDFIPNLSR---IPHESIPSL---------------------------------------
-S-PTSFSADFNLKASEMPPFSSQQSEATSQ-----PQDTPVER---MVRRKWTSGDDEV
LISAWLNTSKDAVVGNEQK--------------------------------WHRINDQMN
KFCAAFAAAERQITSGQSDNDVLKVAHEIFYSDQGHKFTLEHVCAHV-------------
---------------GEVSS--------------------QSSMRPEGIKAAKA-SRNGS
---------------KG-------------------------------------------
----KAIEDYKSILELKMEDL--------------------ARKEKLSKLAILDTLLAKK
-DPLSESEET-VKNKLLAELF---------------------------------------
-----
>gi|89257611|gb|ABD65099.1|	   258 residues, 50 /line  hypothetical protein 31.t00074 [Brassica oleracea]
------------------------------------------------------------
-------------------------------------MDPFSLHAPGFVN----LLASHS
SS-------PIDVDSAEA------AVNSPGL-------------VKPAERRKWSTKEDLV
LISVWLNTSKDPIVSNEHKLGAFWKRIEAYFNSSPQLSGSLPREWGQCKQRWGRVNAEVC
RFVGSHETALKEQASGQSENDVMKTVHDIYFNDYNLKFTLEHCWRELRFDQKWRSH---S
QPK-----ENRK------E--AGA---E----AVPK-EEEE--VRPPGVKASKA-AKRKK
-------------------------------------------------------PNEA-
-----AYDHIHSI---------------------------LAEKNTISRQKILDRLLAKN
IDTLSDNEVA-LKNKLISEML---------------------------------------
-----

Ad blocker interference detected!


Wikia is a free-to-use site that makes money from advertising. We have a modified experience for viewers using ad blockers

Wikia is not accessible if you’ve made further modifications. Remove the custom ad blocker rule(s) and the page will load as expected.