Fandom

Proteins Wiki

At2g06520.1/PDB

< At2g06520.1

47,922pages on
this wiki
Add New Page
Talk0 Share
&&&&&&&&&&&&&&&&&&&& BEGIN  /usr/local/www/html/proteins/Compiled_Programs/WYRM/PyMOL_highlight_conserved_residues &&&&&&&&&&&&&&&&&&&&

Successfully read 2 file paths from WYRM_file_paths.txt

generic_input                                         /usr/local/www/html/proteins/workspace/
generic_output                                        /usr/local/www/html/proteins/htdocs/results/

======================================================

Sequence file type = 3

Sequence type = 3

Got here 1
Got here 2
Got here 3
Sequence 1
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Sequence 2
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Read 2 amino_acid sequences from PIR Sequence file /usr/local/www/html/proteins/workspace/At2g06520-2hayA0.pir.txt

======================================================

Assigned types to 116 residues in Sequence 2-06520, 90 remain unknown
Assigned types to 217 residues in Sequence 2hayA0, 2 remain unknown

======================================================

Successfully read 576 entries for residue match scoring matrix /usr/local/www/html/proteins/workspace/BLOSUM62.dat

Read the residue match scoring matrix /usr/local/www/html/proteins/workspace/BLOSUM62.dat

======================================================

Translated sequence file At2g06520-2hayA0.pir.txt into sequence alignment.

======================================================

>2HAY.pdb  Made from 7050 ATOM records in 2HAY.pdb
IHHQIQQALHFRTAVRVYKEEKISDEDLALILDAAWLSPSSIGLEGWRFV
VLDNKPIKEEIKPFAWGAQYQLETASHFILLIAEKHARYDSPAIKNSLLR
RGIKEGDGLNSRLKLYESFQKEDDADNPRALFDWTAKQTYIALGNTAALL
GIDTCPIEGFHYDKVNHILAKHNVIDLEKEGIASLSLGYRLRDPKHAQVR
KPKEEVSVVKDQTIHHQIQQALHFRTAVRVYKEEKISDEDLALILDAAWL
SPSSIGLEGWRFVVLDNKPIKEEIKPFAWGAQYQLETASHFILLIAEKHA
RYDSPAIKNSLLRRGIKEGDGLNSRLKLYESFQKEDDADNPRALFDWTAK
QTYIALGNTAALLGIDTCPIEGFHYDKVNHILAKHNVIDLEKEGIASLSL
GYRLRDPKHAQVRKPKEEVSVVKTIHHQIQQALHFRTAVRVYKEEKISDE
DLALILDAAWLSPSSIGLEGWRFVVLDNKPIKEEIKPFAWGAQYQLETAS
HFILLIAEKHARYDSPAIKNSLLRRGIKEGDGLNSRLKLYESFQKEDDAD
NPRALFDWTAKQTYIALGNTAALLGIDTCPIEGFHYDKVNHILAKHNVID
LEKEGIASLSLGYRLRDPAQVRKPKEEVSVVKADQTIHHQIQQALHFRTA
VRVYKEEKISDEDLALILDAAWLSPSSIGLEGWRFVVLDNKPIKEEIKPF
AWGAQYQLETASHFILLIAEKHARYDSPAIKNSLLRRGIKEGDGLNSRLK
LYESFQKEDDADNPRALFDWTAKQTYIALGNTAALLGIDTCPIEGFHYDK
VNHILAKHNVIDLEKEGIASLSLGYRLRDPKHAQVRKPKEEVSVVK

======================================================

Best alignment:
2HAY.pdb    74  TASHFILLIAEKHARYDSPAIKNSLL    99
                TAS  I  IAE      SP++KN LL
2-06520     63  TASMVIPEIAEAAGSGISPSLKNFLL    88

======================================================

Highlighted IDENTICAL residue HIS   81  index1   77  path  148  %Seq 100.00
Highlighted IDENTICAL residue LEU   84  index1   80  path  151  %Seq  50.00
Highlighted IDENTICAL residue LEU   85  index1   81  path  152  %Seq  50.00
Highlighted IDENTICAL residue ALA   87  index1   83  path  154  %Seq 100.00
Highlighted IDENTICAL residue ALA   91  index1   87  path  158  %Seq 100.00
Highlighted IDENTICAL residue TYR   93  index1   89  path  166  %Seq 100.00
Highlighted IDENTICAL residue ASN  100  index1   96  path  173  %Seq 100.00
Highlighted IDENTICAL residue LEU  103  index1   99  path  176  %Seq 100.00
Highlighted 8 residues for visualization

Wrote PyMOL macro into file /usr/local/www/html/proteins/htdocs/results/At2g06520-2hayA0.pir.txt.2HAY.pdb.conservation.pml

===============================================================================

The program

/usr/local/www/html/proteins/Compiled_Programs/WYRM/PyMOL_highlight_conserved_residues At2g06520-2hayA0.pir.txt PIR amino_acid 2HAY.pdb _ 100.0 BLOSUM62.dat 

completed successfully.

@@@@@@@@@@@@@@@@@@@@ END  /usr/local/www/html/proteins/Compiled_Programs/WYRM/PyMOL_highlight_conserved_residues @@@@@@@@@@@@@@@@@@@@


Ad blocker interference detected!


Wikia is a free-to-use site that makes money from advertising. We have a modified experience for viewers using ad blockers

Wikia is not accessible if you’ve made further modifications. Remove the custom ad blocker rule(s) and the page will load as expected.