Fandom

Proteins Wiki

At2g06520.1/MSA

< At2g06520.1

47,922pages on
this wiki
Add New Page
Talk0 Share
>gi|18396349|ref|NP_565335.1|	   116 residues, 50 /line  PSBX (photosystem II subunit X) [Arabidopsis thaliana]
MASTSAMSLVTPLNQT--------RSSPFLK-PLPLKPSKALVATGGRAQRLQ--VKAL-
--KMDKALTGISAAALTASMVIPEIAEAAGSG-ISPSLKNFLLSIASGGLVLTVIIGVVV
GVSNFDPVKRT--
>gi|145342485|ref|XP_001416212.1|	   70 residues, 50 /line  psbX, PSII-X, photosystem II polypeptide [Ostreococcus lucimarinus CCE9901]
-----------------------------------------------------MR---RV
EKVKSKASAAMSAAVIT-SMTSPLLAEA----SVTPSLKNTLLSVVAGGVVLGAIAAAVI
GVSSFDKVSRK--
>gi|22831147|dbj|BAC16008.1|	   117 residues, 50 /line  putative ultraviolet-B-repressible protein [Oryza sativa (japonica cultivar-group)]
MATTASLSAVA-ARPLSVAWLKKPLC-ASFQ-PVP-------RARPAAAARMA--VRA-S
ASMKERATAGLTAAAMAAAMVLPDVAEAA-QGSLTPSLKNFLLSIVSGGVVLVAIVGAVV
AVSNFDPVKRT--
>gi|18476498|gb|AAL50314.1|	   86 residues, 50 /line  ultraviolet-B-repressible protein [Pisum sativum]
------------------------------SIGRAS--S-------KSNGRFQ--VKA--
-SLKEKVVTGLTAAALTAQMVIPDVAEAA-T--VSPSLKNFLLSIVSGGVVVTAILGAVI
GVSNFDPVKRGSQ
>gi|33520421|gb|AAQ21122.1|	   118 residues, 50 /line  ultraviolet-B-repressible protein [Trifolium pratense]
MASTSIISMSVPVTCASSKKIEAPISQAFLKAPLTLKPS-------KSNTRFQFQVKA--
-SLKEKVVTGLTAAALTASMIVPDVAEAA-T--VSPSLKNFLLSIVSGGVVVAAILGAVI
AVSNFDPVKRT--
>gi|45356861|gb|AAS58469.1|	   123 residues, 50 /line  ultraviolet-B-repressible protein [Gossypium hirsutum]
MASTSAVSMALPLTRATQNRV--PASEAFFK-PLPRKPSGAIPT-TTSNGRLQ--VKAAA
SSPKDKAVTGLTAAAITASMVIPEVAQAA-DG-VSPSLKNFLLSIVAGGVVLVAIVGAVI
GVSNFDPVKGT--
>gi|62910995|gb|AAY21210.1|	   116 residues, 50 /line  ultraviolet-B-repressible protein [Gossypium hirsutum]
--------MALPLAGTTQNRM--PSSEAFFK-PLPVKPWRSMGAVKRPNGRLQ--VKAAS
SSFKEKAVTGLTAAALTTSMMIPEVAQAA-DG-VTPSLKNFLLSIAAGGVVLVAIVGAVI
GVSNFDPVKRT--
>gi|86607177|ref|YP_475940.1|	   38 residues, 50 /line  photosystem II reaction center protein PsbX [Synechococcus sp. JA-3-3Ab]
------------------------------------------------------------
---------------------------------MTPSLANFLWSLLYGAVVLGLLFGAIV
FVSQRDRVRRR--
>gi|86607216|ref|YP_475979.1|	   38 residues, 50 /line  photosystem II reaction center protein PsbX [Synechococcus sp. JA-3-3Ab]
------------------------------------------------------------
---------------------------------MTPSLANFLWSLVYGAVVLGLLFGAIV
FVSQRDRVRRR--
>gi|86608294|ref|YP_477056.1|	   38 residues, 50 /line  photosystem II reaction center protein PsbX [Synechococcus sp. JA-2-3B'a(2-13)]
------------------------------------------------------------
---------------------------------MTPSLANFLWSLVAGAVVLGALFGAII
FVSQRDKVRRR--


Ad blocker interference detected!


Wikia is a free-to-use site that makes money from advertising. We have a modified experience for viewers using ad blockers

Wikia is not accessible if you’ve made further modifications. Remove the custom ad blocker rule(s) and the page will load as expected.