FANDOM


&&&&&&&&&&&&&&&&&&&& BEGIN  /usr/local/www/html/proteins/Compiled_Programs/WYRM/PyMOL_highlight_conserved_residues &&&&&&&&&&&&&&&&&&&&

Successfully read 2 file paths from WYRM_file_paths.txt

generic_input                                         /usr/local/www/html/proteins/workspace/
generic_output                                        /usr/local/www/html/proteins/htdocs/results/

======================================================

Sequence file type = 3

Sequence type = 3

Got here 1
Got here 2
Got here 3
Sequence 1
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Sequence 2
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Read 2 amino_acid sequences from PIR Sequence file /usr/local/www/html/proteins/workspace/At2g06050-1q45A.pir.txt

======================================================

Assigned types to 391 residues in Sequence 2-06050-391, 0 remain unknown
Assigned types to 391 residues in Sequence 1q45A, 0 remain unknown

======================================================

Successfully read 576 entries for residue match scoring matrix /usr/local/www/html/proteins/workspace/BLOSUM62.dat

Read the residue match scoring matrix /usr/local/www/html/proteins/workspace/BLOSUM62.dat

======================================================

Translated sequence file At2g06050-1q45A.pir.txt into sequence alignment.

======================================================

>1Q45.pdb  Made from 5634 ATOM records in 1Q45.pdb
SNETLFSSYKMGRFDLSHRVVLAPMTRCRALNGVPNAALAEYYAQRTTPG
GFLISEGTMVSPGSAGFPHVPGIYSDEQVEAWKQVVEAVHAKGGFIFCQL
WHVGRASHAVYQPNGGSPISSTNKPISENRWRVLLPDGSHVKYPKPRALE
ASEIPRVVEDYCLSALNAIRAGFDGIEIHGAHGYLIDQFLKDGINDRTDQ
YGGSIANRCRFLKQVVEGVVSAIGASKVGVRVSPAIDHLDATDSDPLSLG
LAVVGMLNKLQGVNGSKLAYLHVTQPREEEAKLMKSLRMAYNGTFMSSGG
FNKELGMQAVQQGDADLVSYGRLFIANPDLVSRFKIDGELNKYNRKTFYT
QDPVVGYTDYPFLAPNETLFSSYKMGRFDLSHRVVLAPMTRCRALNGVPN
AALAEYYAQRTTPGGFLISEGTMVSPGSAGFPHVPGIYSDEQVEAWKQVV
EAVHAKGGFIFCQLWHVGRASHAVYQPNGGSPISSTNKPISENRWRVLLP
DGSHVKYPKPRALEASEIPRVVEDYCLSALNAIRAGFDGIEIHGAHGYLI
DQFLKDGINDRTDQYGGSIANRCRFLKQVVEGVVSAIGASKVGVRVSPAI
DHLDATDSDPLSLGLAVVGMLNKLQGVNGSKLAYLHVTQPRYHAYDEEEA
KLMKSLRMAYNGTFMSSGGFNKELGMQAVQQGDADLVSYGRLFIANPDLV
SRFKIDGELNKYNRKTFYTQDPVVGYTDYPFL

======================================================

Best alignment:
1Q45.pdb      366  NETLFSSYKMGRFDLSHRVVLAPMTRCRALNGVPNAALAEYYAQRTTPGG   415
                   NETLFSSYKMGRFDLSHRVVLAPMTRCRALNGVPNAALAEYYAQRTTPGG
2-06050-391     9  NETLFSSYKMGRFDLSHRVVLAPMTRCRALNGVPNAALAEYYAQRTTPGG    58

1Q45.pdb      416  FLISEGTMVSPGSAGFPHVPGIYSDEQVEAWKQVVEAVHAKGGFIFCQLW   465
                   FLISEGTMVSPGSAGFPHVPGIYSDEQVEAWKQVVEAVHAKGGFIFCQLW
2-06050-391    59  FLISEGTMVSPGSAGFPHVPGIYSDEQVEAWKQVVEAVHAKGGFIFCQLW   108

1Q45.pdb      466  HVGRASHAVYQPNGGSPISSTNKPISENRWRVLLPDGSHVKYPKPRALEA   515
                   HVGRASHAVYQPNGGSPISSTNKPISENRWRVLLPDGSHVKYPKPRALEA
2-06050-391   109  HVGRASHAVYQPNGGSPISSTNKPISENRWRVLLPDGSHVKYPKPRALEA   158

1Q45.pdb      516  SEIPRVVEDYCLSALNAIRAGFDGIEIHGAHGYLIDQFLKDGINDRTDQY   565
                   SEIPRVVEDYCLSALNAIRAGFDGIEIHGAHGYLIDQFLKDGINDRTDQY
2-06050-391   159  SEIPRVVEDYCLSALNAIRAGFDGIEIHGAHGYLIDQFLKDGINDRTDQY   208

1Q45.pdb      566  GGSIANRCRFLKQVVEGVVSAIGASKVGVRVSPAIDHLDATDSDPLSLGL   615
                   GGSIANRCRFLKQVVEGVVSAIGASKVGVRVSPAIDHLDATDSDPLSLGL
2-06050-391   209  GGSIANRCRFLKQVVEGVVSAIGASKVGVRVSPAIDHLDATDSDPLSLGL   258

1Q45.pdb      616  AVVGMLNKLQGVNGSKLAYLHVTQPRYHAY----------DEEEAKLMKS   655
                   AVVGMLNKLQGVNGSKLAYLHVTQPRYHAY          DEEEAKLMKS
2-06050-391   259  AVVGMLNKLQGVNGSKLAYLHVTQPRYHAYGQTESGRQGSDEEEAKLMKS   308

1Q45.pdb      656  LRMAYNGTFMSSGGFNKELGMQAVQQGDADLVSYGRLFIANPDLVSRFKI   705
                   LRMAYNGTFMSSGGFNKELGMQAVQQGDADLVSYGRLFIANPDLVSRFKI
2-06050-391   309  LRMAYNGTFMSSGGFNKELGMQAVQQGDADLVSYGRLFIANPDLVSRFKI   358

1Q45.pdb      706  DGELNKYNRKTFYTQDPVVGYTDYPFL   732
                   DGELNKYNRKTFYTQDPVVGYTDYPFL
2-06050-391   359  DGELNKYNRKTFYTQDPVVGYTDYPFL   385

======================================================

Highlighted IDENTICAL residue ASN    9  index1  366  path    9  %Seq 100.00
Highlighted IDENTICAL residue GLU   10  index1  367  path   10  %Seq 100.00
Highlighted IDENTICAL residue THR   11  index1  368  path   11  %Seq 100.00
Highlighted IDENTICAL residue LEU   12  index1  369  path   12  %Seq 100.00
Highlighted IDENTICAL residue PHE   13  index1  370  path   13  %Seq 100.00
Highlighted IDENTICAL residue SER   14  index1  371  path   14  %Seq 100.00
Highlighted IDENTICAL residue SER   15  index1  372  path   15  %Seq 100.00
Highlighted IDENTICAL residue TYR   16  index1  373  path   16  %Seq 100.00
Highlighted IDENTICAL residue LYS   17  index1  374  path   17  %Seq 100.00
Highlighted IDENTICAL residue MET   18  index1  375  path   18  %Seq 100.00
Highlighted IDENTICAL residue GLY   19  index1  376  path   19  %Seq 100.00
Highlighted IDENTICAL residue ARG   20  index1  377  path   20  %Seq 100.00
Highlighted IDENTICAL residue PHE   21  index1  378  path   21  %Seq 100.00
Highlighted IDENTICAL residue ASP   22  index1  379  path   22  %Seq 100.00
Highlighted IDENTICAL residue LEU   23  index1  380  path   23  %Seq 100.00
Highlighted IDENTICAL residue SER   24  index1  381  path   24  %Seq 100.00
Highlighted IDENTICAL residue HIS   25  index1  382  path   25  %Seq 100.00
Highlighted IDENTICAL residue ARG   26  index1  383  path   26  %Seq 100.00
Highlighted IDENTICAL residue VAL   27  index1  384  path   27  %Seq 100.00
Highlighted IDENTICAL residue VAL   28  index1  385  path   28  %Seq 100.00
Highlighted IDENTICAL residue LEU   29  index1  386  path   29  %Seq 100.00
Highlighted IDENTICAL residue ALA   30  index1  387  path   30  %Seq 100.00
Highlighted IDENTICAL residue PRO   31  index1  388  path   31  %Seq 100.00
Highlighted IDENTICAL residue MET   32  index1  389  path   32  %Seq 100.00
Highlighted IDENTICAL residue THR   33  index1  390  path   33  %Seq 100.00
Highlighted IDENTICAL residue ARG   34  index1  391  path   34  %Seq 100.00
Highlighted IDENTICAL residue CYS   35  index1  392  path   35  %Seq 100.00
Highlighted IDENTICAL residue ARG   36  index1  393  path   36  %Seq 100.00
Highlighted IDENTICAL residue ALA   37  index1  394  path   37  %Seq 100.00
Highlighted IDENTICAL residue LEU   38  index1  395  path   38  %Seq 100.00
Highlighted IDENTICAL residue ASN   39  index1  396  path   39  %Seq 100.00
Highlighted IDENTICAL residue GLY   40  index1  397  path   40  %Seq 100.00
Highlighted IDENTICAL residue VAL   41  index1  398  path   41  %Seq 100.00
Highlighted IDENTICAL residue PRO   42  index1  399  path   42  %Seq 100.00
Highlighted IDENTICAL residue ASN   43  index1  400  path   43  %Seq 100.00
Highlighted IDENTICAL residue ALA   44  index1  401  path   44  %Seq 100.00
Highlighted IDENTICAL residue ALA   45  index1  402  path   45  %Seq 100.00
Highlighted IDENTICAL residue LEU   46  index1  403  path   46  %Seq 100.00
Highlighted IDENTICAL residue ALA   47  index1  404  path   47  %Seq 100.00
Highlighted IDENTICAL residue GLU   48  index1  405  path   48  %Seq 100.00
Highlighted IDENTICAL residue TYR   49  index1  406  path   49  %Seq 100.00
Highlighted IDENTICAL residue TYR   50  index1  407  path   50  %Seq 100.00
Highlighted IDENTICAL residue ALA   51  index1  408  path   51  %Seq 100.00
Highlighted IDENTICAL residue GLN   52  index1  409  path   52  %Seq 100.00
Highlighted IDENTICAL residue ARG   53  index1  410  path   53  %Seq 100.00
Highlighted IDENTICAL residue THR   54  index1  411  path   54  %Seq 100.00
Highlighted IDENTICAL residue THR   55  index1  412  path   55  %Seq 100.00
Highlighted IDENTICAL residue PRO   56  index1  413  path   56  %Seq 100.00
Highlighted IDENTICAL residue GLY   57  index1  414  path   57  %Seq 100.00
Highlighted IDENTICAL residue GLY   58  index1  415  path   58  %Seq 100.00
Highlighted IDENTICAL residue PHE   59  index1  416  path   59  %Seq 100.00
Highlighted IDENTICAL residue LEU   60  index1  417  path   60  %Seq 100.00
Highlighted IDENTICAL residue ILE   61  index1  418  path   61  %Seq 100.00
Highlighted IDENTICAL residue SER   62  index1  419  path   62  %Seq 100.00
Highlighted IDENTICAL residue GLU   63  index1  420  path   63  %Seq 100.00
Highlighted IDENTICAL residue GLY   64  index1  421  path   64  %Seq 100.00
Highlighted IDENTICAL residue THR   65  index1  422  path   65  %Seq 100.00
Highlighted IDENTICAL residue MET   66  index1  423  path   66  %Seq 100.00
Highlighted IDENTICAL residue VAL   67  index1  424  path   67  %Seq 100.00
Highlighted IDENTICAL residue SER   68  index1  425  path   68  %Seq 100.00
Highlighted IDENTICAL residue PRO   69  index1  426  path   69  %Seq 100.00
Highlighted IDENTICAL residue GLY   70  index1  427  path   70  %Seq 100.00
Highlighted IDENTICAL residue SER   71  index1  428  path   71  %Seq 100.00
Highlighted IDENTICAL residue ALA   72  index1  429  path   72  %Seq 100.00
Highlighted IDENTICAL residue GLY   73  index1  430  path   73  %Seq 100.00
Highlighted IDENTICAL residue PHE   74  index1  431  path   74  %Seq 100.00
Highlighted IDENTICAL residue PRO   75  index1  432  path   75  %Seq 100.00
Highlighted IDENTICAL residue HIS   76  index1  433  path   76  %Seq 100.00
Highlighted IDENTICAL residue VAL   77  index1  434  path   77  %Seq 100.00
Highlighted IDENTICAL residue PRO   78  index1  435  path   78  %Seq 100.00
Highlighted IDENTICAL residue GLY   79  index1  436  path   79  %Seq 100.00
Highlighted IDENTICAL residue ILE   80  index1  437  path   80  %Seq 100.00
Highlighted IDENTICAL residue TYR   81  index1  438  path   81  %Seq 100.00
Highlighted IDENTICAL residue SER   82  index1  439  path   82  %Seq 100.00
Highlighted IDENTICAL residue ASP   83  index1  440  path   83  %Seq 100.00
Highlighted IDENTICAL residue GLU   84  index1  441  path   84  %Seq 100.00
Highlighted IDENTICAL residue GLN   85  index1  442  path   85  %Seq 100.00
Highlighted IDENTICAL residue VAL   86  index1  443  path   86  %Seq 100.00
Highlighted IDENTICAL residue GLU   87  index1  444  path   87  %Seq 100.00
Highlighted IDENTICAL residue ALA   88  index1  445  path   88  %Seq 100.00
Highlighted IDENTICAL residue TRP   89  index1  446  path   89  %Seq 100.00
Highlighted IDENTICAL residue LYS   90  index1  447  path   90  %Seq 100.00
Highlighted IDENTICAL residue GLN   91  index1  448  path   91  %Seq 100.00
Highlighted IDENTICAL residue VAL   92  index1  449  path   92  %Seq 100.00
Highlighted IDENTICAL residue VAL   93  index1  450  path   93  %Seq 100.00
Highlighted IDENTICAL residue GLU   94  index1  451  path   94  %Seq 100.00
Highlighted IDENTICAL residue ALA   95  index1  452  path   95  %Seq 100.00
Highlighted IDENTICAL residue VAL   96  index1  453  path   96  %Seq 100.00
Highlighted IDENTICAL residue HIS   97  index1  454  path   97  %Seq 100.00
Highlighted IDENTICAL residue ALA   98  index1  455  path   98  %Seq 100.00
Highlighted IDENTICAL residue LYS   99  index1  456  path   99  %Seq 100.00
Highlighted IDENTICAL residue GLY  100  index1  457  path  100  %Seq 100.00
Highlighted IDENTICAL residue GLY  101  index1  458  path  101  %Seq 100.00
Highlighted IDENTICAL residue PHE  102  index1  459  path  102  %Seq 100.00
Highlighted IDENTICAL residue ILE  103  index1  460  path  103  %Seq 100.00
Highlighted IDENTICAL residue PHE  104  index1  461  path  104  %Seq 100.00
Highlighted IDENTICAL residue CYS  105  index1  462  path  105  %Seq 100.00
Highlighted IDENTICAL residue GLN  106  index1  463  path  106  %Seq 100.00
Highlighted IDENTICAL residue LEU  107  index1  464  path  107  %Seq 100.00
Highlighted IDENTICAL residue TRP  108  index1  465  path  108  %Seq 100.00
Highlighted IDENTICAL residue HIS  109  index1  466  path  109  %Seq 100.00
Highlighted IDENTICAL residue VAL  110  index1  467  path  110  %Seq 100.00
Highlighted IDENTICAL residue GLY  111  index1  468  path  111  %Seq 100.00
Highlighted IDENTICAL residue ARG  112  index1  469  path  112  %Seq 100.00
Highlighted IDENTICAL residue ALA  113  index1  470  path  113  %Seq 100.00
Highlighted IDENTICAL residue SER  114  index1  471  path  114  %Seq 100.00
Highlighted IDENTICAL residue HIS  115  index1  472  path  115  %Seq 100.00
Highlighted IDENTICAL residue ALA  116  index1  473  path  116  %Seq 100.00
Highlighted IDENTICAL residue VAL  117  index1  474  path  117  %Seq 100.00
Highlighted IDENTICAL residue TYR  118  index1  475  path  118  %Seq 100.00
Highlighted IDENTICAL residue GLN  119  index1  476  path  119  %Seq 100.00
Highlighted IDENTICAL residue PRO  120  index1  477  path  120  %Seq 100.00
Highlighted IDENTICAL residue ASN  121  index1  478  path  121  %Seq 100.00
Highlighted IDENTICAL residue GLY  122  index1  479  path  122  %Seq 100.00
Highlighted IDENTICAL residue GLY  123  index1  480  path  123  %Seq 100.00
Highlighted IDENTICAL residue SER  124  index1  481  path  124  %Seq 100.00
Highlighted IDENTICAL residue PRO  125  index1  482  path  125  %Seq 100.00
Highlighted IDENTICAL residue ILE  126  index1  483  path  126  %Seq 100.00
Highlighted IDENTICAL residue SER  127  index1  484  path  127  %Seq 100.00
Highlighted IDENTICAL residue SER  128  index1  485  path  128  %Seq 100.00
Highlighted IDENTICAL residue THR  129  index1  486  path  129  %Seq 100.00
Highlighted IDENTICAL residue ASN  130  index1  487  path  130  %Seq 100.00
Highlighted IDENTICAL residue LYS  131  index1  488  path  131  %Seq 100.00
Highlighted IDENTICAL residue PRO  132  index1  489  path  132  %Seq 100.00
Highlighted IDENTICAL residue ILE  133  index1  490  path  133  %Seq 100.00
Highlighted IDENTICAL residue SER  134  index1  491  path  134  %Seq 100.00
Highlighted IDENTICAL residue GLU  135  index1  492  path  135  %Seq 100.00
Highlighted IDENTICAL residue ASN  136  index1  493  path  136  %Seq 100.00
Highlighted IDENTICAL residue ARG  137  index1  494  path  137  %Seq 100.00
Highlighted IDENTICAL residue TRP  138  index1  495  path  138  %Seq 100.00
Highlighted IDENTICAL residue ARG  139  index1  496  path  139  %Seq 100.00
Highlighted IDENTICAL residue VAL  140  index1  497  path  140  %Seq 100.00
Highlighted IDENTICAL residue LEU  141  index1  498  path  141  %Seq 100.00
Highlighted IDENTICAL residue LEU  142  index1  499  path  142  %Seq 100.00
Highlighted IDENTICAL residue PRO  143  index1  500  path  143  %Seq 100.00
Highlighted IDENTICAL residue ASP  144  index1  501  path  144  %Seq 100.00
Highlighted IDENTICAL residue GLY  145  index1  502  path  145  %Seq 100.00
Highlighted IDENTICAL residue SER  146  index1  503  path  146  %Seq 100.00
Highlighted IDENTICAL residue HIS  147  index1  504  path  147  %Seq 100.00
Highlighted IDENTICAL residue VAL  148  index1  505  path  148  %Seq 100.00
Highlighted IDENTICAL residue LYS  149  index1  506  path  149  %Seq 100.00
Highlighted IDENTICAL residue TYR  150  index1  507  path  150  %Seq 100.00
Highlighted IDENTICAL residue PRO  151  index1  508  path  151  %Seq 100.00
Highlighted IDENTICAL residue LYS  152  index1  509  path  152  %Seq 100.00
Highlighted IDENTICAL residue PRO  153  index1  510  path  153  %Seq 100.00
Highlighted IDENTICAL residue ARG  154  index1  511  path  154  %Seq 100.00
Highlighted IDENTICAL residue ALA  155  index1  512  path  155  %Seq 100.00
Highlighted IDENTICAL residue LEU  156  index1  513  path  156  %Seq 100.00
Highlighted IDENTICAL residue GLU  157  index1  514  path  157  %Seq 100.00
Highlighted IDENTICAL residue ALA  158  index1  515  path  158  %Seq 100.00
Highlighted IDENTICAL residue SER  159  index1  516  path  159  %Seq 100.00
Highlighted IDENTICAL residue GLU  160  index1  517  path  160  %Seq 100.00
Highlighted IDENTICAL residue ILE  161  index1  518  path  161  %Seq 100.00
Highlighted IDENTICAL residue PRO  162  index1  519  path  162  %Seq 100.00
Highlighted IDENTICAL residue ARG  163  index1  520  path  163  %Seq 100.00
Highlighted IDENTICAL residue VAL  164  index1  521  path  164  %Seq 100.00
Highlighted IDENTICAL residue VAL  165  index1  522  path  165  %Seq 100.00
Highlighted IDENTICAL residue GLU  166  index1  523  path  166  %Seq 100.00
Highlighted IDENTICAL residue ASP  167  index1  524  path  167  %Seq 100.00
Highlighted IDENTICAL residue TYR  168  index1  525  path  168  %Seq 100.00
Highlighted IDENTICAL residue CYS  169  index1  526  path  169  %Seq 100.00
Highlighted IDENTICAL residue LEU  170  index1  527  path  170  %Seq 100.00
Highlighted IDENTICAL residue SER  171  index1  528  path  171  %Seq 100.00
Highlighted IDENTICAL residue ALA  172  index1  529  path  172  %Seq 100.00
Highlighted IDENTICAL residue LEU  173  index1  530  path  173  %Seq 100.00
Highlighted IDENTICAL residue ASN  174  index1  531  path  174  %Seq 100.00
Highlighted IDENTICAL residue ALA  175  index1  532  path  175  %Seq 100.00
Highlighted IDENTICAL residue ILE  176  index1  533  path  176  %Seq 100.00
Highlighted IDENTICAL residue ARG  177  index1  534  path  177  %Seq 100.00
Highlighted IDENTICAL residue ALA  178  index1  535  path  178  %Seq 100.00
Highlighted IDENTICAL residue GLY  179  index1  536  path  179  %Seq 100.00
Highlighted IDENTICAL residue PHE  180  index1  537  path  180  %Seq 100.00
Highlighted IDENTICAL residue ASP  181  index1  538  path  181  %Seq 100.00
Highlighted IDENTICAL residue GLY  182  index1  539  path  182  %Seq 100.00
Highlighted IDENTICAL residue ILE  183  index1  540  path  183  %Seq 100.00
Highlighted IDENTICAL residue GLU  184  index1  541  path  184  %Seq 100.00
Highlighted IDENTICAL residue ILE  185  index1  542  path  185  %Seq 100.00
Highlighted IDENTICAL residue HIS  186  index1  543  path  186  %Seq 100.00
Highlighted IDENTICAL residue GLY  187  index1  544  path  187  %Seq 100.00
Highlighted IDENTICAL residue ALA  188  index1  545  path  188  %Seq 100.00
Highlighted IDENTICAL residue HIS  189  index1  546  path  189  %Seq 100.00
Highlighted IDENTICAL residue GLY  190  index1  547  path  190  %Seq 100.00
Highlighted IDENTICAL residue TYR  191  index1  548  path  191  %Seq 100.00
Highlighted IDENTICAL residue LEU  192  index1  549  path  192  %Seq 100.00
Highlighted IDENTICAL residue ILE  193  index1  550  path  193  %Seq 100.00
Highlighted IDENTICAL residue ASP  194  index1  551  path  194  %Seq 100.00
Highlighted IDENTICAL residue GLN  195  index1  552  path  195  %Seq 100.00
Highlighted IDENTICAL residue PHE  196  index1  553  path  196  %Seq 100.00
Highlighted IDENTICAL residue LEU  197  index1  554  path  197  %Seq 100.00
Highlighted IDENTICAL residue LYS  198  index1  555  path  198  %Seq 100.00
Highlighted IDENTICAL residue ASP  199  index1  556  path  199  %Seq 100.00
Highlighted IDENTICAL residue GLY  200  index1  557  path  200  %Seq 100.00
Highlighted IDENTICAL residue ILE  201  index1  558  path  201  %Seq 100.00
Highlighted IDENTICAL residue ASN  202  index1  559  path  202  %Seq 100.00
Highlighted IDENTICAL residue ASP  203  index1  560  path  203  %Seq 100.00
Highlighted IDENTICAL residue ARG  204  index1  561  path  204  %Seq 100.00
Highlighted IDENTICAL residue THR  205  index1  562  path  205  %Seq 100.00
Highlighted IDENTICAL residue ASP  206  index1  563  path  206  %Seq 100.00
Highlighted IDENTICAL residue GLN  207  index1  564  path  207  %Seq 100.00
Highlighted IDENTICAL residue TYR  208  index1  565  path  208  %Seq 100.00
Highlighted IDENTICAL residue GLY  209  index1  566  path  209  %Seq 100.00
Highlighted IDENTICAL residue GLY  210  index1  567  path  210  %Seq 100.00
Highlighted IDENTICAL residue SER  211  index1  568  path  211  %Seq 100.00
Highlighted IDENTICAL residue ILE  212  index1  569  path  212  %Seq 100.00
Highlighted IDENTICAL residue ALA  213  index1  570  path  213  %Seq 100.00
Highlighted IDENTICAL residue ASN  214  index1  571  path  214  %Seq 100.00
Highlighted IDENTICAL residue ARG  215  index1  572  path  215  %Seq 100.00
Highlighted IDENTICAL residue CYS  216  index1  573  path  216  %Seq 100.00
Highlighted IDENTICAL residue ARG  217  index1  574  path  217  %Seq 100.00
Highlighted IDENTICAL residue PHE  218  index1  575  path  218  %Seq 100.00
Highlighted IDENTICAL residue LEU  219  index1  576  path  219  %Seq 100.00
Highlighted IDENTICAL residue LYS  220  index1  577  path  220  %Seq 100.00
Highlighted IDENTICAL residue GLN  221  index1  578  path  221  %Seq 100.00
Highlighted IDENTICAL residue VAL  222  index1  579  path  222  %Seq 100.00
Highlighted IDENTICAL residue VAL  223  index1  580  path  223  %Seq 100.00
Highlighted IDENTICAL residue GLU  224  index1  581  path  224  %Seq 100.00
Highlighted IDENTICAL residue GLY  225  index1  582  path  225  %Seq 100.00
Highlighted IDENTICAL residue VAL  226  index1  583  path  226  %Seq 100.00
Highlighted IDENTICAL residue VAL  227  index1  584  path  227  %Seq 100.00
Highlighted IDENTICAL residue SER  228  index1  585  path  228  %Seq 100.00
Highlighted IDENTICAL residue ALA  229  index1  586  path  229  %Seq 100.00
Highlighted IDENTICAL residue ILE  230  index1  587  path  230  %Seq 100.00
Highlighted IDENTICAL residue GLY  231  index1  588  path  231  %Seq 100.00
Highlighted IDENTICAL residue ALA  232  index1  589  path  232  %Seq 100.00
Highlighted IDENTICAL residue SER  233  index1  590  path  233  %Seq 100.00
Highlighted IDENTICAL residue LYS  234  index1  591  path  234  %Seq 100.00
Highlighted IDENTICAL residue VAL  235  index1  592  path  235  %Seq 100.00
Highlighted IDENTICAL residue GLY  236  index1  593  path  236  %Seq 100.00
Highlighted IDENTICAL residue VAL  237  index1  594  path  237  %Seq 100.00
Highlighted IDENTICAL residue ARG  238  index1  595  path  238  %Seq 100.00
Highlighted IDENTICAL residue VAL  239  index1  596  path  239  %Seq 100.00
Highlighted IDENTICAL residue SER  240  index1  597  path  240  %Seq 100.00
Highlighted IDENTICAL residue PRO  241  index1  598  path  241  %Seq 100.00
Highlighted IDENTICAL residue ALA  242  index1  599  path  242  %Seq 100.00
Highlighted IDENTICAL residue ILE  243  index1  600  path  243  %Seq 100.00
Highlighted IDENTICAL residue ASP  244  index1  601  path  244  %Seq 100.00
Highlighted IDENTICAL residue HIS  245  index1  602  path  245  %Seq 100.00
Highlighted IDENTICAL residue LEU  246  index1  603  path  246  %Seq 100.00
Highlighted IDENTICAL residue ASP  247  index1  604  path  247  %Seq 100.00
Highlighted IDENTICAL residue ALA  248  index1  605  path  248  %Seq 100.00
Highlighted IDENTICAL residue THR  249  index1  606  path  249  %Seq 100.00
Highlighted IDENTICAL residue ASP  250  index1  607  path  250  %Seq 100.00
Highlighted IDENTICAL residue SER  251  index1  608  path  251  %Seq 100.00
Highlighted IDENTICAL residue ASP  252  index1  609  path  252  %Seq 100.00
Highlighted IDENTICAL residue PRO  253  index1  610  path  253  %Seq 100.00
Highlighted IDENTICAL residue LEU  254  index1  611  path  254  %Seq 100.00
Highlighted IDENTICAL residue SER  255  index1  612  path  255  %Seq 100.00
Highlighted IDENTICAL residue LEU  256  index1  613  path  256  %Seq 100.00
Highlighted IDENTICAL residue GLY  257  index1  614  path  257  %Seq 100.00
Highlighted IDENTICAL residue LEU  258  index1  615  path  258  %Seq 100.00
Highlighted IDENTICAL residue ALA  259  index1  616  path  259  %Seq 100.00
Highlighted IDENTICAL residue VAL  260  index1  617  path  260  %Seq 100.00
Highlighted IDENTICAL residue VAL  261  index1  618  path  261  %Seq 100.00
Highlighted IDENTICAL residue GLY  262  index1  619  path  262  %Seq 100.00
Highlighted IDENTICAL residue MET  263  index1  620  path  263  %Seq 100.00
Highlighted IDENTICAL residue LEU  264  index1  621  path  264  %Seq 100.00
Highlighted IDENTICAL residue ASN  265  index1  622  path  265  %Seq 100.00
Highlighted IDENTICAL residue LYS  266  index1  623  path  266  %Seq 100.00
Highlighted IDENTICAL residue LEU  267  index1  624  path  267  %Seq 100.00
Highlighted IDENTICAL residue GLN  268  index1  625  path  268  %Seq 100.00
Highlighted IDENTICAL residue GLY  269  index1  626  path  269  %Seq 100.00
Highlighted IDENTICAL residue VAL  270  index1  627  path  270  %Seq 100.00
Highlighted IDENTICAL residue ASN  271  index1  628  path  271  %Seq 100.00
Highlighted IDENTICAL residue GLY  272  index1  629  path  272  %Seq 100.00
Highlighted IDENTICAL residue SER  273  index1  630  path  273  %Seq 100.00
Highlighted IDENTICAL residue LYS  274  index1  631  path  274  %Seq 100.00
Highlighted IDENTICAL residue LEU  275  index1  632  path  275  %Seq 100.00
Highlighted IDENTICAL residue ALA  276  index1  633  path  276  %Seq 100.00
Highlighted IDENTICAL residue TYR  277  index1  634  path  277  %Seq 100.00
Highlighted IDENTICAL residue LEU  278  index1  635  path  278  %Seq 100.00
Highlighted IDENTICAL residue HIS  279  index1  636  path  279  %Seq 100.00
Highlighted IDENTICAL residue VAL  280  index1  637  path  280  %Seq 100.00
Highlighted IDENTICAL residue THR  281  index1  638  path  281  %Seq 100.00
Highlighted IDENTICAL residue GLN  282  index1  639  path  282  %Seq 100.00
Highlighted IDENTICAL residue PRO  283  index1  640  path  283  %Seq 100.00
Highlighted IDENTICAL residue ARG  284  index1  641  path  284  %Seq 100.00
Highlighted IDENTICAL residue TYR  285  index1  642  path  285  %Seq 100.00
Highlighted IDENTICAL residue HIS  286  index1  643  path  286  %Seq 100.00
Highlighted IDENTICAL residue ALA  287  index1  644  path  287  %Seq 100.00
Highlighted IDENTICAL residue TYR  288  index1  645  path  288  %Seq 100.00
Highlighted IDENTICAL residue ASP  299  index1  646  path  299  %Seq 100.00
Highlighted IDENTICAL residue GLU  300  index1  647  path  300  %Seq 100.00
Highlighted IDENTICAL residue GLU  301  index1  648  path  301  %Seq 100.00
Highlighted IDENTICAL residue GLU  302  index1  649  path  302  %Seq 100.00
Highlighted IDENTICAL residue ALA  303  index1  650  path  303  %Seq 100.00
Highlighted IDENTICAL residue LYS  304  index1  651  path  304  %Seq 100.00
Highlighted IDENTICAL residue LEU  305  index1  652  path  305  %Seq 100.00
Highlighted IDENTICAL residue MET  306  index1  653  path  306  %Seq 100.00
Highlighted IDENTICAL residue LYS  307  index1  654  path  307  %Seq 100.00
Highlighted IDENTICAL residue SER  308  index1  655  path  308  %Seq 100.00
Highlighted IDENTICAL residue LEU  309  index1  656  path  309  %Seq 100.00
Highlighted IDENTICAL residue ARG  310  index1  657  path  310  %Seq 100.00
Highlighted IDENTICAL residue MET  311  index1  658  path  311  %Seq 100.00
Highlighted IDENTICAL residue ALA  312  index1  659  path  312  %Seq 100.00
Highlighted IDENTICAL residue TYR  313  index1  660  path  313  %Seq 100.00
Highlighted IDENTICAL residue ASN  314  index1  661  path  314  %Seq 100.00
Highlighted IDENTICAL residue GLY  315  index1  662  path  315  %Seq 100.00
Highlighted IDENTICAL residue THR  316  index1  663  path  316  %Seq 100.00
Highlighted IDENTICAL residue PHE  317  index1  664  path  317  %Seq 100.00
Highlighted IDENTICAL residue MET  318  index1  665  path  318  %Seq 100.00
Highlighted IDENTICAL residue SER  319  index1  666  path  319  %Seq 100.00
Highlighted IDENTICAL residue SER  320  index1  667  path  320  %Seq 100.00
Highlighted IDENTICAL residue GLY  321  index1  668  path  321  %Seq 100.00
Highlighted IDENTICAL residue GLY  322  index1  669  path  322  %Seq 100.00
Highlighted IDENTICAL residue PHE  323  index1  670  path  323  %Seq 100.00
Highlighted IDENTICAL residue ASN  324  index1  671  path  324  %Seq 100.00
Highlighted IDENTICAL residue LYS  325  index1  672  path  325  %Seq 100.00
Highlighted IDENTICAL residue GLU  326  index1  673  path  326  %Seq 100.00
Highlighted IDENTICAL residue LEU  327  index1  674  path  327  %Seq 100.00
Highlighted IDENTICAL residue GLY  328  index1  675  path  328  %Seq 100.00
Highlighted IDENTICAL residue MET  329  index1  676  path  329  %Seq 100.00
Highlighted IDENTICAL residue GLN  330  index1  677  path  330  %Seq 100.00
Highlighted IDENTICAL residue ALA  331  index1  678  path  331  %Seq 100.00
Highlighted IDENTICAL residue VAL  332  index1  679  path  332  %Seq 100.00
Highlighted IDENTICAL residue GLN  333  index1  680  path  333  %Seq 100.00
Highlighted IDENTICAL residue GLN  334  index1  681  path  334  %Seq 100.00
Highlighted IDENTICAL residue GLY  335  index1  682  path  335  %Seq 100.00
Highlighted IDENTICAL residue ASP  336  index1  683  path  336  %Seq 100.00
Highlighted IDENTICAL residue ALA  337  index1  684  path  337  %Seq 100.00
Highlighted IDENTICAL residue ASP  338  index1  685  path  338  %Seq 100.00
Highlighted IDENTICAL residue LEU  339  index1  686  path  339  %Seq 100.00
Highlighted IDENTICAL residue VAL  340  index1  687  path  340  %Seq 100.00
Highlighted IDENTICAL residue SER  341  index1  688  path  341  %Seq 100.00
Highlighted IDENTICAL residue TYR  342  index1  689  path  342  %Seq 100.00
Highlighted IDENTICAL residue GLY  343  index1  690  path  343  %Seq 100.00
Highlighted IDENTICAL residue ARG  344  index1  691  path  344  %Seq 100.00
Highlighted IDENTICAL residue LEU  345  index1  692  path  345  %Seq 100.00
Highlighted IDENTICAL residue PHE  346  index1  693  path  346  %Seq 100.00
Highlighted IDENTICAL residue ILE  347  index1  694  path  347  %Seq 100.00
Highlighted IDENTICAL residue ALA  348  index1  695  path  348  %Seq 100.00
Highlighted IDENTICAL residue ASN  349  index1  696  path  349  %Seq 100.00
Highlighted IDENTICAL residue PRO  350  index1  697  path  350  %Seq 100.00
Highlighted IDENTICAL residue ASP  351  index1  698  path  351  %Seq 100.00
Highlighted IDENTICAL residue LEU  352  index1  699  path  352  %Seq 100.00
Highlighted IDENTICAL residue VAL  353  index1  700  path  353  %Seq 100.00
Highlighted IDENTICAL residue SER  354  index1  701  path  354  %Seq 100.00
Highlighted IDENTICAL residue ARG  355  index1  702  path  355  %Seq 100.00
Highlighted IDENTICAL residue PHE  356  index1  703  path  356  %Seq 100.00
Highlighted IDENTICAL residue LYS  357  index1  704  path  357  %Seq 100.00
Highlighted IDENTICAL residue ILE  358  index1  705  path  358  %Seq 100.00
Highlighted IDENTICAL residue ASP  359  index1  706  path  359  %Seq 100.00
Highlighted IDENTICAL residue GLY  360  index1  707  path  360  %Seq 100.00
Highlighted IDENTICAL residue GLU  361  index1  708  path  361  %Seq 100.00
Highlighted IDENTICAL residue LEU  362  index1  709  path  362  %Seq 100.00
Highlighted IDENTICAL residue ASN  363  index1  710  path  363  %Seq 100.00
Highlighted IDENTICAL residue LYS  364  index1  711  path  364  %Seq 100.00
Highlighted IDENTICAL residue TYR  365  index1  712  path  365  %Seq 100.00
Highlighted IDENTICAL residue ASN  366  index1  713  path  366  %Seq 100.00
Highlighted IDENTICAL residue ARG  367  index1  714  path  367  %Seq 100.00
Highlighted IDENTICAL residue LYS  368  index1  715  path  368  %Seq 100.00
Highlighted IDENTICAL residue THR  369  index1  716  path  369  %Seq 100.00
Highlighted IDENTICAL residue PHE  370  index1  717  path  370  %Seq 100.00
Highlighted IDENTICAL residue TYR  371  index1  718  path  371  %Seq 100.00
Highlighted IDENTICAL residue THR  372  index1  719  path  372  %Seq 100.00
Highlighted IDENTICAL residue GLN  373  index1  720  path  373  %Seq 100.00
Highlighted IDENTICAL residue ASP  374  index1  721  path  374  %Seq 100.00
Highlighted IDENTICAL residue PRO  375  index1  722  path  375  %Seq 100.00
Highlighted IDENTICAL residue VAL  376  index1  723  path  376  %Seq 100.00
Highlighted IDENTICAL residue VAL  377  index1  724  path  377  %Seq 100.00
Highlighted IDENTICAL residue GLY  378  index1  725  path  378  %Seq 100.00
Highlighted IDENTICAL residue TYR  379  index1  726  path  379  %Seq 100.00
Highlighted IDENTICAL residue THR  380  index1  727  path  380  %Seq 100.00
Highlighted IDENTICAL residue ASP  381  index1  728  path  381  %Seq 100.00
Highlighted IDENTICAL residue TYR  382  index1  729  path  382  %Seq 100.00
Highlighted IDENTICAL residue PRO  383  index1  730  path  383  %Seq 100.00
Highlighted IDENTICAL residue PHE  384  index1  731  path  384  %Seq 100.00
Highlighted IDENTICAL residue LEU  385  index1  732  path  385  %Seq 100.00
Highlighted 367 residues for visualization

Wrote PyMOL macro into file /usr/local/www/html/proteins/htdocs/results/At2g06050-1q45A.pir.txt.1Q45.pdb.conservation.pml

===============================================================================

The program

/usr/local/www/html/proteins/Compiled_Programs/WYRM/PyMOL_highlight_conserved_residues At2g06050-1q45A.pir.txt PIR amino_acid 1Q45.pdb _ 100.0 BLOSUM62.dat 

completed successfully.

@@@@@@@@@@@@@@@@@@@@ END  /usr/local/www/html/proteins/Compiled_Programs/WYRM/PyMOL_highlight_conserved_residues @@@@@@@@@@@@@@@@@@@@


Ad blocker interference detected!


Wikia is a free-to-use site that makes money from advertising. We have a modified experience for viewers using ad blockers

Wikia is not accessible if you’ve made further modifications. Remove the custom ad blocker rule(s) and the page will load as expected.