Fandom

Proteins Wiki

At2g06050.2/FASTA

< At2g06050.2

47,922pages on
this wiki
Add New Page
Talk0 Share

>gi|62900708|sp|Q9FUP0|OPR3_ARATH 12-oxophytodienoate reductase 3 (12-oxophytodienoate-10,11-reductase 3) (OPDA-reductase 3) (Delayed dehiscence 1) (AtOPR3) MTAAQGNSNETLFSSYKMGRFDLSHRVVLAPMTRCRALNGVPNAALAEYYAQRTTPGGFLISEGTMVSPG SAGFPHVPGIYSDEQVEAWKQVVEAVHAKGGFIFCQLWHVGRASHAVYQPNGGSPISSTNKPISENRWRV LLPDGSHVKYPKPRALEASEIPRVVEDYCLSALNAIRAGFDGIEIHGAHGYLIDQFLKDGINDRTDQYGG SIANRCRFLKQVVEGVVSAIGASKVGVRVSPAIDHLDATDSDPLSLGLAVVGMLNKLQGVNGSKLAYLHV TQPRYHAYGQTESGRQGSDEEEAKLMKSLRMAYNGTFMSSGGFNKELGMQAVQQGDADLVSYGRLFIANP DLVSRFKIDGELNKYNRKTFYTQDPVVGYTDYPFLAPFSRL

Ad blocker interference detected!


Wikia is a free-to-use site that makes money from advertising. We have a modified experience for viewers using ad blockers

Wikia is not accessible if you’ve made further modifications. Remove the custom ad blocker rule(s) and the page will load as expected.