Fandom

Proteins Wiki

At2g06050.1/MSA

< At2g06050.1

47,923pages on
this wiki
Add New Page
Talk0 Share
>gi|15225045|ref|NP_178662.1|	   391 residues, 50 /line  OPR3 (OPDA-REDUCTASE 3); 12-oxophytodienoate reductase [Arabidopsis thaliana]
------------------------------------------------------MTAA-Q
GNSNETLFSSYKMGRFDLSHRVVLAPMTRCRAL---NG---VP-NAALAEYYAQRT-TPG
G-FLISEGTMVSPGSAGFP----HVPGIYSDEQVEAWKQVVEAVHAKGGFIFCQLWHVGR
ASHAVYQPNGGSP-ISSTNKPISENRWRVLL----------PDGSHVKYPKPRALEASEI
PRVVEDYCLSALNAIRAGFDGIEIHGAHGYLIDQFLKDGINDRTDQYGG-SIANRCRFLK
QVVEGVVSAIGASKVGVRVSPAID-------HLDATD--SDPLSLGLAVVGML----NKL
QGVNGSKLAYLHVTQPRYHAYGQTESGRQGSDE--EEAKLMKSLRMAY-NG---------
-TFMSSGGFNKELGMQ-AVQQGDADLVSYGRLFIANPDLVSRFKIDGELNKY-NRKTFY-
TQD-PVVGYTDYPFLAPFSRL--------------------------------------
>gi|67904380|ref|XP_682446.1|	   388 residues, 50 /line  hypothetical protein AN9177.2 [Aspergillus nidulans FGSC A4]
--------------------------------------------------M---G----S
LSPLEPLFTPLRIGAFALQHRVVQAPCTRMRSTK-ESDGIWVP-NDLNVEYYAQRA-SKG
G-LMLSEATPISRDAAGYP----GVPGIFTPSQIEGWRKVTNAVHTKGGLILCQLWHVGR
ATTPGFL-GGKTP-LAPSDIPISGK---AL----D------GN-VYAD-APPRPMTVDEI
KEVVLEYAAASKRAIEAGFDGVEIHGGNGYLLDQFLHDNVNNRTDAYGG-SIENRSRIVL
EIISAVTEAIGAERVGIRLSPYN-------YFQDTRD--SNPQKHWGYLCTQIASLPES-
-----SRPAYVHMIEPRFDEILDES------EKISALETMQEVVKPSL-DGLRSSLKKGG
VSFIAAGNFKPENAGE-KLITDSADAIAFGRLFISNPDLPRRLKEGIELTKY-DRSTFY-
GATPPEKGYTDYPFAQ-------------------------------------------
>gi|70728715|ref|YP_258464.1|	   349 residues, 50 /line  xenobiotic reductase B [Pseudomonas fluorescens Pf-5]
------------------------------------------------------------
---MTTLFDPIKLGDLELSNRIIMAPLTRCRADA--GR---VP-NALMAEYYVQRA-S-A
G-LILSEATSVTPMGVGYP----DTPGIWSNDQVRGWANVTKAVHGAGGKIFLQLWHVGR
ISHPSYL-NGETP-VAPSALQPKGH---VS----L------VR-PLADFPTPRALETAEI
ADIVDAYRVGAENAKAAGFDGVEIHGANGYLLDQFLQSSTNQRTDQYGG-SLENRARLLL
EVTDAAIEIWGAGRVGVHLAPRA-------DSHDMGD--ANLAETFTYVAREL----GK-
-----RGIAFICSREKEG------------------ADSLGPQLKEAF-GG---------
-PYIANERFTKDSANA-WLAAGKADAVAFGVPFIANPDLPARLKADAPLNEA-HPETFY-
GK--GPVGYIDYPTL--------------------------------------------
>gi|71279732|ref|YP_268509.1|	   385 residues, 50 /line  N-ethylmaleimide reductase [Colwellia psychrerythraea 34H]
------------------------------------------------------------
-MKNSILFNAKKLGTFEASNRVVLAPMTRSRTAQ-PDD---VP-TDLMAEYYAQRA-S-A
G-FIITEATQISSQGKGYS----FTPGMFTPEQVTGWKKVTQAVHQADGHIVSQLWHVGR
MSHASFHVDG-LP-VAPSAIAPDAQ---VWVVGED------GIGRMVDCPVPRELSKQDI
KDIVLDYRLAASNAIEAGFDGIEIHGGNGYLIDQFLRRSSNKRNDEYGG-SITNRLRFVM
EVVEAVSDEIGANKVGIRLAPFI-------TQRGMHD--IEAIDAILLASKKF----ND-
-----LGLAYIHLSEADWDDAP----------L--VSDQFRQALRLNF-NG---------
-SIVVAGNYTAKTGAD-LIDSGLVDFIAYGRKFLANPDLPYRFKHDLPLNDITDPSTLF-
GG--DARGYTDYPRYSDQASVA----------------QSND------STKPTAEILP-
>gi|71280065|ref|YP_269808.1|	   374 residues, 50 /line  oxidoreductase, FAD/FMN-binding [Colwellia psychrerythraea 34H]
------------------------------------------------------------
-MTFSPLFTATELGPYTLKNRIVFPPLTRSRSSQ-PGN---IP-NQLMANYYSQRA-G-A
G-FMVTEGTQIEPRGQGYA----WTPGIHSAEQVQGWKQVTQAVHDAGSIIFCQLWHVGR
VSHTSLQPNQAAP-VGPSALKADAV--KVFIETAP------EQGALADPSEPRALSTIEV
EELVQMYKQAAVNAKEAGFDGVELHCANGYLVNQFISEHTNDRTDKYGG-SLENRLRFLK
EITQAVADVMGADKVGVRFAPLFESTDEVRVYLGLVE--SDPHATYIAAIKAL----ND-
-----IGIAYLSLAEADWDNAP----------D--LPEDFYKAVRNTF-DG---------
-LVMYAGKYTPEKALR-ILTEGNGDIFGFGRPFIANPDLPERIKNEWSLNDV-DPTSMY-
GG--TDKGYTDYPVYAL------------------------------------------
>gi|83815286|ref|YP_445806.1|	   383 residues, 50 /line  oxidoreductase, FMN-binding [Salinibacter ruber DSM 13855]
------------------------------------------------------------
--MASPLFDDLDLGPLPLPHRVAMAPLTRNRAAA--GN---VP-TEMNAEYYRQRA-D-A
A-FIVSEATQVAPKGQGYP----RTPGIHSDAQVEGWKAVTDAVHDAGGRIFLQLWHVGR
ISHSLYH-DGEKP-VAPSPIPAEGE---VI----T------PELEMTSFETPRALETEEV
PEVVEQYRRGAENAQRAGFDGVEIHGANGYLIDQFLRSGTNDRADRYGG-SLDNRLRFLR
EVMAAVTDVWTSDRVGVRLSPLA-------PIHGIYD--DTPEATFRGAAATA----ND-
-----HDLAYVHLVEPDAPKPPVAG------DG--DAADVFGAIREAF-DG---------
-ALVANGNYDTDSATD-AIERGYADLVAFGRAFLANPDLPRRLKEGLPINVP-DEDTFY-
NG--DEHGYTDYPTWEELQNGV----------------SFDT------LDALSELKARG
>gi|84702709|ref|ZP_01017284.1|	   383 residues, 50 /line  GTN reductase [Parvularcula bermudensis HTCC2503]
--------------------------------------------MSMSGSV---GAATPK
QQELKPLFEPLKLGQLELPNRILMAPLTRNRAHA--DG---TP-KEMAATYYSQRA-S-A
G-LIISEATQISPMGKGYI----DTPGIYEDRHVEGWKAVTDAVHEKGGRIICQLWHVGR
ISHTSLLPDGAQP-HAPSAIAADAQ---TF----T------PN-GFEPTSEPKAMTTDDI
KRTVDDYAHAAKQALAAGFDGVEVHAANGYLLDQFIRDKSNKREDAYGG-SVENRLRFLR
EVLDGVTAAIGADRTGIRLSPLG-------TFNDISD--SDPETTFSEAVALL----NP-
-----YGLAYCHFLERFGGDV----------PD--TDLETLGRISSGF-DG---------
-PYIANGNFDAEEAAR-WIAKERCDAVTFGKLFIANPDLPKRLALGAALNDW-NQDTFY-
GG--GEERYIDYPFLEEDIEEE----------------TP-----------------KG
>gi|86140423|ref|ZP_01058982.1|	   370 residues, 50 /line  flavoprotein NADH-dependent oxidoreductase [Flavobacterium sp. MED217]
------------------------------------------------------------
MKTDQPLLQSFKLGATTLKNRVVMAPMTRSRADN-PGN---VP-TEMHVEYYTQRA-S-A
G-LIITEGSQVSEQAVGYI----HTPGIHTAEQVAGWKKVVDAVHSEGGKIFIQLWHVGR
MSHPDFH-NGEKP-LAPSAVNPNAK---AY----T------PE-GFKETEEPRAMTLEEI
KQTQEDFVNAAKNAIEAGFDGVEIHSSNGYLFHQFFNKNANVRTDDYGG-SIENRVRFFF
ETLDKVKEVLPENKIGVRLNPSLNG-----VFGIEAT--EETIPTFDHIVERL----NN-
-----YDLAYLHLSEPFTDVSDI--------DY--LETEIAKHYRPKY-HG---------
-NLMINANFDQESGNK-VIEEGNADLVAFGKLFISNPDLVERFAMNAPMADW-DEDTFY-
TQ--GEKGYTDYPTYKAEQQEA-------------------------------------
>gi|94313030|ref|YP_586239.1|	   369 residues, 50 /line  NADH:flavin oxidoreductase/NADH oxidase [Ralstonia metallidurans CH34]
--------------------------------------------------M---GAQT-E
AFLTEALFQPIKLGRIELANRMAMAPLTRSRADD--DL---VP-TEMVVEYYRQRA-S-V
G-LIIAEATQVSETAQGYT----NTPGVYTPEQIAAWKTVTDAVHAQGGKIFLQIWHTGR
MSHSHFQPDNQAP-VAPSAIAANAK---TYI---N------GQ-GYVECSLPRALEASEI
PEIVNDFRVAAANAIKAGFDGVEVHGAHGYLLDAFLRDGTNKRTDAYGG-SIENRARFLL
EVMAAVTAEIGADRVGVRLAPVS-------PVNDAVE--SNPQPLFEYVVREL----EK-
-----LHPVYIHVVEGYTGGPRD------------NVPFDYEALHRLY-SG---------
-VWMVNNGYSKEMAEE-AIRAGRADMVSFGRKMITNPDLPRRFRENQPLNSPFEDASLY-
GGT-GPHGYVDYPALA-------------------------------------------
>gi|94498076|ref|ZP_01304639.1|	   360 residues, 50 /line  NAD(P)H-dependent 2-cyclohexen-1-one reductase [Sphingomonas sp. SKA58]
------------------------------------------------------------
---MTSLFDPIQLGAIAAPNRILMAPLTRARATR--DH---VP-TPLMVDYYRQRA-S-A
G-LIISEATGISRQGLGWP----YAPGLWSQEQVEGWKPVTDAVHEAGGRIVAQLWHMGR
LVHPAVT--GEDA-VSSSPIAAPGH---AH----T------YE-GNKDYPTPRALEVSEI
SHLLDTYAQTARNAIAAGFDGVQIHAANGYLIDEFLRDGVNQRSDDYGG-SADNRVRLLR
EVTGTVVDAIGADRTAVRLSPNG-------ETQGTDD--SDPASLFPVAAQAL----DA-
-----LGIAFLELRELTPTGTYG--------SS--EVPRQSPLIRQHF-KG---------
-PLILNSDYTKASAQA-AIDSGVADGIAFGRPFIANPDLVERLRIDAPLNEW-NPKTFY-
TQ--GAEGYTDYPALEKVA----------------------------------------
>gi|1051208|gb|AAC43569.1|	   377 residues, 50 /line  morphinone reductase
-------------------------------------------------------MPD-T
SFSNPGLFTPLQLGSLSLPNRVIMAPLTRSRT-P--DS---VP-GRLQQIYYGQRA-S-A
G-LIISEATNISPTARGYV----YTPGIWTDAQEAGWKGVVEAVHAKGGRIALQLWHVGR
VSHELVQPDGQQP-VAPSALKAEGA--ECFVEFED-----GTA-GLHPTSTPRALETDEI
PGIVEDYRQAAQRAKRAGFDMVEVHAANACLPNQFLATGTNRRTDQYGG-SIENRARFPL
EVVDAVAEVFGPERVGIRLTPFLE-------LFGLTD--DEPEAMAFYLAGEL----DR-
-----RGLAYLHFNEPDWIGGD--I-------T--YPEGFREQMRQRF-KG---------
-GLIYCGNYDAGRAQA-RLDDNTADAVAFGRPFIANPDLPERFRLGAALNEP-DPSTFY-
GG--AEVGYTDYPFLDNGHDRL------------------------------------G
>gi|107022315|ref|YP_620642.1|	   373 residues, 50 /line  NADH:flavin oxidoreductase/NADH oxidase [Burkholderia cenocepacia AU 1054]
------------------------------------MTIDN---------SP---SGR-A
ASTRATLFDPLEFGGITLGNRIVMAPMTRSRAGA--GD---VP-GALSATYYAQRA-S-A
G-LIVTEGTQISPLGKGYP----FTPGIYSDAQIDGWQRVTDAVHRAGGRIFVQLAHVGR
IGHPDLQPDGALP-VAPSAIQPDGQ---AFT----------PA-GPKPHPVPRALETNEI
PGIVEQYSHAAQAALRAGFDGVEIHAGNGYLLDQFLRDGTNRRTDPYGG-TIDNRIRLPL
DVVRAVGRVVSAARVGVRISPVTP------HFGGIAD--SQPQALFDRFADRL----TG-
-----LA-AYLHVVEGIPQVAA--D-------Q--APPFDYRALRRAF-GG---------
-LYIANGGYTKARAQQ-ALDDGHADLVSFAYPFIANPDFVTRLRHDRPLAHA-DMSTAY-
GG--GEAGYTDYPTLDA------------------------------------------
>gi|109897747|ref|YP_661002.1|	   364 residues, 50 /line  NADH:flavin oxidoreductase/NADH oxidase [Pseudoalteromonas atlantica T6c]
------------------------------------------------------------
------------MGNIQFNNRVFMAPLTRSRSTP-GEN---LQ-TPLHALYYAQRA-S-A
G-LVISEATQISPQGQGYA----WTPGIFTDEQVQHWQVVTDAVHNAGGRIFCQLWHVGA
ISHQVFQPHDARP-FSSSEFQPEGE---AFVGDLL-----PDG-PTVPHPTAQAMTLEDI
DNLKRDYRHAAKCAKEAGFDGIELHAANGYLLDQFIRSSVNKRDDQYGG-SVENRLRLLE
EVIDVIAQEIPRNNIGVRLSPTGG-------PGGSYD--DDPEGTYVAAAKAV----SG-
-----KGAVYLHVVRPNNHTGD--GS----GIE--QGNQLLKDMRAAF-SG---------
-VFIANGEFSPQEADT-WIENNDADAVAFGRSFLANPDLPARIAKDGPYNEP-NDETFY-
GG--GSEGYVDYPSLSHVKSA-------------------------------------M
>gi|113867778|ref|YP_726267.1|	   370 residues, 50 /line  glycerol trinitrate reductase [Ralstonia eutropha H16]
------------------------------------------------------------
--MTSHLFAPITIGALQLNHRVAMAPLTRSRAGQ-PGN---VP-SAMNVEYYRQRA-S-A
A-LIITEASQVSQQGQGYA----WTPGIHSAEQIEGWRAVAEAVHAEGGRIFLQLWHVGR
VSHPSFQPGGALP-VAPSALPVPGK---TFIVDAD-----GNG-VWSEIPTPQALSAAAI
AAIVQDYRRAARNAIDAGVDGVEIHAGNGYLLDQFINSESNHRTDAYGG-SIENRARFLL
VVVDAAAEEIGAERVGVRLTPMGR-------FMGMGD--DTPEATFGYIAQRL----ND-
-----WPLAYLHLVEPAMVGTVKDEA----ADP--RWDGMILAMRAAY-RG---------
-VLMLAGGYDGKSAEQ-AIADGRADIIAFGRPFIANPDLPRRLRVQASLNAP-DAATFF-
GG--TAVGYTDYPALA-------------------------------------------
>gi|113936066|ref|ZP_01421962.1|	   371 residues, 50 /line  NADH:flavin oxidoreductase/NADH oxidase [Caulobacter sp. K31]
------------------------------------------------------------
--MARKLFEAVSVGPTQLDHRVVMAPLTRMRSDP--GD---VP-NDLMLRYYDQRA-SKG
G-LIIAEAATVSTRGRAYL----GAPGIYNDEQVAAWRKITAAVHAKGGKIFLQLWHGGR
QSHSDNEPNKEPP-IAPSALLVEGY---AHT----------PD-GWKAIDMPRALEIEEI
PAVIEEFQSGAARAMAAGFDGVEIHAANGYLPDQFLQDSSNVRTDAYGG-PIQARARFLL
EVTKAVIDVWGADRVGVRISPDSK-------FNAMAD--SDPTATFSYLVKAL----DA-
-----LDLGFLHVIEPRMAGDTPLD------ET--AEPVAAATLRKLF-KR---------
-TIIAAGGFNPDSAEA-ILASGAADLVAFGRSFIANPDLPKRFRDGLALNPY-DRDSFY-
GG--DARGYVDYPFHDAKAPEP----------------V-------------------A
>gi|113936071|ref|ZP_01421967.1|	   374 residues, 50 /line  NADH:flavin oxidoreductase/NADH oxidase [Caulobacter sp. K31]
-----------------------------------------------------------M
TDYASPLLDPIKLGAIDLPNRIIMAPLTRMRADA--NG---VP-GALMAEQYAQRA-S-A
G-LIIAEATSIAPNAYGVP----NQPGIHTAEQIAGWRRVTDAVHAKGGRIVLQIVHGGR
ASHSSLS-GGERP-IAPSEIAAPGG---TYSPQ---------Y-QPVEYEVPRALSVAEI
PAVVALFAQAARNAHDAGFDGVEIHGANGYLIDEFLQDVSNTRTDDYGG-SFDNRARFLL
EVVDAVIAAVGADRVGLRLSPWST-------YNGMSD--SDPKALFSAVIAAL----ND-
-----RRLAYLHMPEGRASEVGMADN----ILQ--DMASNAETFSKLF-DG---------
-PFITAGGYTPQTGAR-AIAAGHAAAVGFGRIFVANPDLVARIETDAPLNAH-DRATFY-
GG--AAEGYTDYPVLTSELSAA------------------------------------Q
>gi|114704859|ref|ZP_01437767.1|	   370 residues, 50 /line  NADH:flavin oxidoreductase/NADH oxidase [Fulvimarina pelagi HTCC2506]
------------------------------------------------------------
-MATQKLFEPYNLGPNTLSNRIVMAPLTRSRADD--TD---TP-KDMHVVHYRQRA-S-A
G-LIISEATQISNEGKGYA----WTPGIYSDEQVAAWKRVTDAVHAEGGKIFMQLWHVGR
ISHPDLQHGGRLP-VSASAIQPDQQ---AFT----------ET-GFKPIPTPRALETDEL
PRVIADYVKAAENAKAAGFDGVEVHSANGYLLDQFLQDSTNKRTDAYGG-SIENRMRFPL
EVIDAVVKVWGADRVGVRVSPGSG-------ANDMAD--SDPEALFLAYAKEL----GQ-
-----RKLAYLHVIEGLIWQDR----------D--KEDVTSDKLRDAF-GG---------
-TYMGNNQYTREIAIE-RAEIGQVDLACFGRPFIANPDLVERLKLDAPLNEP-DKDTFY-
GG--DEKGYIDYPFLSEEEKTR----------------FADA----------------A
>gi|114777269|ref|ZP_01452280.1|	   358 residues, 50 /line  morphinone reductase [Mariprofundus ferrooxydans PV-1]
------------------------------------------------------------
---MTDLFSPIKLGKLALSNRITMAPMTRNRAP---EG---IP-TPLMVEYYSQRA-T-A
G-LIITEGAQISEQGVGYP----ATPGIYSDAQVDGWQKVTEAVHAKGGHIFVQLWHCGR
ISHPDFH-GGNLP-VAPSAIRAEGQ---AFT----------YE-GLKDFVTPRALDIEEI
PAIVEQYRHAAACARKAGFDGVEIHAANGYLLDQFLRDGSNTRSDAYGG-SIENRARLLL
EVTEAVCNEIGSDRVGIRISPVNA-------FNDMHD--SDPQALFNHVADAL----SG-
-----LKPVYLHLVEVSMTGAAD-------------HAVNMQQIRERF-DG---------
-LYIANGGYDKARGND-VIATRAADLVAYGIPFLANPDLPARLRLNATLNEA-DQATFY-
GG--DLHGYTDYPALDDSQE---------------------------------------
>gi|116687229|ref|YP_840475.1|	   367 residues, 50 /line  NADH:flavin oxidoreductase/NADH oxidase [Burkholderia cenocepacia HI2424]
------------------------------------------------------------
---MSKLFTSYDMAGAILSNRVVMAPMTRTRTV---DN---VP-NDLTAVYYAQRA-S-A
G-LIITEGLPISDEGRGYL----YTPGLYTDEQTNGWRKVTDAVHAKGGKIFAQLWHVGR
MSHTSLQPGNAAP-VSSGEVPATNT--TVYAWIEP-----GKA-GPVAPSVPRALSTEEV
RRVTKDFVASALRAIDAGFDGIELMAANAFLFDQFLSSKLNTRTDEYGG-SIVNRQRFLL
ETIDAIAAAIGGGRVGVRVSPFGR-------LYDLQP-YADEEETWMSVAASL----ND-
-----RELAYVHLNYQPTITGV----------E--VPTNFIARFREAY-RG---------
-TLIAAGGFNRELAEA-ELKTGHHDLIAFGTPYIANPDLVERMQNGWPLAES-DRSTFY-
GVV-GSKGYTDYPAYQNHV----------------------------------------
>gi|117168612|gb|ABK32277.1|	   372 residues, 50 /line  Amb9 [Polyangium cellulosum]
-----------------------------------------------------------M
TTAADLLFSPFKLGPLSLPNRLVMAPMTRCRAGE--GN---VP-TELNAVYYEQRA-S-A
G-LIITEATQVSQQGVGYL----RTPGIHTDAQVEGWRRVTDAVHRAGGHIFAQLWHVGR
ASHVSFQPGRQAP-VSSSALPIRTG--HAHT----------PE-GAQPYSTPRALETREI
PGVVAQFEDGARRARAAGFDGIELHAANGYIIDQFLRDGVNQRTDQYGG-SVENRARFLL
EIVDAVTGVFDPDRVGARVSPLGG-------YNDMSD--SNPKAIFGHVAAEL----SA-
-----RKLAYLHVVEPVDGQAE----------D--AAGRVMPLLRERF-RG---------
-VLMANGGYTLETAEA-ALRTGAADLVSFGAPFLANPDLPERLSRRAPLNPP-DVSTFY-
SE--GPRGYTDYPRLAEAQAAA----------------QPS-----------------A
>gi|118036989|ref|ZP_01508396.1|	   428 residues, 50 /line  NADH:flavin oxidoreductase/NADH oxidase [Burkholderia phytofirmans PsJN]
MQSSRRKAFGALRTAGSQVFGAVARFSRRPAPIDCHSTQDSARSARRQSFTG---SHR-E
TNIMSKLFTSVKVGPYEFAHRVVLAPLTRMRAED--GA---RP-GRLMAEYYAQRT-S-A
GALLIGEATIAAVEGNGYL----GAPGLYDDSQIAGWREVTDAVHAKGGKIFLQLYHAGR
QSNAELQPEGRRP-VGPSEVLHGGV---AYT----------KA-GWIPNTPNRALEIDEI
AAIVESFRTAAERGVKAGFDGVELHAANGYLFDQFLQDGSNKRTDIYGG-SFENRARLLM
EATRAVISVWGSNKVAVRLGPSGS-------WGDMSD--SDPVGLFSYVADEL----AK-
-----LDLAYLHLIEPRIAGNVEDES----R-N--PDPVAAQTIRKHY-AG---------
-TIIAAGGFKGDSAEA-ILVDGDADLVAFGRDFIANPDLPERLRRNLPLNAY-DRPTFF-
GG--TEVGYTDYPLYDEEAVSA-------------------------------------
>gi|118040101|ref|ZP_01511498.1|	   362 residues, 50 /line  NADH:flavin oxidoreductase/NADH oxidase [Burkholderia phytofirmans PsJN]
------------------------------------------------------------
---MSSLYDPLTMGKLQLKNRVFMAPLTRNRARP--DG---VP-GSMAAVYYSQRA-S-A
G-LIVTEATQISPMGKGYV----NTPGIHTDEQVAEWKKIVAAVHQAGGRIFLQLWHVGR
ISHSSLLPGNVAP-LAPSAIRAKSQ---TVT----------AS-GFVDVSTPRAMTATDI
LQTIGDFRKAAANAHLAGFDGVEIHAANGYLIDQFLQSKSNARTDDYGG-TTAKRVRFLR
EVVEAVLDVWEPTRVGVRISPGGT-------FNDMDD--EDPEQTFSQVVDML----NG-
-----FRLGYLHVVEAAPEETPAR--------E--QLTTLFKYLRGAW-KG---------
-IYIVNGGYDAARGEL-AVSSGDADAVAYGRLFLANPDLPKRLSHRGPLNAP-DPKTFY-
GG--TAAGYIDYPDWSAHV----------------------------------------
>gi|118053376|ref|ZP_01521921.1|	   409 residues, 50 /line  NADH:flavin oxidoreductase/NADH oxidase [Comamonas testosteroni KF-1]
------------------------------------------------------------
-----MLFTPYRLGDLELPNRIVMPPMTRSRAAS--GN---VP-TALMAEYYAQRA-C-A
G-LIVTEGTQISPQGQGYA----WTPGIHSAEQVLGWRGVTDAVHAAGGRIFAQLWHVGR
VSHVSMQPDGAAP-VSSSPLVAEGV--KVFIDPEGQGPQAGVG-GMVQHSAPRALSEAEI
TQVVQDFATAARHALDAGFDGVELHGANGYLINQFIDSQANTRTDGYGG-PLSNRLRFLR
EVTQAVVAVVGRERVGVRLAPLTT-------LQGAVD--DTPQATYLGVAKVL----DD-
-----IGVAYIHIAEADWEDAP----------D--MPAAFKEALRLVY-GG---------
-TLIYAGKYTAERAEA-ALRNGWADLIGFGRPFVANPDLPQRLRQGLPLNEP-DASRFF-
GG--GAAGYTDYTLATAEECARPGLNLSTKKDTQTRTPRAGAASRAMERLGSVDCNLRS
>gi|118590200|ref|ZP_01547603.1|	   368 residues, 50 /line  Putative NADH-flavin oxidoreductase [Stappia aggregata IAM 12614]
------------------------------------------------------------
-MSQAKLFSPAKAGAIELKNRVVMAPLTRNRARH-EDD---AP-HDLTVKYYDQRA-G-A
G-LIITEASQISPQGKGYA----WTPGIYSDAQIEGWKKVTDAVHAKGGKIVIQLWHVGR
ISHPVLQPGGADP-VAPSAIAAKSK---TFD----------GE-QFVDTPTPRALDASEI
PGIVEDYRKAAENAKKAGFDGVEVHAANGYLIDQFLRDGSNKRDDAYGG-SIENRSRFLK
EVMDAVVDVWGGDRVGVRLSPFSH-------ANDASD--SNPQATFSHAIKLL----NG-
-----YGLAYLHLVEGQTGGPRDI-----------PEGGDLSALYALF-DG---------
-AHMGNNGYDRSMAIE-AVETGKVDLVAFGRPFIANPDLVDRLEKDAPLNKL-DADTLY-
GG--AEKGYTDYPALAETSVAA------------------------------------E
>gi|118747277|ref|ZP_01595150.1|	   358 residues, 50 /line  NADH:flavin oxidoreductase/NADH oxidase [Marinomonas sp. MWYL1]
-----------------------------------------------------------M
TSTETNLFSPVKLGSLELPNRFIMAPLTRTRA-P--GH---LP-NALMAEYYAQRA-S-T
G-LLITECTMVTEGSSTFG----DDPGIYSQEQIEGWKLTTQAVHEKGGRIFMQIWHGGR
AAHPLLN-GGKES-VSASAIAIDGE---THT----------PE-GKKPYAVPRALTVEEI
KDIVNDFRQAAINAKEAGFDGVEIHGANGYLIDQFLRESSNQRTDEYGG-SLENRARFLT
EILEAVTDVLGSGRVGLRLSPLNT-------FQSMRE--NDPVTWTRFLSEHL----NQ-
-----FNLAYLHLMRADFFAEQ--------------QADVVSVAREYY-KG---------
-HLMVNMGYTPEEANQ-VIESNQADSVAFGKGILANPDFVERVRVGAELNEP-NPDTFY-
TS--GKEGYTDYPFMTA------------------------------------------
>gi|30250429|ref|NP_842499.1|	   354 residues, 50 /line  NADH:flavin oxidoreductase/NADH oxidase [Nitrosomonas europaea ATCC 19718]
------------------------------------------------------------
-----MLFNPLQVGSLTLPNRILLAPLTRARADA--GH---MP-NALMAEYYSQRA-T-G
G-LLISECTMVAPGTSAFV----NEPGIYNDAQIAAWRQVTDAVHAKGGRIFMQIWHAGR
AAYPGAA-DGAPI-VSSSATAIEGE---IHT----------PQ-GKVPHAVPRPLTVDEI
PGIVAAFAQGARNAIAAGFDGVEVHGANGYLIDQFLRDTPNQRTDAYGG-SLENRARLLF
EVLTAVTQAIGSERVGLRLSPLNS-------FNSMKD--SDPLALIGFLADRL----NA-
-----FKLAYLHVMRADFFGVQ--------------KADVMPVAREKY-KG---------
-VLVGNMGYSADEAEA-AIAEGRLDAVAFGTAFLANPDLPARIRAKAPLNAP-DSNTFY-
AG--GAKGYTDYPTLQLA-----------------------------------------
>gi|119486193|ref|ZP_01620253.1|	   372 residues, 50 /line  flavin oxidoreductase/NADH oxidase [Lyngbya sp. PCC 8106]
------------------------------------------------------------
MNTTLNLLKPFKLGAYELPNRMVMAPLTRMRAKP--GN---IP-QEMNQVYYTQRA-S-A
G-LIISEATQISPQGLGYP----NTPGIHSPEQIQGWKKVTQAVHENNGRIFLQLWHVGR
ISHPSLQPNGELP-VAPSAIAPEGM---ANT----------FS-GEQPFVTPRALETEEI
PAIVEQYRQGAKNALEAGFDGVEIHSANGYLLDQFLHDGSNKRTDQYGG-SIENRARFLM
EVLEAVTSVWDADKVGVRLSPSST-------FGTVFD--SDTEALFNYVVSKL----NP-
-----FNLAYLHIVEPRIQGNVTVE------DD--GNGLGASYFRSIY-QG---------
-TIITAGGYTRETGEA-VLEQDDADLVAYGRLFIANPDLPKRFALNAPLNEY-DRSTFY-
GG--DQRGYTDYPFLDDSKVLT----------------TV-------------------
>gi|121529926|ref|ZP_01662536.1|	   368 residues, 50 /line  putative flavoprotein NADH-dependent oxidoreductase [Ralstonia pickettii 12J]
------------------------------------------------------------
--MTQQLLSPVQTGRTTLANRVVMAPLTRSRAGQ-PGD---VP-TELNVTYYAQRA-T-A
G-LIVTEATQISRQGQGYA----WTPGMYTDAQEAGWKTVVDAVHAKGGRISQQLWHVGR
ISNTLLQENGQAP-VAPSAIVAKGA--QSFVVQPD-----GTP-ANVPTSEPRALATEEI
PGVIAQYRQAVLRARRAGFDFVEIHAANGYLLHQFLSTNSNQRTDQYGG-SLENRARLIL
EVVDTAIDEIGADRVGIRLSPHFV-------AHDIAD--AQAEESALYLAREL----TK-
-----RGIAYLHIAEPDWAGGP----------E--LTNDFRRQLRDAF-KG---------
-TLIVCGQYTAEEGEQ-MIASGLADAVAFGRPFIANPDLVARFRAGASLNKP-DRETFY-
GG--QEKGYTDYPTLEEAA----------------------------------------
>gi|123443246|ref|YP_001007220.1|	   371 residues, 50 /line  NADH:flavin oxidoreductase / NADH oxidase family protein [Yersinia enterocolitica subsp. enterocolitica 8081]
------------------------------------------------------------
---MEKLFTPLKVGNITLNNRVVMAPMTRSRARK--GD---IA-DELTAEYYAQRA-S-A
G-LIVTEGAQISVQGQGYL----FTPGIYSQEQVKGWSLTTQAVHEKGGKIFLQLWHVGR
ISHTSLQNNGVAP-VSSVAVKAESS--HCYALDQN-----GNP-GQVPVLIPQALTIDGI
KAIINDYVMAAENAIEAGFDGVEIHAANGYLLEQFINGGLNTRNDEYGGESHSNRIRFTL
EVTDAVSKAIGSDKTGIRLAPFGR-------LFDMHA-FEGEEQTWLQLADEL----NT-
-----RSLAYVHLSDQQTLGQQ----------A--IPDGFIQKFRAVY-QG---------
-ILIIAGGFDKQRAEK-YLQDGCADLIGFGRPYISNPDLVERMKNDWPLTEP-DRATFY-
GG--TEVGYTDYPFYSAQLDN-------------------------------------Q
>gi|124514979|gb|EAY56490.1|	   367 residues, 50 /line  NADH flavin oxidoreductase [Leptospirillum sp. Group II UBA]
-----------------------------------------------------------M
AQNSIDLFSPYTLGSLSLPNRAVMAPMTRNRADA--GN---VP-NALMATYYKQRS-S-A
G-LIITEATQVCPMGQGYI----RTPGIHSPEQIEGWKQVTRAVHQAGGRIFLQLWHVGR
ISHPDFL-EGRLP-VAPSAIAPRGV--TAYT----------MD-GPKAIPTPRALETGEI
PGIVEDFRKGAENAKKAGFDGVEIHAANGYLLDQFLEDSTNKRTDMYGG-SIENRARLIF
EVVDAVTSVWGKDRVGIRLSPGGT-------FNDMGD--SRPQETFGYVVRRL----SG-
-----TGIGYLHLIEPAEPEGE---------HP--SPDLSASFFRPIY-KG---------
-TLMLAGGYSREKAND-VLKKGLGDLISFGRPFLANPDLLARFSKNAPLNNP-DPATFY-
GG--TEKGYIDYPTLEEISSR--------------------------------------
>gi|126172876|ref|YP_001049025.1|	   369 residues, 50 /line  NADH:flavin oxidoreductase/NADH oxidase [Shewanella baltica OS155]
--------------------------------------------------MF---MI--D
NSTRTDLFSATQLGKIAIANRIIMAPVTRSRYAE--NG---IP-NELHATYYAQRA-S-A
G-MLIAEATNISPQGRGYA----ATPGIWSDEQVEGWKKVTDAVHANGGKIVVQLWHVGR
FSCVELQPDGAAP-VAPSAIKAEGS---TYT----------VD-GFVPVSMPRALETDEI
PRIIEQYKIAARNAMRAGFDGVEVHSANSYLLDQFLRDSTNHRTDEYGG-SIENRARLTL
EVTQAVVNIWGSDRVGIRLSPVTPD-----AGNTPPD--SNVMALYGYLIQQL----NQ-
-----FNLAYLHFVEGATATSREV-----------PEGVDMDTLSVQF-NG---------
-PFIGNNNYDLEMAIE-RRAQGKIDAVAFGRLFISNPDLVERLRRGAELTIA-ERESYY-
GG--GAKGYTDWPKGNY------------------------------------------
>gi|126654881|ref|ZP_01726415.1|	   368 residues, 50 /line  xenobiotic reductase B [Cyanothece sp. CCY0110]
------------------------------------------------------------
MNNSHTLFAPCQVGNITLKNRVIMAPLTRSRAGE--ER---MP-NDLMKEYYMQRK-S-A
G-LIISEATVISRQGCGWV----HSPGIYSDEQMEAWKPITQALHEKETPIFLQLWHCGR
ASHSSFQENNQLP-VSASAIKLNED--YIHT----------PI-GKQPYETPRALETEEI
PRIVEDYRLATERAKNAGFDGVEIHSANGYLIDQFLQSKTNHRSDKYGG-SIENRYRFLK
EIVEAVLTVFPANKIAVRLSPNGD-------FNDMGS--PEYRELFTYVAQQL----NN-
-----YDLAYLHIIDGLQFGFHEL-----------GEPMTLADFRQVF-DG---------
-VLMGNCGYSKDSAEA-KIREGNADLIAFGRPFISNPDLVERFANNWPLNPPADMQYWY-
SF--DAEGYIDFPTYEESKKS--------------------------------------
>gi|145589555|ref|YP_001156152.1|	   366 residues, 50 /line  NADH:flavin oxidoreductase/NADH oxidase [Polynucleobacter sp. QLW-P1DMWA-1]
------------------------------------------------------------
MSGKEIMFTPVNLGSLQLKNRLVMAPLTRMRAVA--GD---VP-NPLAKTYYGQRA-S-A
G-LIITEATQISPLGMGYP----ATPGIYSPEQTAAWKEIVEAVHAKGGTIVAQLWHVGR
ISHSSLHPEDGVP-EAPSAIAAAGQ---TYG----------ADWKLHDYEVPKAMSLDDI
VRLLKEFELAARNAKAAGFDGIEIHSANGYLLDQFLQDKTNQRNDQYGG-SIENRLRLLG
EVIEAVSKVFTSDRVGVRLSPYGT-------FNDMSD--SDPVALFTAAINKL----NA-
-----YGLAYVHMIEPRATSAGGGEQ----VNE--GAPITSELFRKAY-QG---------
-KFITAGGYDQAMGEK-VLEEGMADAVAYGRLYISNPDLLERFEKNAPLNPY-NRATFY-
GG--AEVGYTDYPSL--------------------------------------------
>gi|146342968|ref|YP_001208016.1|	   374 residues, 50 /line  putative NADH-dependent Flavin Oxidoreductase [Bradyrhizobium sp. ORS278]
------------------------------------------------------------
--MLPALFSPLTIGPYHLKHRVVMAPLTRMRAAR-ETL---AP-RKLNVEYYAQRA-TPG
G-LIIAEASPVLPTGTGSP----NVPGIYSEGQVAGWRQVVDAVHAKGGLIFLQLWHVGR
VSHSSFQPGGAPP-VAPSAIAIPDDL-KAMT----------ADGKGAAYETPRALETDEI
PALVAAYGQAARNAMAAGFDGVEVHGANGYLIEQFLQTRSNQRTDRYGG-SIENRCRFLI
EVTEAVIAACGADKVGVRLSPYGI-------ANGSGE--ADPMPLYTHAIEAL----NK-
-----LGIAYLHLIEPRSSGAGRADV----NWQ--NVPSAIALFRLVW-KG---------
-VLIGAGGFTGEPAEA-AIQAGHADAIAFGRYFISNPDLPARLQHGWPLTPY-NRPTFY-
GG--EEKGYTDYPVYDATVTA--------------------------------------
>gi|147918750|ref|YP_687527.1|	   371 residues, 50 /line  predicted FMN oxidoreductase [uncultured methanogenic archaeon RC-I]
------------------------------------MPIN---------------VLI-I
MAADPDLFSPYRMGDLTLPNRIVMAPMTRCLAEE--GD---VP-GHLTVTYYVQRA-S-A
G-LIISEGSQVSPQGVGYM----RTPGIYSEAQVAGWKKVTDAVHRAGGRMFIQLWHVGR
VSHPDFL-GGALP-VAPSALPVEGY---VHT----------PG-GKKPIPVPRALRTEEI
PDIVEQFRHAAENAKVAGFDGVEIHGANSYLLDQFLRSGSNHRTDQYGG-SLENRARLPL
EVAKAVIKVWGGDRVGYRISPHMN-------WNSISD--ANPRETFSYFTREL----DK-
-----LGLGYLHLIEPLGGRMGFV--------P--PQERIGPELRRIF-KR---------
-TFMLNGGYDSESGNA-AIARGDADLIAFGVPYLANPDLPERFRQNAPLNEP-DVETFY-
AG--GAKGYTDYPALPKK-----------------------------------------
>gi|148871712|gb|EDL70553.1|	   366 residues, 50 /line  GTN Reductase [Vibrio harveyi HY01]
------------------------------------------------------------
--MKDTLFQPVQLGSLTLQNRIVMPPMTRSRASQ-PGN---VA-NDMMAEYYAQRA-S-A
G-LIVAEGTQISPMGQGYA----WTPGIYSQEQIAGWKKVTDAVHAKGGAIFAQLWHVGR
VTHPD-NIGGEQP-ISSSALKAENV--KVFIDNGT-----DEP-GFVDVVEPREMTKEDI
KLVIEEYRQAALNAIEAGFDGIELHAANGYLVNQFIDSEANNRTDEYGG-SVENRLRFLG
EVVAAMSQAIGADRVGVRLAPFTS-------LNGTVD--KTPVETYTAAAALL----DK-
-----LNVVYMHIAEVDWDDAP----------D--TPAEFKTAVREAY-KG---------
-TIIYAGRYNTEKAVE-ALESGLADMVGFGRPFIANPDLPNRIKNDYPLAAH-DPATLF-
GG--NEKGLLDYPTYQAN-----------------------------------------
>gi|149279719|ref|ZP_01885847.1|	   331 residues, 50 /line  NADH-flavin oxidoreductase/NADH oxidase [Pedobacter sp. BAL39]
------------------------------------------------------------
----------------------------------------------MNAEYYAQRA-S-A
G-LIISEATNVSPEALGFA----FTPGIYNDEQEGGWRQVTDAVHAAGGKIFCQLWHVGR
ISHSSMQPNGMLP-VAPSAVKPDAR---CFT----------EN-GFKSCATPRALELEEI
PGLIEQFFHATKRARQAGFDGVEILAGGGYLIDQFLKDKTNRRTDDYGG-SIPNRSRFLI
EVVEAAIKAWSPDHIGVRISPVGT-------VNDIDD--SNPEELFSHVAEQL----SA-
-----YELAYLHVMENTVPGSPRE--------D--TYDLLMEKLRKLY-KG---------
-VYIGNSGYDLKLAIN-RQQDNLADLIAFGRPFIANPDLVQRFKIGAALNEP-DNSTFYD
GG--GSVGYTDYPFLPNDSVWS----------------T-------------------G
>gi|149375530|ref|ZP_01893300.1|	   373 residues, 50 /line  NADH-dependent flavin oxidoreductase, Oye family protein [Marinobacter algicola DG893]
-----------------------------------------------------------M
NNVNDALFQPHDLGTLTLPNRVLMSPLTRSRSRQ-PGD---VP-NDMNAQYYQQRA-G-A
G-LIISEATQVSPQGKGYA----FTPGIHSEEQIEGWRKVTSAVHMAGGRIHMQLWHVGR
ISHTALQPDGNQP-VAPSAIKPEGA--KTFIS--------ADS-GMVDVPEPRALEASEM
ADIVEQYRQGALNAKAAGFDGVEVHAANGYLLDQFLKSGSNHRSDEFGG-SVENRMRLPL
MVIEAVIGVWGKDNVGVRVSPTGS-------FNAMYD--EDPVETFGEFAKRL----ND-
-----LGISYIEVVEDSFQGNHAN--------G--RPESVIDAIRAGF-NG---------
-TYIANGAYTAEEARQ-RIGNGRCDLVTFGRPFIANPDLPERFRQHAELNKW-DDSTFY-
GG--DERGYTDYPTLKELEIS-------------------------------------A
>gi|149386046|gb|ABN65735.2|	   361 residues, 50 /line  12-oxophytodienoate reductase 1 (12-oxophytodienoate-10,11-reductase 1) (OPDA-reductase 1) (AtOPR1) (FS-AT-I) (OYE) [Pichia stipitis CBS 6054]
------------------------------------------------------------
-MSTDKLFTPLKIGDLQLAHRVIMAPLTRYRAE---NY---LP-GSLMETYYSQRA-TPG
G-LLITEGTTISSTAGLHP----DSPRIDTAESIESWRKVTNAVHDKGGYIFVQLNHCGR
SALSKFN-DNQQP-ISSSAIKQL-------------------DG--LEFELPREMTEADM
KNVISDFCKASSNAMEAGFDGIELHSANGYLLDQFLEDNINSRTDMYGG-TIENRCRFVL
QVIDAICSQLGSSKVGVRISPWDN-------FQGAND--SDPLFHFGYLCEQL----EK-
-----RSLAYVHIIEARSESNGGLEK----DDI--KKVSFIPPLKKHLPTT---------
-PVFSAGGWNCNNFAG-ILSETGIDGLAFGRYFISNPDLVHRLQYSASLSKY-DRATFY-
KHL-SPVGYIDYPLAVA-----------------------------------------R
>gi|149910201|ref|ZP_01898847.1|	   369 residues, 50 /line  NADH oxidase family [Moritella sp. PE36]
-----------------------------------------------------------M
KTPMSKLFQKANLQSLDLQNRVVMAPMTRARTSQ-PGN---IP-NEMMATYYKQRA-T-A
G-LIISEATQISDDSQGYS----FTPGVYTDEQVKGWQPITKAAHDQGAVMFCQLWHVGR
VSHPTFQ-NGKLP-IAPSALAPVET--KVWISDDQ-----GNG-TMVDCIQPRAMNQADI
DRVIHDFSYAAKRAIEAGFDGVEIHGGNGYLIDQFLRTNSNKRTDNYGG-TRENRLRFLL
EVVDAVIKEIGADKVGVRLAPFIT-------FKDMDC--PDIVATILDASQAL----QA-
-----RDIAYMHLSEADWDDAP----------V--IPESFRIQLRQIF-SN---------
-TIIVAGSYTQERADE-VLNKGYADLVAFGRPFVSNPDLVSRLKNNNELADL-DGATLF-
GG--NKLGYTDYPTLDAL-----------------------------------------
>gi|149928386|ref|ZP_01916625.1|	   376 residues, 50 /line  NADH-flavin oxidoreductase/NADH oxidase [Limnobacter sp. MED105]
----------------------------------------------MNAPTPHVNEQI-A
NVDDLKLFQPGKIGSIEVKNRVVMAPLTRCRSDEAAGD---IPGSDMNIEYYKQRA-N-A
G-LIISEGTQVSPAGKGYM----ATPGIYSEAQVQGWKPITAAVHAAGSKIIAQIWHVGR
ITHPDLT-GGLSP-IAPSAVKPNVV---AYT----------HN-GKVEVPVPHELSADEI
KVVVNEYRQGAANAIKAGFDGVEIHGANGYLIDQFLRDGANKRTDQYGG-SAENRARFAL
EVVDAVIAEIGAGKVGIRLSPVTP-------FNDLSD--SNPQAVFGYLIEQL----NQ-
-----RGIGFIHMIEGSTGGDR----------D--VPGFDYAWARKTF-QG---------
-TYIVNNGYTRDMAIN-ALETGWADAVSFGRAYISNPDLVQRLKLNAPLAEG-NPQTYY-
AP--GPEGYIDYPSLNA------------------------------------------
>gi|50554125|ref|XP_504471.1|	   373 residues, 50 /line  hypothetical protein [Yarrowia lipolytica]
------------------------------------------------------------
--MAPALFSPINVGDTHLLNRVVMAPLTRFRADE--GG---VP-SDLQKDYYVQRSQTPG
T-LLVAEATYVSPGAGGMKTFGGHVPGLWNEAQIAGWKKVIDAVHAKGCKFYIQLWDLGR
TANQQVLEKEGLPFTGPSAIPQKGD---------------------KFGDKIRALTVPEI
KQKIKDYATAAENAIKAGADGVEIHSANGYLPDQFIHWNSNHRTDEYGG-SIENRCRFSL
EIVDAISASIGSDKLAIRLSPWTD-------VQDVEVDQVNTLPTFEYIFRQL----QKR
-ADNGQKLAYVHLIEPRVNGTKTKR------ED--IAWQTNEPFRKIW-KG---------
-PLVRAGGFTRETALE-AAASDPLTLVAFGRFFISTPDLVERLEKDEKLNPY-NRKTFY-
SS--GPVGYIDYPTYEKAKL---------------------------------------
>gi|5701740|dbj|BAA83083.1|	   385 residues, 50 /line  LEDI-5a protein [Lithospermum erythrorhizon]
---------------------------------------------------------M-S
IPSSKLLFTPYQLGKHLLSHRIVMSPMTRNRSF---DA---MP-QKHAILYYSQRT-SPG
G-FIVTEATGVSDTAQGYP----HTPGIWTKEQTEAWKPIVDAVHAKGGVFFCQLWHVGR
VSNKGFQPNGQDP-ISSTTKGFTPAV---RASY----------VQEDWFSPPRALETDEI
PKIIEDFVVSARNAIDAGFDGIELHGAHGYLLEQFLKDNVNDRTDKYGG-SLENRCRFVL
ELVEAVVKEVGADKVGIKLAPFSD-------FMEAGD--SDPAALGTYLVEAL----NK-
-----YGLLYLHVLEPRMKTTG----------E--TNNQSIDPMRKAF-KG---------
-TFMVGGGYDKDLGEK-ALEEGRADLVVYGRPFVANPDLPKRFEVDAPLNEP-DRNTFF-
SHD-PVVGYTDYPFLEEATCLV----------------PVFD------THCIFSIFLFN
>gi|62907042|gb|AAY21012.1|	   361 residues, 50 /line  12-oxo-phytodienoic acid-like protein [uncultured organism]
------------------------------------------------------------
-------FEPINIGKNKLQHRVVLAPLTRFRATL--EA---VP-TELMVEYYKQRA-SPG
G-LLITEATFIDRLAGGYP----RAPGIYTKEQIEGWKKVTEAVHQKGGIIYLQLWHIGR
ANLSKLNPNNEQV-VSASAIAIPGK---NIM----------GE----DHEVPRPLEVHEI
KEIVQQYKRAALYAVEAGFDGVEIHNANGYLLDQFVNSGSNQRTDEYGG-SVENRARFSL
EVVDAVVDAIGPERTAIRFSPGGS-------FQGVSD--EDPVKTWSYLTSSL----QEK
----HSQLAYVHFIEPHSNFFTDD--------A--EIVDSLDPFRKLW-KG---------
-PFITAGGFSTAIKHAVDVAEKNGDLIAFGRSFIANPDLPERIKKEVELNKY-NRDTFY-
TN--DAVGYTDYPFYKKETKA--------------------------------------
>gi|67159101|ref|ZP_00419835.1|	   356 residues, 50 /line  NADH:flavin oxidoreductase/NADH oxidase [Azotobacter vinelandii AvOP]
------------------------------------------------------------
----MSIFQSGQIGNLALANRIVMAPLGRARSDV-QSR---VP-LPRVATYYSQRA-G-A
G-LIVSEATHVSPNSVSRP----GGSAIHTAEQVEGWKAVTAAVHAAGGRIFQQLFHLGR
KAHQGRLPGNALP-VAPSAIAAQGE---VET----------PQ-GPQPFPVPRALERAEI
PALVEEFRQAARNSLLAGFDGVEIHAANGYLIDQFLRDGSNRRQDDYGG-SVANRARLLL
EIVDAVIGVFGPGRVGVRISPHFE-------VDGIGD--SDPAALYTHVAEQL----QA-
-----RGIAYLHLIEPDSV-------------E--PARRLAPRLRQLF-RG---------
-AFILAGEFDRARAIR-ALAEGRADFVAFGRLFIANPDLVERLRREAPLNPP-DEATFY-
SG--EEHGYIDYPFLAVG-----------------------------------------


Ad blocker interference detected!


Wikia is a free-to-use site that makes money from advertising. We have a modified experience for viewers using ad blockers

Wikia is not accessible if you’ve made further modifications. Remove the custom ad blocker rule(s) and the page will load as expected.