FANDOM


>gi|4388727|gb|AAD19765.1|	   461 residues, 50 /line  hypothetical protein [Arabidopsis thaliana]
------------------------------------------------------------
------------------------------------------------------------
-M----------------------------------------------------------
--------------------------------TILRSREIPS-------VSPKPLP---K
----ESDTEPSTPARTLEP---------ELHRSPDETAPELGLVDEPTHTTR--------
----------------------RRSLRLAHQ-FDGDDCVTEKEVSVDEKFLSLRSGKRVA
KRGVD--------YGIEIESSKFDFDLKLGESASKT------------------------
------------------------------------------KRVCVDLVEET-------
----------------I-VKNESEDSVDL----------------------------EDK
SSSGVLGDSLAEKW------------------------------------YVVEVENE-S
NNKGKGIMEDSYGESDVICGQSYEKQSSSMGRRRYTRE---------EKGKGIMQVEDVS
SPVTVEIVEVDEEEMEIESLVNSEKPPDVSVTELAATMANVEQAQNRENSNEIGNDSRT-
QHFRDIAERIAHRFAHFDAQVEEEEDLSDKEGEQQVE--------DWPGPFSTAMKIIKD
REEYTTPHVGIGVSNK-ERSSPTIWVPRSNFSFPP-RKAPSLQELS--------------
-----LRVLVKNADAI--------------------TSLDYVPDTLRVKLCQLLCDSRRM
DLHFLDLLVQGSPTEICVPDCSWLTEEEFTECF---------------------------
KNCD--TS----------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------NLMVTY----------FFL------------------
------
>gi|115389074|ref|XP_001212042.1|	   583 residues, 50 /line  conserved hypothetical protein [Aspergillus terreus NIH2624]
------------------------------------------------------------
--------------------------------------------MLPP---------DSL
F-----------------------------------------------------------
---------------------------------LTLKT----------------------
---------------------------------------------NWHRQSLGPDGFPSV
REA------ERQQSVDTPSDAQ--------------------------------------
------------------------------------------AQD---------------
--------AEESETNA---SESPEQKKKRKRKEAATLAKIKQSKEFARRKA---------
----------------RRIGEPDDDDD---------------------------------
----------------------LIAREM-MDEKSRPLPGQLENCELCGKRFTVTAYSK-T
GPNGG-----------LLCAKCSKELAN--------------------------------
--------------------------------------------------------DEK-
KAKA--------------------------------------------------------
------------KKRGP-RTGRRQNQSNLLDGITQ-QGALSLAEMC--------------
-----TKKVADNINDI--------------------EEFGDLPSQLLHGLSQILSKRRVL
TPRTLNLFLRPDLESIDIYDSAKLETDDFQKIF---------------------------
AFMP--GLKHVNLRFAGQMKDRV-----FEYMIDRDLKVRHLQLDAANLISDKCWRKLFQ
KL-----------------------GPQLESLKLSNMDSSFDDETVKVLCESC-PGLRRL
KLKECWKMSTSSLQAIST----LRSLEHLSLGFV---------QDADPNDLLELVSHLGP
NLRTLSLEGFPNAD----DSLL-SAIHEKCHS------LTKLRFTGNAVCTDKGFAGLFT
DW---HNPPLEIVDLSSTRDVDNANPDGPTD-ATGLASQGFIALM-GHSG----------
------------AKIEKLNMSSCRHVSRTAFEEVFAEGK---------------------
------------------TYPQLKELDVSFHTVMDDYLVGCIFRCCPELKKVIAFACFNV
REA----RI---------------------------------------------------
-----------------------------PKGVALIG-----------------------
------------------------------------------------------------
-------------------GLKAQDAIVVEGA----------------------------
------
>gi|119482552|ref|XP_001261304.1|	   640 residues, 50 /line  DNA repair protein Rad7, protein [Neosartorya fischeri NRRL 181]
MLVANIGTAGMDLRSEKGGSVG-------------------------------------T
LGRFGKFFHSSTGTRP-----------------------VIHRPVTTPSYTTLGESNHSA
LT----------------------------------------------------------
--------------------------------DFLASN----------------------
---------------------------------------------NISAAQIHQDYQRRV
RQA------EREATANEPADEL--------------------------------------
------------------------------------------EEE---------------
---------DEYEDND---GETAEQRKKRKRKEAATLAKIKQSKEFARRKA---------
----------------RRTGEPDDDDD---------------------------------
----------------------VIAREM-MYQKSRPMPGQLENCELCNKRFTVTPYSK-T
GPNGG-----------LLCAKCSKEVAD--------------------------------
--------------------------------------------------------DER-
KSKA--------------------------------------------------------
------------KKRGP-RSGRRQNQSNLLDGIVQ-QGALSLVEMC--------------
-----AKKVADNHNDI--------------------EEFGDLPSRLLRRLSQIFSKRRIL
TSRTLHLFLRPELNFIDIYDAAKLETDDFHKIF---------------------------
AIMP--ALNNVNLRFAGQIKDRV-----VEYMIDRDLQVRQLQLDAANLVSDTYWRRLFQ
KL-----------------------GSQLESLKLSNLDFSFDDETVETLCRNC-TALKRL
KLKQCWKIGSNSLRAIST----LPTLEHLSLDTV---------QELEIEPFLQMVNTLGP
NLRTLSLEGFRNAD----DRLL-DLIHDKCRL------LSKLRFSDNALCSDRGFVNLFT
DW---ANPPLRFVDLSSTRDVDNANPNGPVE-AIGLASQGFIALM-NHSG----------
------------STLQKLNISSCRHISRAALEEVFSEEK---------------------
------------------TYPFLQELDVSFHTVMDDFLIGRIFQSCPAIKKVVAFACFNV
RDV----QV---------------------------------------------------
-----------------------------PVGVALVG-----------------------
------------------------------------------------------------
-------------------GLKAQHSIVIEGPA-----S--G------------------
------
>gi|70987423|ref|XP_749125.1|	   642 residues, 50 /line  DNA repair protein Rad7, protein [Aspergillus fumigatus Af293]
MLVANIGTAGMGLRSEKGGLCW-------------------------------------N
FWKIWKIL----------------------------------------SQLDRNTASDSQ
TR----------------------------------------------------------
--------------------------------RYPLSN----------------------
---------------------------------------------NISAAQIHQDYQRRV
RQA------EREVAANEPADEL--------------------------------------
------------------------------------------EEE---------------
---------DEYEDND---GETAEQRKKRKRKEAATLAKIKQSKEFARRKA---------
----------------RRTGKPDDDDD---------------------------------
----------------------VIAREM-MYQKSRPMPGQLENCELCNKRFTVTPYSK-T
GPNGG-----------LLCAKCSKDVAD--------------------------------
--------------------------------------------------------DER-
KSKA--------------------------------------------------------
------------KKRGP-RSGRRQNQSNLLDGIVQ-QGALSLVEMCAKVNIFEQSFDMSC
SRTDRIQKVADNHNDI--------------------EEFGDLPSRLLRRLSQIFSKRRIL
TSRTLNLFLRPELNFIDIYDAAKLETDDFHKIF---------------------------
ASMP--ALNSVNLRFAGQIKDRV-----FEYVIDRDLQIRQLQLDAANLVSDTYWRRLFQ
KL-----------------------GSQLESLKLSNLDFSFDDETVETLCRNC-TALKRL
KLKQCWKIGSDSLRTIST----LPTLEHLSLDTI---------QDLEIEPLLQMVNTLGP
NLHTLSLEGFHNAD----DRLL-DLIHDKCRL------LSKLRFSDNALCSDRGFVNLFT
NW---ANPPLRFVDLSSTRDVDNANPDGPVE-AIGLASHGFIALM-NHSG----------
------------STLQKLNISSCRHISRAAFEEVFQEEK---------------------
------------------TYPFLQELDVSFHTVMDDFLIRKIFQSCPAIKKVVAFACFNV
RDV----QV---------------------------------------------------
-----------------------------PVGVALVG-----------------------
------------------------------------------------------------
-------------------GLTAQHSIVIEGPA-----S--G------------------
------
>gi|121711215|ref|XP_001273223.1|	   577 residues, 50 /line  DNA repair protein Rad7, protein [Aspergillus clavatus NRRL 1]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------------------MHNSN----------------------
---------------------------------------------NISAAQIHQDYQRRV
REA------DQDVAASETQNEV--------------------------------------
------------------------------------------TED---------------
---------EEYEEDP---SESAEQRKKRKRKEAAALARIKQSKEFARRKS---------
----------------RRTGEPDGDGD---------------------------------
----------------------LIAREM-MHEKSRPLPGQLENCELCSKRFTVTPYSK-T
GPNGG-----------LLCAKCSKEIGN--------------------------------
--------------------------------------------------------DEK-
KSKA--------------------------------------------------------
------------KKRGP-RTGRRQNQSNLLDGVAS-QGALSLVEMC--------------
-----TKKVADNHNEI--------------------EEFGDLPSRLLHRLSQIFSKRRIL
TPRTLNLFLRPELNSIDIYDAAKLETDDFHKIF---------------------------
AIMP--ALMRVNLRFAGQIKDRV-----IEYMLDRDLKVRQLQLDAANLVSDSSWQQLFQ
KL-----------------------GSQLESVKLSNLDYSFTDETVERMCESC-VALQQL
KLKQCWKLGNDSLSAIST----LSALEHLSLDLV---------QETSGEVLLQMISTLAP
KLRTLSLEGISNAD----DRLL-DLIHEKCLV------LAKLRLTDNSVLSDKGFVNLFT
DW---ANAPLKFVDFSSTRDVDNSNPDGPAD-AIGFASQGFIALM-NHSG----------
------------STLRKLNISSCRHISHAAFEEVFTEGK---------------------
------------------SYPFLQELDISFLTVVDDFLMGRVFRCCPSIKKVVAFACFNV
RQV----HV---------------------------------------------------
-----------------------------PIGVALIG-----------------------
------------------------------------------------------------
-------------------GLKAQDSIVIEGTT-----S--G------------------
------
>gi|145247835|ref|XP_001396166.1|	   594 residues, 50 /line  hypothetical protein An13g00250 [Aspergillus niger]
------------------------------------------------------------
-------MANRRQTRN-----------------------Q----IRGP---------HSA
LT----------------------------------------------------------
--------------------------------DFLASN----------------------
---------------------------------------------NISAAQIQQDHLTRL
RQF------ERQTAVERRETDH--------------------------------------
------------------------------------------VND---------------
---------DEYK-NA---DESAADKKKRKRKEAVALAKIKKSKEFARRKA---------
----------------QGTGDSDNDDD---------------------------------
----------------------IV-REM-MCEDSQPFAYQLENCEVCGKRFTVTPYSK-A
GPRGG-----------LLCARCSKELAD--------------------------------
--------------------------------------------------------DGK-
KPKA--------------------------------------------------------
------------NRRGP-RSGRRQKQSNLLDGLAQ-LGAPSLAEMC--------------
-----TKKVADNINDI--------------------EEFGDLPPQLLHRLSQILCKRRVL
TSRTLNLFLRSELNFIDIYDAAKLETQDFEKIF---------------------------
AFMP--NLYHVNFRFAGQLKDKV-----VEYLLDRNLKIKRLQLDAANLISDECWQQLFR
KL-----------------------GPQLESLKLSNLDSSLDDETVEVMCREC-TSLQRL
KLKQCWKMGNRSLQAISQ----LISLQHLSLDFV---------QEICDEILLNTVSKLSP
RLRTLSLEGLSTAD----DRLL-DIIHVNCRT------LTKLRFSDNAVCSDKGFVTLFT
DW---DNPPLEFVDLSSTRDVDNSNPDGPVD-AIGLASQGFMALM-NHSG----------
------------PGLQKLNIASCRHVSRSAFEEVFAAGK---------------------
------------------TYPNLEEIDVSFHTVVDDYIVGRIFQCCPKLQKLVAFACFNL
RDA----QV---------------------------------------------------
-----------------------------PAGVALIG-----------------------
------------------------------------------------------------
-------------------GLKAQDPIVLQGHH--------Y------------------
------
>gi|67528128|ref|XP_661875.1|	   586 residues, 50 /line  hypothetical protein AN4271.2 [Aspergillus nidulans FGSC A4]
------------------------------------------------------------
---------MRRQTRN-----------------------Q----ISGP---------RSA
LT----------------------------------------------------------
--------------------------------DFLASN----------------------
---------------------------------------------NISAAQIHDDYQRRL
REA------ESQ--ANEGQEER--------------------------------------
------------------------------------------LTD---------------
---------EEYEDNI---GETPEERKKRKRKEAATLAKIKQSKEFARRKA---------
----------------RRIGEPDDEDE---------------------------------
----------------------LIAREM-LKERARPMPGQLENCEICSKRFTVTPYSK-T
GPQGG-----------LLCPKCSKEVGD--------------------------------
--------------------------------------------------------KEK-
KLQP--------------------------------------------------------
------------KKKGP-RTTRRQNQSDLLDGITQ-HGALSLVEMC--------------
-----TKKVADNIQDI--------------------TEFGDLPWQPLRRLSQILSKRRAL
TPRTLDLFLRPDLGFIDICDSGKLETDDFRKIF---------------------------
TFMP--ALTSVNLRFAGQLKDDV-----IDYMLDRNLSIRHLQLDSANLVSDLRWRQVFQ
KL-----------------------GDKLETLRLSNLDSSLDDESIEVMCKHC-TGLRRL
KLTQCWRMCDRSLRAIST----LPSLEHLSLDLI---------QETKTDSLVELVSRLGS
NLRSLSLRGFSSAD----DTLL-EMIHNKCRH------LRKLRFSDNSVCTDKGFNELFL
NW---LNAPLEIVDLSSTRDVDNTNPNGPPD-AIGLASNGFAALM-RHSG----------
------------SAIRILNIASCRHISYAAFEEAFAEGK---------------------
------------------NYPNLKELDVSFHGVMDDYLVGRILQCCPAIQKVVAFACFSV
REP----QV---------------------------------------------------
-----------------------------PKGVSLIG-----------------------
------------------------------------------------------------
-------------------GLRTQDSLA--------------------------------
------
>gi|83770095|dbj|BAE60230.1|	   611 residues, 50 /line  unnamed protein product [Aspergillus oryzae]
----MSNSAGV---------TA-------------------------------------T
LLSGVLQRANRRQTRN-----------------------Q----IRGP---------HSA
LT----------------------------------------------------------
--------------------------------DFLASN----------------------
---------------------------------------------NISAAQIREDYRRRL
EEA------EHQGASEEPS-EP--------------------------------------
------------------------------------------AEN---------------
---------DEAEQSL---DESSEQRKNRKRKEAANLAKIKQSKEFARRKA---------
----------------RRIGEPDDDDN---------------------------------
----------------------RIAREI-IYQRSRPMPGQLENCETCSKRFTVTPYSK-T
GPNGG-----------LLCTKCSRSLED--------------------------------
--------------------------------------------------------DGK-
KPKA--------------------------------------------------------
------------KKRGP-RTGRRQNQSNLLDGIAQ-QGALSLAEMC--------------
-----TKKVADNINDI--------------------EEFGDLPSPLLHRLSQILSKRRAL
TSRTLNLFLRPDLDSINIYDSAKLETNDFQKIF---------------------------
AFMP--TLTNVNLRFAGQLKNTV-----IEYLLGRDLRLKYLQLDAANLVSDSHWRRLFE
KL-----------------------GPQLEALKLSNLDFSLDDETVEVLCRNC-TELRRL
KLKQCWKVGHISLQALSS----LTSLEHLSLDLV---------QETSNDSLIKVVSTVGP
RLHTLSLEGFPNAD----NCLL-ETIHDKCRS------LSKLRLSGNVVCTDEGFAKLFT
GW---PNPPLEYVDFSSTRDVENSNLDGSRD-AIGLASEGLIALM-DHSG----------
------------SAIQKLNISSCRHVSRAAFEEIFSDGK---------------------
------------------VYPNMKELDVSFHTVMDDYLISRILQCCPVIKKLVAFACFNV
RDV----RI---------------------------------------------------
-----------------------------PVGVAMIG-----------------------
------------------------------------------------------------
-------------------GLKAQDTIVTEGRS---------------------------
------
>gi|116197987|ref|XP_001224805.1|	   639 residues, 50 /line  hypothetical protein CHGG_07149 [Chaetomium globosum CBS 148.51]
------------------------------------------------------------
----MAAGSRQAR--------------------------------------------QQR
QI----------------------------------------------------------
--------------------------------AFDQSH----------------------
---------------------------------------------NISAYQIRLDADARR
RAA---------------------------------------------------------
-----------------------------------RDEQGEPANGDNQSNDQTSVASP--
AATPAVTASPAPTTRSRRAAAAPSREEEARKKEQKAIEKIKASKKFQKRKR---------
------------------GVES-EDEDE--------------------------------
-----------------------LARALL--QSTAPLPGQQENCESCGKRFTVTAYSR-N
GPNGG-----------LLCSPCSKELDK--------------------------------
--------------------------------------------------------DNA-
AQKKKP------------------------------------------------------
----------KRATGGA-VGRRRQLQSNILDGTYS-LGAKSLMTLC--------------
-----IETLAKNIDLA--------------------EDLGDLPSPIIDKIARKLSKHRLL
DSRTLSLFLQPTTEEVCIYDGAKLSSDDFIRIF---------------------------
QTVP--GLKKLKVRNGIHFKGQV-----LDFLMTRNIELEDLYLHGANLLSKDKWKEYLE
KK-----------------------GHALRALRVYFTDLHFGDEILALLPTTC-PSLTRL
KVSHNQEVTGTGVAAIGQ----ISTLRHLSLDLR---------NEIHSDIYVDLLSKIGA
GLETLCLTRVPQAD----NTVL-DAIHTHCRS------LTKLRITESEEMTDAGFVRLFR
DW---ANPGLTIVDFQKCRQLDSARPRDNPD-GLGLCSDGFRALV-AHSG----------
------------KTLRELNVHGCRHIAVGAFEDVFRSE----------------------
--------------VGGRQYEAMQKLEISFCEEVTDFVVGCVFRCCPSLRELNVFGCMKV
RDV----RV---------------------------------------------------
-----------------------------PRGKILVG-----------------------
------------------------------------------------------------
-------------------VPNAKGMVIEGD-D-----DEDVCLWAAFGGDGRHINVEKG
VLHGGL
>gi|85102650|ref|XP_961376.1|	   612 residues, 50 /line  hypothetical protein ( (AL451013) related to nucleotide exsicion repair protein RAD7 [Neurospora crassa OR74A] )
MSP---------------------------------------------------------
----TRSRQQNNRAGR-----------------------Q----IRGP---------QSA
LT----------------------------------------------------------
--------------------------------DFLASH----------------------
---------------------------------------------NISANQIRLDADARR
RAA---------------------------------------------------------
-----------------------------------EQENGASSSSNQQQVAEDEVGE---
--SSTVTTSVT-----------VTTRTSRRKKDQKVIDKIKASKTYQKRKR---------
------------------NAGEDDADDD--------------------------------
-----------------------LLDTLL--RERAPLPGQMDNCANCGKRFTVTAYSR-N
HPDGG-----------LLCSPCGKEMDK--------------------------------
--------------------------------------------------------DAP-
PKKKPA------------------------------------------------------
----------KRAATGP-VGRRRQIQSKILDGTFQ-LGAKSLMTLC--------------
-----IETLAKNIDLA--------------------EDLGDLPQPVIDKIARKLSKHRLL
NPTTLSLFLQPTADEVCIYDGAKLSADDYIRIF---------------------------
QTVP--GLKRLKARNAIHFKDEV-----MDFLVSRKTELEDLYLHGSNLIAEEKWLEFLE
KK-----------------------GKSLQSLRVYWTDKHFGDSALAALPSSC-PSLVRL
KACHNQKITGEGINHLAQ----LHHLKHLSIDLR---------NHVHSDVYVNVLSSIGP
NLETFSITREIELD----NTVL-DAIHNHCRS------LQKLRITDSDVMTDEGFARLFT
NW---ENKCLLFVDLQKCRQVDSANPRQNPD-NIGLCDRGFKALM-AHSG----------
------------RKIQHLNVHGCRHISAKAFEEVFPSD----------------------
---------------GKKVYPELKNLEISFCEEVTDFIVGSIFKCCPNLHELNVFGCMKV
KSV----RV---------------------------------------------------
-----------------------------PKGKILVG-----------------------
------------------------------------------------------------
-------------------VPNALGMVIEGV-D-----DDEE------------------
------
>gi|116497824|gb|EAU80719.1|	   884 residues, 50 /line  hypothetical protein CC1G_04829 [Coprinopsis cinerea okayama7#130]
MSVKGITKMPSLEFHPMVPRTP--KTPARSVFTFEGQTCVTPMSAAFDHDIPPRPGAPTP
LAAMFGGSVYDAAGQSTPLGFPSKFPSVKREEDDPELIFA----ARSK---------NKS
VTQPSRLVAALGLRARQFESNSENSDSDDDLFFDASGSGNDSLFGELELDDEAWSSDGVY
GSDYENELEEDDEKDYVSGHYSENEGELSTVLEDAEEEDSEGLKDDPELAPDASLETVKE
DCIGGVSEPSKEKADERTAQDTEYESPHERIHTPDSILDGVDS--GITHATIARRAATRQ
QQQ-------QQDDDQQQDDGQ-----------------------QGDGQPQAGPSNAQP
EASSSTSTPSRRP--SRAASRRVSGYGSDNL-----DDEDEDGDGDVEMKEAT-------
--------DNEPEQQE--AVESPAPAKKRKLSKKA------------------EAKLKAE
EKKKMKGKKG------KGGDDDDDYDDE--------------------------------
----------------DDDPYTSLSKAMWTNSGSKPAPGSFENCARCKKQFTVTKYTMTA
NPPPG-----------WLCHVCAKSSGQ--------------------------------
--------------------------------------------------------DPF-
KKPA--------------------------------------------------------
---------------AP-KKRKTAADKREITHFVE-NRLPTLVTIC--------------
-----IRLVTKHIDDV--------------------ESLGDIGTLNLEAIAKAMSKNRSL
TPDNAKLFYNASNPRLTFYDATNITPAAFETLV---------------------------
YLNP--NLTSLRLDFCGQLDDTA-----FKVFCTSLPALTHIELLGPFLVRAPMWQE-FA
KS-----------------------HPNLEAFLITQS-PRFDLECIKALVKHC-PGLKEL
RLKEFAKMSDVFLEELA---ALGEGLTYLDISCPG-------GESCSEAAIIQLLESVGG
SLKSLDVAKHDDIT----DRLLKEGLIPHVHH------LDTLNLSHLNELTDEGVGEFFS
TW---ENPPLVHLDISRN---------------PDLGTKALEAIM-KHSG----------
------------KTLEVLNINGFKDVEEPALRTIGRL-----------------------
-------------------GKEMRKLDVGFCRNVDDFVIKAWLEG---------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------EEVNGV
SDGSMSKKVWFDGAWRRVAYYSHE----LKS-------ILLS------------------
------
>gi|119176943|ref|XP_001240323.1|	   620 residues, 50 /line  hypothetical protein CIMG_07486 [Coccidioides immitis RS]
---------------------MTAGFLQRATEPEATGGWAR-------------------
-LCQFEMANNNTRPRR-----------------------N----IQGP---------HSA
LT----------------------------------------------------------
--------------------------------DFLASH----------------------
---------------------------------------------NISAAAIRDSYQRRV
ADA------AQQNDVESTVDTP--------------------------------------
------------------------------------------------------------
--------EDEEEDSV--Y-EEVEATRKRARRNL-------------------ATAKANA
KKKQKAKRSG------DHEDSDDDDD----------------------------------
----------------------ELLETM-MYQKRKAVPGQLANCEICSKRFTVTPYSK-S
GPEGG-----------LLCTQCSKKQTA--------------------------------
--------------------------------------------------------EEK-
KAKA--------------------------------------------------------
------------KVRKPSKRGRRQNYSNLLDGIAQ-SGAFSLLETC--------------
-----IKKVADSIHDI--------------------DEFGDLPEGLLHRLSQILSKRRVM
TPRTLELFLRRDVSSIDIYDCAKLETEDFQKIF---------------------------
AFMP--YLERVNLRCAGQFKDST-----LEYITSRESHIRELQLDSSNLVSDECWQKFFK
TC-----------------------GHKLESLKLSNLDCSMGDETIEQMVKNC-QNLRRL
KIKECWRPGNESLKSIST----LTGLEHLSLDFM---------QETDLETLGQLIHNVGP
NLRTLSLRGFKNAD----DRIL-EAVHQRCKR------LNKLRFADNATCTDKGYAHLFT
NW---QAPPLAFIDLSGARHIDNAVPDGPEE-PVGLASEGFKALM-EHSG----------
------------DKIETLNISSCRHVSFDAFASTFDESR---------------------
------------------TYPKLKELDISFHTKVDDFLVNSIFKCCPALRRLIAFACFNI
TGA----KV---------------------------------------------------
-----------------------------PSGVALIG-----------------------
------------------------------------------------------------
-------------------GVNACSSIAIED--------GVA------------------
------
>gi|125603655|gb|EAZ42980.1|	   871 residues, 50 /line  hypothetical protein OsJ_026463 [Oryza sativa (japonica cultivar-group)]
------------------------------------------------------------
-------MAGGSSAGT-----------------------P----WPSP---------STA
LT--------------------------------------------------------LG
LGLGPPAAD-----------------------GSLKSPGLAP--------------PPCR
----SLRLASGAVASGVAS---------PTTTPASSAPAAGADGA-------------SS
GSGSASSGRRKGRAQAIPAPVASPTSAGEFGGGGEVRVWGGGNRSGEAAFISLQSGSRVA
--------------------------------------------------------KRSM
ELGVQMGGEMGLGSNG--G-G-------GAGGQVHDEMPHR-----------------NV
DSSGKRRKIGMEIPYVSDSESDNDDDCILPGEDGSRMPVQLCAASDLIELNLFTMSMGRT
DEGRMGDSV-----KTGK------------KKASGVTIRENDIPID---EHVHGQSSA-I
GESIE-----------LLASPMRSALGENHAGMYSTEEERRQKARYDVKGKGKLYLGNDD
SGAGTGIGKFSPDSKGKAKMVVEESSLSVSSGADQMDLNSVISEEVQSFPADHWEPRRR-
ERARQRAIEMAPRFAFFKADEDGHSDDGDDDDDNAEELEPVPDPQDWPGPFSTAMRIITD
REAKLRARELNSSNLN-KSANKVISWIPSKDRKSPLRSAPSLTSLC--------------
-----LQTLSNNAEAI--------------------ESLAGIPDELKNRLLSSLCHSRKM
NVHLLGELMCDNPVTVQLSECSWLSEDDFETIF---------------------------
GKCRTEILQVLQLDLSGRCMPDYMLPATLAKVPNSMPLLKKISLKGNYRLSDSGLDTII-
SA-----------------------APSLSSLNLCEC-SLLTSTGIENLANKLSLVLTEL
YIDDCLNVDAMMILP---SLQKIKHLEVLSMSG---------IQSVSNKFVNELIPVHGS
NLKELAFAGCLQLT----SSSI-KTIAGNCPQ------LSSLDLRNLNRLRDSAMRHLRN
G-----CRLIKKIKLQR----------------NTFSDEAVYRFL-EQSG----------
------------GYLTELCLNNVEKAGNLTAYAIARN-----------------------
------------------CSTHLEVLDLSFCRELTNEALGLIVDSCSSLRILKLFGCTQI
TDVFLKGHS---------------------------------------------------
-----------------------------NSLVTIVG-----------------------
----------------------------------------------------------IE
GNIL---------------KQTGS-----------------L------------------
------
>gi|146418934|ref|XP_001485432.1|	   579 residues, 50 /line  hypothetical protein PGUG_03161 [Pichia guilliermondii ATCC 6260]
------------MAR---------------------------------------------
-----------QKKST-----------------------G----VRGP---------NSA
LT----------------------------------------------------------
--------------------------------EFLRVE----------------------
---------------------------------------------GITDAFRRRQERSES
V-----------ETSETSTGPE----------------------EA-----ETSNGTV--
------------------------------------------------------------
------------------------SNN-EEVLVADPEE----DAIREAGRRKR-------
---------------AGK-YDSDDSDD---------------------------------
---------------------EWVDD-E-SN-RNQDKFGETSECADCGKPFTLTVYSRYL
AARKG-----------YLCDECNELVKE--------------------------------
--------------------------------------------------------QER-
ASRR--------------------------------------------------------
------------SQFA-ARKRRKKVALALLDR-TR-VRIPKLQDVC--------------
-----IRKITENIGDV--------------------DALGDIGQSNINKVAQILSKNRSL
DETTIPLFLNPQITSLRLWDCSNVDSDSLNKIV---------------------------
AFCP--KIQSLTLFMCGQFHNDN-----LKYYGTNLLELTSLALNGPFLISETAWLDYFA
DG-----------------------GSRLTEFELRNT-HRFGNDSLISLLEGCGSNLTSL
KLSRLDGLKEESVYSLIPHYLLASKLVHLELSYP------HSEGLITDDLIINILSVTGD
TLVSLNVDGCTDLT----DRFLIEGVAKFCPR------LTHLSMDSLDQVSNEGFSKAFE
DYSKVNSGGLIGVNLRKC---------------GLLANEAVYSLL-KHSG----------
------------KTLVELNLNSLRLLTKDLLIDVLLPHK---------------------
-VDKD-------SQFDPLDLPLLTTLDIGFVRVVDNMVLMLLGQKCPKLAILEVYGDNRS
TKQ---ANV---------------------------------------------------
-----------------------------RNDLLVIG-----------------------
------------------------------------------------------------
-------------------RQSDT-----------------A------------------
------
>gi|50412609|ref|XP_457144.1|	   630 residues, 50 /line  hypothetical protein DEHA0B04114g [Debaryomyces hansenii CBS767]
------------MAR---------------------------------------------
---------RSNRNQS-----------------------G----VRGP---------NSA
LT----------------------------------------------------------
--------------------------------EFLRVE----------------------
---------------------------------------------GITDAFRRRQERGDP
T-----------SREESPADRN----------------------ET-----EDSEVLLPS
------------------------------------------------------------
------------------V-PLDIHEN-NLDGEVDEEE----KAIRQAARRKRRAAKRRL
GG-----RFP-----SDS-DDDDDNDD---------------------------------
---------------------NYSDDDV-LG-NGFKKFGEEDNCVDCGKIFNMTVYSRYD
RARKG-----------YLCESCNENLKQ--------------------------------
--------------------------------------------------------REK-
TARR--------------------------------------------------------
------------NQLN-ARKKRKKVAQALLDK-SS-IQMPTLQDIC--------------
-----IKKITQNIDDV--------------------DALGDIGQTNMNKISMILSKNRSL
NNSTMTLFLHPGLKVLDFWDCSNVDSDSLNKIA---------------------------
SYCP--NLESLTLFMCGYFHNDN-----LKYYSSHLQNLTELSLNGPFLISDSMWQEYFE
NG-----------------------GSRLSKFEIRNT-HRFGNDSLISLLENCGSKLTKL
KLSRLDGLDSAPVYELIPHYLLTSNLTSLEISYP------YKEELITDDLLINILSVTGE
SLTSLNVDGCSNLT----DRFLTEGIVRFCPN------LTHVSMKLLDQLTDEGFAAAFR
EYSNVNSGGLINVQLTKC---------------TGLGNNAIYSLL-HHSA----------
------------QTLVELSLNSIYNVDKDFLFQIFTDDYHPLKKSLKDSIESTSRRTEVH
SSDEGNDETGMTKFYGKINFPLLTTLDIGFVRAVDDEILNFISDNCSKLTILETYGNNRC
TLR---ANV---------------------------------------------------
-----------------------------RNDLMVIG-----------------------
------------------------------------------------------------
-------------------RQNDI-----------------L------------------
------
>gi|149248068|ref|XP_001528421.1|	   684 residues, 50 /line  conserved hypothetical protein [Lodderomyces elongisporus NRRL YB-4239]
------------MARR--------------------------------------------
-----QR---GRRTEG-----------------------G----VQGP---------SSA
LT----------------------------------------------------------
--------------------------------AFLKSE----------------------
---------------------------------------------GITDAFRARRERERE
Q-----------QVANNPTEEP----------------------ETLESGSEGSDANTPS
R----TGTPEAANT--------------------------PSRTGTPDSAEQSRRASSQV
NIEQVGENRSGHGDNN--V-GVDQNEDDDDDDDDDDEI----RQMKRAAKRKLRAARRGA
GSNGTKRRTA-----PGDGSDGDDSDD------------------------------SDK
---NDN------------DDYNDDDDDE-LQNVDMKKFGEDDTCVDCGDRFELSVYSRFI
KEKTG-----------YLCDSCNQVLRE--------------------------------
--------------------------------------------------------RER-
KAKA--------------------------------------------------------
------------NQLA-ARKKRRKVAQALLNK-ST-VKLPKLQDVC--------------
-----IKKITQNIEDV--------------------DALGDIGQMNLNKIAMILSKNRSL
NDKTISLFLSPDLKHLEFWDCSNVDSDSLNKIA---------------------------
SFCP--NLESLTLFMCGQLHNDN-----LEYFASNLKHLHSLSLNGPFLISDRMWQSYFE
QI-----------------------RGKFVKFEVRNT-HRFGNESLLSLLECCGNELTSL
KLSRLDGITKTEAYQEIPKYISRNKLVELEISYP------TNEDLITDELLIDILAITGE
SLNYLNVDGCSGLT----EKFLLEGVSKYCRN------LTRLSMKNLDQVSNEGFAKAFE
KFSKVNAGGLLEINLMKC---------------TDLGDDALYALF-NHSC----------
------------HTLVEMSINSLYRVSKDFLSQIFTEDAHQFKINLRNKAK---------
-------EDSSIAHFHAIKLPLLTYLDASFVRAVDNEILTLISENCPKLQIIEVYGDNRC
TNK---AVF---------------------------------------------------
-----------------------------EDSLMVIG-----------------------
------------------------------------------------------------
-------------------RQTDD-----------------L------------------
------
>gi|68466691|ref|XP_722541.1|	   652 residues, 50 /line  hypothetical protein CaO19_1493 [Candida albicans SC5314]
------------MARR--------------------------------------------
-----QRSKQGSSSQS-----------------------G----VKGP---------NSA
LT----------------------------------------------------------
--------------------------------EFLRNE----------------------
---------------------------------------------GITDAFRQRRQREQE
T-----------VNEGNENDND----------------------TNEPEQST--------
----------------------------------------SAVEVTPEARRRSTRRSPSA
-----------------------PVEDTKDTNDDDDEI----REMRRAAKRKLRAARRGS
--TRQPRNRH-----DPDNSGGDDSSS------------------------------SSS
GSDNDG------------DPNFSEDEDD-LGNLNMRKFGEQDDCVDCGQTFELTVSSRFL
KEKNG-----------YLCNSCNQLLKA--------------------------------
--------------------------------------------------------RER-
KAKM--------------------------------------------------------
------------NQMN-ARKKRKRVAQALLNK-TD-VKIPKLQDVC--------------
-----IKKITENIEDV--------------------DVLGDIGQMNMNRISMILSKNRSL
NNKTISLFLSPDLKSLQFWDCSNVDSDSLNKIA---------------------------
SYCP--HLESLTLFMCGQLHNDN-----LQYFATQLTKLTELSLNGPFLISDVMWQDYFE
EA-----------------------GNRLTKFEIRNT-HRFGNDSLISLLTNAGRNLTSL
KLSRLDGLNAADVYGMIPHFLSPSKLTHLEISYP------EKEELISDDLIISILSITGD
TLVSLNLDGCSDLT----EKFLIDGVAQFCPN------LTHLSIQNLDQISDDGFAQALK
EYSKVNVGGLLEVYLTKC---------------IGLGDKAIYELF-KHSG----------
------------HTLVELSINSLDLLTKNFLSQVFTEDSHQFKKRLLQQLEES-------
-------QDEEVEYYNHIRLPLLTYLDSGFVRAVDNELLSLIGESCPQLKIIEVYGDNRC
TSK---ARI---------------------------------------------------
-----------------------------RPGLMVIG-----------------------
------------------------------------------------------------
-------------------RQSDE-----------------I------------------
------
>gi|149385826|gb|ABN65410.2|	   619 residues, 50 /line  nucleotide excision repair protein [Pichia stipitis CBS 6054]
------------------------------------------------------------
-----------SRGSS-----------------------G----VRGP---------NSA
LT----------------------------------------------------------
--------------------------------AFLQNE----------------------
---------------------------------------------GITDAFRERRERELF
Q-----------TAQEPTTVVE----------------------VVEEQTTT--------
----------------------------------------SLSSLSARASRVSRRLRAA-
---------------------------LQEEQEEDPEV----EEIKKAARRKRRAAKR--
--------------------DSDDDDD---------------------------------
----DI------------DDLDFSDIDE-LED-NVKKFGEEDTCVDCGNTFHLTVYSRYL
KDSKG-----------YVCEECNEIIKE--------------------------------
--------------------------------------------------------RER-
KARA--------------------------------------------------------
------------NQQT-ARKRRKKVAQALLNK-TV-VRIPKLQDIC--------------
-----IKKISDNINDV--------------------DVLGDIGQINLNKLSKILSKNRSL
NNNTMSLFLSPELKSLEFWDCSDVDSDSLNKIA---------------------------
SYCP--NLESLTLFMCGQLHNDN-----LKYYNSNLKKLTDISLNGPFLISEAMWQEFFD
ES-----------------------DNRITKFEVRNT-HRFGNDSLISLLESSGKRLTSL
KLSRLDGLDSSAVYDLIPHYIQTSTLTDLELSYP------NKEDLITDELLINILAISGE
SLVSLNVDGCTGLT----DAFLIDGVSKFCPN------LTHLSMVGLDQITDDGFASAFE
EYSKVNGGGLLNVNLCKV---------------TGLGDKAVYALF-KNSC----------
------------STLVELNLNSLYKLSKEFLYQVFTDDHNVYKKKLQHRIDNG-------
--ESSGETEPPLVLYNQTRLTLLTTLDIGFVRAVDDEILKLIGESCPKLSVLEVYGDNRC
TSR---AKF---------------------------------------------------
-----------------------------REGLMVIG-----------------------
------------------------------------------------------------
-------------------RQNDE-----------------I------------------
------
>gi|150413888|gb|EDN09253.1|	   600 residues, 50 /line  conserved hypothetical protein [Ajellomyces capsulatus NAm1]
-------------MYV-TLCLVVVCLLGSL------------------------------
-----------RIVAD-----------------------G----LEGR---------KDR
SV----------------------------------------------------------
------------------------------------------------------------
---------------------------------------------QAFGDQIRSNYEQRL
RQA---------QENEEQANGT--------------------------------------
------------------------------------EYSNTNDQGDAELDEEM-------
--------PDEPVE----------STGTRKRKSQAALKAIKAAKQ-------K-------
----------------KEQAKQDGDARI--------------------------------
----------------------FNSMAS-GKKSGSLLPGQLENCEYCKKRFTVTSYSK-S
GSKGG-----------LLCPPCSKREEL--------------------------------
-------------------------------------------------------RDRQ-
----------------------------SKKS----------------------------
------------LVNK-NKRSRRQNVSKILDGIVQ-SGAPSLVETC--------------
-----IKKVADHITDV--------------------DEFGDLPPDLILSISHILSKRRAL
TSLTLDLFLRGDVTAIDIYDCGKLEEDDFHKIF---------------------------
ATTP--YLERVNLRFAGQLKDKQ-----LEYMMNHNKFIKHIHLDASNLISNEGWQNLFK
TY-----------------------GSQLESLKLSNLDYSLDDKSISVMAKHC-TNLRRL
KLKTCWLLGDDALSSIST----LSNLEHLSLDFL---------KETSAAALLEVVDRLGP
NLQSLSLSSFKNAD----DTVL-DMIHQRCRR------LSKLRFSDNCICTDTAFALLFT
DW---ENPPLTYVDVSGTRDVDNANPNGPED-PVGLASAGFQALM-NHSG----------
------------KHLETLNICSCRHISHTSLSAAFDGTRN--------------------
------------------KYPCLREFDISFHTSADDFLVLSIFKSCPALRKVIAFACFGI
RDN---L-----------------------------------------------------
-------------------------------DELCFE-----------------------
------------------------------------------------------------
-------IP----------HLSDL--FVI----------QLS------------------
------
>gi|19075202|ref|NP_587702.1|	   563 residues, 50 /line  hypothetical protein SPCC613.14 [Schizosaccharomyces pombe 972h-]
------------------------------------------------------------
-----------MSSGS-----------------------R----VRGP---------NSA
LT----------------------------------------------------------
--------------------------------EFLRSQ----------------------
---------------------------------------------GINASALGRARPPRQ
S-----------EESAGQSTGT--------------------------------------
-------------------------------ESEVIQTPTSVEENNEDENSMS---T---
-------------------------------TTIEIPVVKRRNLRNQKKKKKT-------
----------------DEEAEDNEDTFS--------------------------------
----------------------MNSRAG-FSYKAREHTGKLDFCAHCNCRFTITPYSKYS
NSEKG-----------WLCYPCSRGAED--------------------------------
--------------------------------------------------------RSV-
PELR--------------------------------------------------------
------------TRKR-KALTRKKVAAATMDE--E-ISVPKLQDLC--------------
-----IRVIAEYINDI--------------------EAFGDIGQVNMDKISQIISKNRSL
NDTTVKLFLSGGQTELKLYDCSKITADSLFQIA---------------------------
QYCP--NLQTLHLTYCGQMQDQV-----LHFYADHLTELTDVSFQGAFLVSSSEWINFFK
KR-----------------------GSKLISLELTDT-ARIHVSVINAIVDCC-PNLISL
NLSRIFYLDDECVRLLAG----CRNLVSLKIESPG--------GIINDGSILDVLNQIGS
GLHTLSLSGCTKLT----DEVLKQGIGPCCGR------LKHLNLSGLELLTDDEASIVFG
EWK--IQSGLETLSLRRC---------------LSLGDKTVRAVL-VNSG----------
------------HTLRTLDLNGMSFVTDEALQYIVNF-----------------------
------------------PLPMLKALDVSWIRGMNDKLVCDFESKKPTLEKLLVWGDNHV
LMP---S-----------------------------------------------------
------------------------------NRLLLIG-----------------------
------------------------------------------------------------
-------------------REV-------------------Q------------------
------
>gi|22326928|ref|NP_680178.1|	   544 residues, 50 /line  unknown protein [Arabidopsis thaliana]
-------------MNSSDFPNDSRENRRINTDGEAIDALFM-------------------
-ATEEAVTRDFLSGFQ-----------------------N----QD--------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------VEMEERKSTEADVV-KTGSDYWRDYEVKRNFKAAKHFALELHSD-L
------------------------------------------------------------
---------------------------------------KIVEKTEEEVEEEVIRDEDK-
SEFRKA------------------------------------------------------
----------KESIKK-RRQEISTTSDMEIDLNVR-RKAPSLVELS--------------
-----ARVLAQNFLAI--------------------KSLKLVPDHLRKKLSYLVSGLGEF
DTRLMELLIEDSPSEICAKNCVQLVEDDLVKIF---------------------------
CDCDRVSLKVLILDLCGRSMTDYTINQFFKRAPNGFPSLTTLSLQGAFCLTDNALL-LIS
KS-----------------------SPLLQYINLTEC-SLLTYRALRILADKFGSTLRGL
SIGGCQGIKKHKGFSSSL--YKFEKLNYLSVAG---------LVSVNDGVVRSFFMFRSS
ILTDLSLANCNEVT----DECM-WHIGRYCKK------LEALDITDLDKLTDKSLEFIT-
----EGCRYLKSLKLTSN----------------RFSDECIAAFL-EVSG----------
------------GSLRELCLNKVRDVGPETAFSL---AK---------------------
------------------VCKMLQFLDLSWCRRLKEDDLRRILRCCSSLQSLKLFGWTQV
EDT---YLE---------------------------------------------------
---------------------------ELSRSDVHITGLKLTSLYAH-------------
------------------------------------------------------------
-------------------LDNFYPSVGA----------KFF------------------
------
>gi|39978261|ref|XP_370518.1|	   610 residues, 50 /line  hypothetical protein MGG_07015 [Magnaporthe grisea 70-15]
----------------------MDGTPSLGRLVIKGLLDHI-------------------
-A------------LN-----------------------H----SRRQ---------QAA
LT----------------------------------------------------------
--------------------------------EAVAAE----------------------
---------------------------------------------AASNRPRSTNRN---
------------------------------------------------------------
---------------------------------GSSQRTSTSGPSNQSGN--L---PGAL
TNASSVAALADGVNPT-------IYKKKLTKAEAKAIEHYKTTD--DFANAKQ-------
----------------Y-YQGNVEDEDQ--------------------------------
-----------------------LAR-M-FYFTAKKAVGQFENCANCGKRFTVTAYSS-A
DPGGG-----------LLCTACGKELAK--------------------------------
--------------------------------------------------------EAP-
KK--------------------------RKQA----------------------------
------------ASGG-PIGKRRAAQSRVLDGTGS-IGVKSLVEIC--------------
-----IQHLSKNIELA--------------------DDLGVLPEHVVDRISRILAKRRKF
NSEVLPLFLQPGTRALRIYDSANLSSQDMISIF---------------------------
QVIP--DLKILQLRNAIQFKNEV-----MSYLLDRPTKLEVLSLHGCNLITTELWERFFV
EK-----------------------GQNLHTLQVYRCGDYFTDTLVAKAVEHC-PNLKRL
KLQENLNVTYASLESLQS----LSKLEHLSLKLW--------NQDIPNPALVSLIDALGS
KLQTLSLKLVEDAN----DTVL-QAIHRNCKS------LSKLRITGSKAFTDDALMRLFT
NW---ANPPLRFVSFENCRSMTHGE---NLE-EVGLCDKGFGALM-AHSG----------
------------RKIQHINVESCRHISAAAFLAAFDQDK---------------------
------------------TYPDLETIEISFCENVTDFIVGSIFRSCPALKWIKVFGCMKV
KDV---LV----------------------------------------------------
-----------------------------PRGRILIG-----------------------
------------------------------------------------------------
-------------------VPTAAGMQIE----------GYA------------------
------
>gi|45185600|ref|NP_983316.1|	   548 residues, 50 /line  ACL088Cp [Ashbya gossypii ATCC 10895]
-------------MYR--------------------------------------------
-----SRNKSK-AGDN-----------------------E----VRGP---------NSA
LT----------------------------------------------------------
--------------------------------QFLREQ----------------------
---------------------------------------------GISAESIKERWKSTR
Q-----------SESQDSADAA--------------------------------------
--------------------------------------ETDSDKGDSDYDGSS---SDGA
PESGL-----------------------------------ESSRASSRARSNP-------
----------------V-DSDEEEYEEGV----------------------------AAR
------------------------------------------------------------
-----Q---------GIRPKREPEMVQE--------------------------------
--------------------------------------------------------VLK-
RRKQ--------------------------------------------------------
-------------ALQ-RRQAKRKRAMELLDR-KT-KRIPTLQDVC--------------
-----VAVIGESIMKHKEHSLS--------VNKHILDVLGGVSVHNMNKLADALSKSRAL
NDRTLQLFLNVNLETITFHDCSNISADGYKSLA---------------------------
AFTP--HLRAVSLQMCGQLNNEA-----LLLMAEKLTNLRELYLDGPFLINDETWGIFFE
RM-----------------------GDKLEAFHVSNT-HRFTDDSLQKLLLHCGGSLRSL
KLSRLDSISNYALLPRY---LH-QDVHTLILQYP------SNEEDITDEIMINLLGVVGN
SLKVLNLDGCTGIT----DSFLVNGLASNVRSGSDSCSLERLSLEELDQVTSDGFITFFS
S---VQLPRLHYLNLRRC---------------HQLDDASIAEIWLNPCS----------
------------KFLKELNLNSARNLTAAGFQLM--------------------------
------------------SCPNLQQLNVGFVRCVDDKLLAHISECAPNLEIVEVYGDNLV
TQN---ASA---------------------------------------------------
------------------------------RGVTIIG-----------------------
------------------------------------------------------------
-------------------RQSDS-----------------I------------------
------
>gi|46123055|ref|XP_386081.1|	   634 residues, 50 /line  hypothetical protein FG05905.1 [Gibberella zeae PH-1]
-------------MHRCERNNIKTKGKKKARATRSNNQNAQ-------------------
-DQNGQTGQNGNRPAR-----------------------S----ITGP---------QSA
LT----------------------------------------------------------
--------------------------------DFLASH----------------------
---------------------------------------------NISAAQIRSTADARR
R-----------------------------------------------------------
---------------------------------QAAAEEATEEDVNGNGE--S---SAAG
ARSGRRAARSDENEAS----------SKRKMEEQKTLTKIKESKAFRKRKKNT-------
------------------DESD--------------------------------------
---------------------DEIARAI-MDEGTGPLPGQMENCEICDKRFTVTPYSV-A
GPNGG-----------LLCSPCGREIAK--------------------------------
--------------------------------------------------------ERQ-
-------------------------GAPKKKVK---------------------------
----------KQAAVG-GVGRRRAIQSRILDG--D-VGTKSLATLC--------------
-----VQTLAKNVDLA--------------------DSLGDLPEHLVDKIARMFSKRRLL
KSETLPLFVQPNTEDVHIYDGSKLTEFDYMSIF---------------------------
QIAP--RLRHLKIRCGIQFKDEV-----MDYLLTRDTALETFYLHGANLLSEEKWHEFMQ
AK-----------------------GQSLQGVQVYYTDNHFGDDSIAMLRDHC-PNLKRL
KVENNQKLTNDGVKTIAD----LASLEHLGLQLL---------HKTRSDAYVKIIRSIGV
NLQTLSLKIVTDID----DAVL-RAIHDNCRS------LVKLRITDCEVMTDFGFVELFT
NW---ENPPLQFVDLQKCRQVDASRPRENPD-NIGLCSDGFKALM-AHSG----------
------------HKLRELNVHACRHISREAFEEVFNENA---------------------
------------------QYPELKKMEISFCEEVTDFVLDLIFRACPNIREVNVFGCMKV
RNV----RV---------------------------------------------------
-----------------------------PRGVILVG-----------------------
------------------------------------------------------------
-------------------IPNAQGMMVE----------GSE------------------
------
>gi|50286481|ref|XP_445669.1|	   594 residues, 50 /line  unnamed protein product [Candida glabrata]
-------------MYR--------------------------------------------
-----SRNRNRQGGPN-----------------------S----IKGP---------SSA
LT----------------------------------------------------------
--------------------------------QFLKEE----------------------
---------------------------------------------GISAEAIRNRWLQRQ
V-----------KGGDKKEGSP--------------------------------------
-----------------------------------DEDKDTAFTTN--------------
--------------ND----------EEVKKDYDSESTLSDEPRLKREALEAN-------
------------------IVSDEEDEEDV-------------------------------
-----------------------EYKEI-TPAKDESVSYE-ERMKRFNQDSDEEEYDE-S
ASASIE---------PLVLPEKKVDKAT--------------------------------
--------------------------------------------------------IEK-
KART--------------------------------------------------------
------------VIQ--NRRKKQRRAANLLDR-KS-NAVLSLQALC--------------
-----IAKISQNIYKWQKDSEENRNNDHNVMFSHLREVLGGVSTENLNNLANALSKNRAL
NDQTLQLFLKTDLEALTFHDCSKVSFDGYKTLA---------------------------
IFTP--HIKKLSLHMCGQLNNES-----LLYIAEKLRNLTSLYLDGPFLINEKTWVQFFE
IM-----------------------KGRLEEFHVSNT-HRFTDKSLASLLINCGSSLKAL
GLSRLDGLFNYALIPQY---LCNEEFHSLELGYP------YNDEDITDEVVINILGQIGH
SLKRLVLCGCSDLS----DSVIINGIGAFIG---ENNRLEEIGLEELDQISNDSLLYLFS
Q---IQFPNLRVCSFRRS---------------IQIGDDTIMELFQ-NAAV---------
------------NTLEILNLNSLNSLTKESLLLL--------------------------
------------------SCPHLKHLDVAFVRAVDDEVVGRLGKQNPKLSLMEVFGDPLV
TEK---AKI---------------------------------------------------
-----------------------------RPGITLTG-----------------------
------------------------------------------------------------
-------------------RQSDS-----------------I------------------
------
>gi|50302839|ref|XP_451356.1|	   575 residues, 50 /line  unnamed protein product [Kluyveromyces lactis]
-------------MYR--------------------------------------------
-----ARSRRN-NDGS-----------------------G----VRGP---------NSA
LT----------------------------------------------------------
--------------------------------QFLKEQ----------------------
---------------------------------------------GISAENIRDRWLEAQ
K-----------KEAEHPQET---------------------------------------
------------------------------------QKDDSETESDEDLKAG--------
---------------V----------AAKKRSRKPRAVKKQESSSSGESDD-D-------
------------------EDDDDEDDDDY----------------------------KAE
ARLRRLRG------------------------------ADLEDSDEEEEVLPVSDRKK--
---------------RMLTLTNGKKTSP--------------------------------
--------------------------------------------------------QLA-
KARH--------------------------------------------------------
---------------Q-QKKTRRKKAANLLDK-KD-SLISSLQDIC--------------
-----IKVIGKSIVEYNAQS----------MVEHIRDTLGGVSLENLNKLAQALTKNRAL
NDDTLQLFLNTSLTTLTFYDCSKLSYEGYKRLA---------------------------
IFSP--HLESLSLQMCGQLNNEA-----LLYLAEKLPNLKELYLDGPFLINEDTWVQFFE
LL-----------------------KGRLTAFHVSNT-HRFNDNALSAMLRNCGSSLESL
GLATLDTVTNYALLPQY---LNSPNFHTLILEEP------SRETDINDEVIISLLGSIGQ
NLRKLSLNRCTGLT----DSCIINGFLPFLSNS-GQSILTDLELEELDQITTDGIVLLFS
S---LQFPLLKRCSLKRC---------------FALEDAAVVELL-LNSS----------
------------STLEELNLNGLKSLTSKTFTFM--------------------------
------------------ACPNLKQLNIGFVHCVDNEIVEKISKDNEKLTIIEVYGDNQV
TGK---CSP---------------------------------------------------
-----------------------------RNGVSIIG-----------------------
------------------------------------------------------------
-------------------RQSDS-----------------I------------------
------
>gi|50551261|ref|XP_503104.1|	   568 residues, 50 /line  hypothetical protein [Yarrowia lipolytica]
-------------MRH--------------------------------------------
-----YRHRQAVTGSG-----------------------E----VRGP---------NSA
LT----------------------------------------------------------
--------------------------------EFLKEQ----------------------
---------------------------------------------GITRRRESSEPPDEV
G-----------LEVGDQGQTS--------------------------------------
QTAIELSDNNTDDSSG--------------------------------------------
----------------------------SSADEDDPDI----VRIRNLARRKR-------
------------------NWDESEDDPD--------------------------------
----------------------MTSEEE-I--KGVKNPGQKDTCAVCGVLFVVTAFSR-N
HKNDAL---------KLLCYDCTMEEVK--------------------------------
--------------------------------------------------------KEK-
EAKK--------------------------------------------------------
------------RDHN-LRKLRKKQAEALLDQKQY-IRVPKLQDMC--------------
-----ITLITTHIDHV--------------------EALGDIGGENKNKISRILSRNRRL
DSETMKFFFDTQLKNLEFWDCSNIDSESLRMIG---------------------------
SFCP--NLEELVLGMCGRLRKED-----LLYLGEKLKSLASLYIDGAFLISGDTWNVFFD
MV-----------------------GGGLKELTIKNS-HRISSENIVYMCEKC-PKLEKL
VLSRLEGCTDPMGYEMAA--LTLGNLKEIEISYP------QDESLVSDDLISGLVSTCGP
QLKSINLDGCSALT----DKTL-GTL-RACTA------LESLSLSHVDQLTDNGVASLFY
QW---ENPGLSEIHMRKC---------------IALGDDSFRVLV-DNSG----------
------------PTLKSISVNSWAEIGVDTVKTVC---K---------------------
------------------SLPGLQDIDLGFCKGINDECVELLAENCPLLQKIEVYGDPGV
TEN---CKV---------------------------------------------------
-----------------------------GDGIKLIG-----------------------
------------------------------------------------------------
-------------------RMSDV-----------------V------------------
------
>gi|58261138|ref|XP_567979.1|	   600 residues, 50 /line  DNA dependent ATPase [Cryptococcus neoformans var. neoformans JEC21]
------------------------------------------------------------
-----MSRR--SRAGG-----------------------A----VRGP---------SSA
LT----------------------------------------------------------
--------------------------------SFLAGL----------------------
---------------------------------------------GVEPSHRINAWGDRS
A-----------VETPTSNGSN--------------------------------------
------------------------------------QHPDPANVVSDENVEA--------
-----GPSRVGLGTPS----------LDEEGDLPVGFKRERGTNGDEDYKAKR-------
------------------VRAASIDSDDL----------------------------DAD
DTPVVGHSA-----RTPKSAPQSSTNV---PAGPMRPIGEFMVCGECTKRFTVTAYTK-E
HPTNSQ---------TYLCVQCCYALGI--------------------------------
--------------------------------------------------------DPF-
AKPK--------------------------------------------------------
------------KAAP-KKAVKKQNRAKIVHYEQR-RGVNSLGDIC--------------
-----IQLVGKYIENV--------------------EQLGDIGSINMDKVCRIICKGRRL
TPETAPLFYSVERDSLDMYDCTRLTPEAFFTLA---------------------------
NLCP--NLQTLRLDLVGQMSTEV-----VSHWAKSLKQLKRIELHAPFLVRKEAWIELFQ
AA-----------------------GERLEGFLVTQS-PRIDRETVHQLVKNC-PNLTEL
RLAEIGRLDSEMLKELK---PL-KKLRLLDISSP--------ADSLTDDAIVDLLEAVGD
SIEDLNLADNFDLT----DAIL-PAIVKYCPR------LQSLCLRNLTELTDEGVTAFFG
SLQAKGHQGLRCIDMEKG---------------HELRDSALGALI-AHSG----------
------------ETIEWLSLLGWKEVALEALNALVR------------------------
-------------------CKNLKYLDVGWCRAVNNFWVKDVLDGCHAIEQVRVWGCNEL
SDG---VPR---------------------------------------------------
-----------------------------KKGVKVIG-----------------------
------------------------------------------------------------
-------------------IETHS-----------------I------------------
------
>gi|6322512|ref|NP_012586.1|	   565 residues, 50 /line  Protein that recognizes and binds damaged DNA in an ATP-dependent manner (with Rad16p) during nucleotide excision repair; subunit of Nucleotide Excision Repair Factor 4 (NEF4) and the Elongin-Cullin-Socs (ECS) ligase complex [Saccharomyces cerevisiae]
-------------MYR--------------------------------------------
-----SRNRPKRGGEN-----------------------E----VKGP---------NSA
LT----------------------------------------------------------
--------------------------------QFLREE----------------------
---------------------------------------------GISAENIKQKWYQRQ
S-----------KKQEDATDEK---------------------------KGKAEDDSFTA
EISRVVEDEEIDEIGTG-------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------SGTETERAQVS-YDARMKLVPADSDEEEYETSHISDTPVSL-S
SANDR-----------ESLTKKRQNTA---------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------KIIQ-NRRRKRKRAADLLDR-RV-NKVSSLQSLC--------------
-----ITKISENISKWQKEADES----SKLVFNKLRDVLGGVSTANLNNLAKALSKNRAL
NDHTLQLFLKTDLKRLTFSDCSKISFDGYKTLA---------------------------
IFSP--HLTELSLQMCGQLNHES-----LLYIAEKLPNLKSLNLDGPFLINEDTWEKFFV
IM-----------------------KGRLEEFHISNT-HRFTDKSLSNLLINCGSTLVSL
GLSRLDSISNYALLPQY---LVNDEFHSLCIEYP------FNEEDVNDEIIINLLGQIGR
TLRKLVLNGCIDLT----DSMIINGLTAFIPEK---CPLEVLSLEESDQITTDSLSYFFS
K---VELNNLIECSFRRC---------------LQLGDMAIIELLLNGAR----------
------------DSLRSLNLNSLKELTKEAFVAL--------------------------
------------------ACPNLTYLDLGFVRCVDDSVIQMLGEQNPNLTVIDVFGDNLV
TEK---ATM---------------------------------------------------
-----------------------------RPGLTLIG-----------------------
------------------------------------------------------------
-------------------RQSDS-----------------I------------------
------
>gi|66802658|ref|XP_635201.1|	   902 residues, 50 /line  hypothetical protein DDBDRAFT_0183884 [Dictyostelium discoideum AX4]
------------------------------------------------------------
-------------MSS-----------------------N----VLNN---------HSI
LN----------------------------------------------------------
--------------------------------SHTSSSQTSS-------VSPSLSSVNSN
----NNNNNDNNNNNLLQQ---------PTHSSSSSDTGEFINNSNFLNNSENKMANNNG
NSVITSTLNEKGEPETITTTTTTTTTTTKRP-LDEIDDRNLKKVKEDFTTNNSSNNNINN
NNNNNINNNNGDNYNNYNNNNNNNNYNNNNFNNNYNNNYNGNNSFDYNNNNNS---NVYF
NNDRGNNYNNSYNDYN----------NNNNNNTNTNTNTNTNTNTNTNT-----------
------------------------------------------------------------
--------------NTNTNTNTNNNNSF-NNNNNNNNNNNFNNSSNYNYDYNNKPYVN-S
NNNNN-----------NNNNNFNNNINN--------------------------------
--------------------------------------------------------NNN-
NRNKSPPPQYQTQISQQQPNNQQQQQLNNKNEN---------------------------
------------LELE-DEDENLILNQNRKP-KKT-KTIHRLMDIC--------------
-----LEELVKNIDKI--------------------ETLEPLPDELCQKIIPLFQRRKIL
SLKTLSLFRNCKLSRLELYGKEIAINDEWLNITKGLMKSTLSSINISKNNSLTDQGIASL
SSLA--KLSSLDISYCEKIDGTG-----LEPLVDAGVPLQKLHMEGNSSLNLVKVFNSLS
KLKTLNSLCVGNTNITDDMCKPLSLLTTLTHLDVARN-TQLGNQGLESISK---------
----------------------------------------------------------CV
NLIDLDISCCTKIN----ALGI--------------------------------------
-RHLGSLSNLQSLSAENC---------------A-IDDESMKYIG-TLKSLSSLSLINNP
FSDTGAKNIGNLTLLTTLDLSMCANITDAALVHF----K---------------------
------------------NLTQISKLNLNFCGNLTDSGVTSLTGGLGQLKTLGIIGCNRL
LIK---VKHRPLVLLVEDNPLQIKVISKVMERYNFDVEVASNGQMALDMFKANPRYELVL
MDMIMPIMDGLTATMLIREYERERGLKRTPVIIQTADSRESHKLICLAAGCDDFMTKPLD
KRFVDRAWKLLNEEFDSTDNNNNNNNNNNNNNNSNNNNNSNNNNNSNNNNYNNNNNRENS
GDNVNNNSSNINNGFSNI-RVNIN-----------------V------------------
------
>gi|71004276|ref|XP_756804.1|	   650 residues, 50 /line  hypothetical protein UM00657.1 [Ustilago maydis 521]
------------------------------------------------------------
--------------MS-----------------------N----VRGP---------TSA
LT----------------------------------------------------------
--------------------------------EFLRER----------------------
---------------------------------------------GITARNTNRFRRRDQ
N-----------EQEAVATATA---------------------------AAVTNASSLPA
PASPAPAPRTRGA--LARNGSS--------------MNFEEDDETDDDLPQAA---TASI
EVEAKASTRSGYQTRS----------NGKKRAQPDQVVAEASSTLDGKGKKKA-------
------------------KNEQDEDDDDY----------------------------NPK
GSSKKGKGPAREDWEDSLGLPQASSSRA-NHSYASRTPGSIAYCGMCKMKFTVTSYTK-M
SEKGP-----------L-CHRCGPMYKG--------------------------------
--------------------------------------------------------PGG-
VGAD--------------------------------------------------------
------------DKAK-STPKKRQIRRKTLQDSVH-QSFPSLQRYC--------------
-----IEIVSRHIEDV--------------------EALGLIGFDSKDAISKSISKNRSL
NPTTLQLFLSPFIKTLSLYDCSKLDSQSLQSIA---------------------------
TFAP--NLEHINLQLCGMLDNDA-----IDAWAQKLTKLKSIELYGPFLVRKEAWHRFFA
AV-----------------------GPRLESFKIRES-PRFDLSCAESMVQHC-PNLREL
GLAQIGPLDKTMLKPLE---SYGDQLTYLDISDPGVSAPGIPPKSLENDEVVSLLKAVGK
NLTYLDTSKNIDLT----DRIIVEAISPCCHK------LKTLRLIGLENLKAETVAGMFA
DWTLEGVTGISYLYLDRM---------------LKLDDSLMEPLL-THSG----------
------------PDLVELSLNSVDGITDTGLEVLAN-AK---------------------
------------------NLTKLETLDLSFVRAVDDDSLDKICRNIDSLKKVSVFGCNRI
SDF---FR----------------------------------------------------
-----------------------------SDRVRIVG-----------------------
------------------------------------------------------------
-------------------KEKYA-----------------A------------------
------
>gi|111064159|gb|EAT85279.1|	   564 residues, 50 /line  hypothetical protein SNOG_07813 [Phaeosphaeria nodorum SN15]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------------------MAAERSKKKRKRDQDEAIAKIKKGKEAKKKASKK-------
----------------KKKGSDDESDF---------------------------------
----------------------GDIMDM-SKKAPPPLPGQLKHCELCDKRFTVTPYSK-A
GPDGG-----------LLCTPCGKEMQK--------------------------------
--------------------------------------------------------EAKA
QEKA--------------------------------------------------------
------------KKPVV-RKGRRKLESNRLDGLTV-RGPKTLQQLC--------------
-----IEMLAKHSEDI--------------------DELGEMPEGIMNRISEIFSKKRAM
NSTTMKLFLQPDMHSIAIHEAAYLETEDYDQIF---------------------------
AVCP--TVKRLSLRNCCQFKDSN-----IDYMIEKGKHLEELQLLGANLVSNDKWIELFI
AR-----------------------GKDLKSLKVEWLDAAFDDQVVEALGTFC-PNLERL
KIERCKKLGEDSIDAIAR----MEHLQHLTLRFY---------SEIPHEKLINLITSVGA
NLRTLCLEHFLDASSEPTDDVL-DTIHNTCHK------LQKFRFTENNECSDAGYVNLFS
NW---DNPPLHYADINSTRDMDNSNPDGPEDEPIGLASNGFRELM-AHSG----------
------------SRLEFLDISSCRHISHEAFTEIFDGSK---------------------
------------------QYPHMREINLSFCPVVDTQIIAGIFRSCPQLQKVVTFGCFQV
EDV----VV---------------------------------------------------
-----------------------------PRGIVLIG-----------------------
------------------------------------------------------------
-------------------APKAQDQIEQFGEVVLDYQREIEAEMSARGLGM------GR
VVPVMG


Ad blocker interference detected!


Wikia is a free-to-use site that makes money from advertising. We have a modified experience for viewers using ad blockers

Wikia is not accessible if you’ve made further modifications. Remove the custom ad blocker rule(s) and the page will load as expected.