Fandom

Proteins Wiki

At2g05990.1/MSA

< At2g05990.1

47,923pages on
this wiki
Add New Page
Talk0 Share
>gi|18396215|ref|NP_565331.1|	   390 residues, 50 /line  MOD1 (MOSAIC DEATH 1); enoyl-[acyl-carrier-protein] reductase (NADH)/ oxidoreductase [Arabidopsis thaliana]
----------MAAT-AASSLQIATRRPSMSSP-SKILKAGT----YIVGANPGNASWDK-
----LSCTRQLSNLGCLRNHSAVP-----TCKRPF-SFSTRAMS--ESSENKA-------
-PSGLPIDLRGKRAFIAGIADDNGYGWAIAKSLAAAGAEILVGTWVPALNIFETSLRRGK
FDQSRVLP---------DG--SL----MEI-----KKVYALDAVFDNPEDVPEDVKTNKR
YAGSSNWTVQEAAECVKKDFGSIDILVHSL--ANGPEVSKPLLETSRKGYLAAISASSYS
FVSLLRHFLPIMNPGGASISLTYIASERIIPGYGGGMSSAKAALESDTRVLAYEAGRKSN
IRVNTISAG-PLGSRAAKAIG---------------------------------------
----FIDTMIEYSYNNGPIQ-KTLTADEVGNAAAFLASPLASAITGATIYVDNGLNAMGV
ALDSPVFKDLNSK----N
>gi|111608895|gb|ABH11005.1|	   340 residues, 50 /line  enoyl-ACP reductase [Polytomella parva]
--------MKAL------------------------------------------------
-----------SLTCTKLSNKLG------VSAV-NYVQKRRAS---VQAAAVN-------
-GNGLNIDLRGKKAFIAGVADDQGFGWAIAKCLAEAGCEISLGVWVPALNIFESSLRRGK
FDANRKLS---------NG--KL----MEF-----SKIYPMDAVFDTLADVPKDILSNKR
YAGNSKWTVAEVAESVKADSGNIDILVHSL--ANGPEVIKPLLETSRKGYLAALSASSYS
LISLVQRFGPLMNKGGSVISLTYNASNRIIPGYGGGMSSAKAALESDTRVLAYEAGRKYG
VRVNTISAG-PLGSRAAKAIG---------------------------------------
----FIDDMIRYSEENSPIQ-KGLSAEEVGAVATFLLSPLASGVTGHVMFVDNGLNAMGL
ATDAKSLIPPAK------
>gi|32307472|gb|AAP79141.1|	   392 residues, 50 /line  enoyl-ACP reductase [Bigelowiella natans]
--------MSYSGF-EVSSTVGSTSR-RIFSK-KSNLPVIV----L--SACAVMAACCF-
----FSQGRLLSTMASVRRGATG------ISGMRAPSFRNHHPNPVRGLTSCQ-------
-ANGLPIDLKGKKAFVAGVADDQGFAWAISKCLVEAGADVSLGIWVPALGIFKKSMQMGK
FDESRKLS---------DG--SL----MDF-----EKLYPLDAVFDTPEDFPEEIATNKR
YAGESDWTISEVANLVEKDIGKIDILVHSL--ANGPEVRNPLLETSRKGYLAAQSASAYS
LVSMVQKFGPIMNEGGSVLSLTYDASNKVVPGYGGGMSSAKASLESDTRTLAYEAGRKHK
IRVNTVFAG-PFGSRPARAIG---------------------------------------
----FIERVINYSYKNAPIE-KELSAMEVGQTAGFLLSPLAFAITGQVVYVDNGLSPMGL
SFDSPTLKAEEEQ---TG
>gi|116058940|emb|CAL54647.1|	   335 residues, 50 /line  enoyl-(ISS) [Ostreococcus tauri]
----------------------------------------------------------M-
----LRQGR--AVRGTTLKGTSA------REG-------TRAVGR-RAATTTT-------
-RAGLNVDLRGKKAFVAGVADDNGFGWAISKALSEAGAEVILGTWVPALNIFETSYRRGK
FDESRKLS---------DG--SL----MEF-----AKIYPMDAVFDTPDDVPEDIATNKR
YAGNEKWTVSEVAKCVEADFGKIDIVVHSL--ANGPEVAKPLLETSRKGYLAAVSASSYS
MVSMVQHFAPLMNEGGAVISLTYIASEAVIPGYGGGMSSAKAALESDTRVLAYEAGRKHG
IRVNTISAG-PLGSRAAKAIG---------------------------------------
----FIDKMINYSLSNAPLAEKPLGAIEIGNTAAFLCSPLASAITGQTIYVDNGLSVMGS
ATSAPEFQ----------
>gi|145348656|ref|XP_001418761.1|	   331 residues, 50 /line  predicted protein [Ostreococcus lucimarinus CCE9901]
------------------------------------------------------------
----MRQSS--AVTGTRARTT---------RG-------ARAA-R-PRATTTT-------
-RAGLNVDLRGKKAFVAGVADDNGFGWAISKALSEAGAEVILGTWVPALNIFETSYRRGK
FDESRKLS---------DG--SM----MTF-----SKIYPMDAVFDAMDDVPEDIATNKR
YAGNEKWTVSEVAKCVEEDFGKIDVLVHSL--ANGPEVAKPLLETSRKGYLAAISASSYS
NVSMIQHFGPLMNKGGAAISLTYLASEQIIPGYGGGMSSAKAALESDTRVLAYEAGRKWG
IRVNTISAG-PLGSRAAKAIG---------------------------------------
----FIDKMINYSLSNAPLKEKPLEAIEIGNTAAFLCSPLASGITGATIYVDNGLNAMGL
AETAPEISG---------
>gi|115475922|ref|NP_001061557.1|	   375 residues, 50 /line  Os08g0327400 [Oryza sativa (japonica cultivar-group)]
----------MGAS-AATGMQMVAARPCISAS-QGMLTSRA----A--VSRIGRA-----
----LSTTTGFATCPRICYSSPL------GSSKRS-GVAIRAMS-----SESG-------
-PQGLPIDLRGKRAFIAGVADDNGYGWAIAKALAAAGAEILVGTWVPALNIFETSLRRGK
FDESRKLP---------DG--SL----MEI-----VKVYPLDAVYDSPEDVPEDVKGNKR
YAGSSNWTVKEVAESVKNDFGSIDILVHSL--ANGPEVTKPLLETSRRGYLAALSASSYS
FVSLLQHFLPIMNPGGASISLTYIASERAIPGYGGGMSSAKAALESDTKVLAFEAGRKGK
IRVNTISAG-PLGSRAAKAIG---------------------------------------
----FIEKMIEYSYVNAPLQ-KELLADEVGNTAAFLVSPLASAITGSTVYVDNGLNTMGL
AVDSPTISS---------
>gi|115478314|ref|NP_001062752.1|	   371 residues, 50 /line  Os09g0277800 [Oryza sativa (japonica cultivar-group)]
----------MGAS-VTTGLQMAAARPCIPAC-QRLLGSRA----A--LPSFGRA-----
----LSTQTGFASCRKTASAGPF------VSLNHK-RFAVRAMS----------------
-AQGLPIDLRGKRAFIAGVADDNGYGWAIAKALAAAGAEILVGTWVPALNIFETSLRRGK
FDESRKLP---------DG--SL----MEI-----TKVYPLDAVFDSPEDVPDDVKANKR
YAGSSNWTVKEVAETVKNDFGTIDILVHSL--ANGPEVKNSLLETSRKGYLAAVSASSYS
FISLLQHFLPIMNPGGATISLTYIASERTIPGYGGGMSSAKAALESDTRVLAYEAGRKGK
IRVNTISAG-PLGSRAAKAIG---------------------------------------
----FIEKMIEYSYVNAPLQ-KELLADEVGNTAAFLASPLASAITGSTIYVDNGLNTMGL
ALDSPTLST---------
>gi|15604823|ref|NP_219607.1|	   298 residues, 50 /line  enoyl-(acyl carrier protein) reductase [Chlamydia trachomatis D/UW-3/CX]
------------------------------------------------------------
------------------------------------------------------------
---MLKIDLTGKIAFIAGIGDDNGYGWGIAKMLAEAGATILVGTWVPIYKIFSQSLELGK
FNASRELS---------NG--EL----LTF-----AKIYPMDASFDTPEDIPQEILENKR
YKDLSGYTVSEVVEQVKKHFGHIDILVHSL--ANSPEIAKPLLDTSRKGYLAALSTSSYS
FISLLSHFGPIMNAGASTISLTYLASMRAVPGYGGGMNAAKAALESDTKVLAWEAGRRWG
VRVNTISAG-PLASRAGKAIG---------------------------------------
----FIERMVDYYQDWAPLP-SPMEAEQVGAAAAFLVSPLASAITGETLYVDHGANVMGI
GPEMFPK-D---------
>gi|15618321|ref|NP_224606.1|	   299 residues, 50 /line  enoyl-(acyl carrier protein) reductase [Chlamydophila pneumoniae CWL029]
------------------------------------------------------------
------------------------------------------------------------
---MLKIDLTGKVAFVAGIGDDQGYGWGIAKLLAEAGATIIVGTWVPIYKIFSQSWELGK
FNESRKLS---------NG--TL----LEI-----AKIYPMDASFDSPEDVPEDIAENKR
YKGITGFTISEVAEQVKKDFGHIDILVHSL--ANSPEISKSLLETSRKGYLAALSASSYS
FVSLLSHFGSIMNRGGSTISLTYLASMRAVPGYGGGMSSAKAALESDTKTLAWEAGRRWG
IRVNTISAG-PLASRAGKAIG---------------------------------------
----FIERMVDYYQEWAPIP-EAMNAEQVGAVAAFLASPLASAITGETLYVDHGANVMGI
GPEMFPKDS---------
>gi|15834999|ref|NP_296758.1|	   298 residues, 50 /line  enoyl-(acyl carrier protein) reductase [Chlamydia muridarum Nigg]
------------------------------------------------------------
------------------------------------------------------------
---MLKIDLTGKIAFIAGIGDDNGYGWGIAKMLAEAGATILVGTWVPIYKIFSQSWELGK
LNESRKLS---------NG--EL----LTL-----AKIYPMDASFDTPEDVPQDILENKR
YKDLSGYTVSEVVEQVKKDFGHIDILVHSL--ANSPEIAKPLLDTSRKGYLAALSTSSYS
FISLLSHFGPIMNEGASTISLTYLASMRAVPGYGGGMSAAKAALESDTKVLAWEAGRRWG
IRVNTISAG-PLASRAGKAIG---------------------------------------
----FIERMVDYYLDWAPLP-SPMEAEQVGAAAAFLVSPLANAITGETLYVDHGANIMGI
GPEMLPK-D---------
>gi|29840151|ref|NP_829257.1|	   299 residues, 50 /line  enoyl-(acyl carrier protein) reductase [Chlamydophila caviae GPIC]
------------------------------------------------------------
------------------------------------------------------------
---MLKIDLTGKVAFIAGIGDDQGYGWGIAKVLAEAGATIIVGTWVPIYKIFSQSWDLGK
FDESRKLS---------DG--SL----LEI-----KKVYPMDASFDKPEDVPQDITENKR
YKGISGYTISEVVEQVTKDFGHIDILIHSL--ANSPEISKPLLETSRKGYLAALSTSSYS
LVSLLAHFGPIMHPGGSSISLTYLASSRAVPGYGGGMSAAKAALESDTKMLAWEAGRKWG
IRVNTISAG-PLASRAGKAIG---------------------------------------
----FIEQMVDYYLDWTPIP-NPMTTEQVGAAAAFLVSPLASAITGETLYVDHGANIMGI
GPEMLPKNS---------
>gi|62185007|ref|YP_219792.1|	   299 residues, 50 /line  enoyl-(acyl carrier protein) reductase [Chlamydophila abortus S26/3]
------------------------------------------------------------
------------------------------------------------------------
---MLKIDLTGKIAFIAGIGDDQGYGWGIAKALAEAGATILVGTWVPIYKIFTQSWDLGK
FDQSRKLS---------DG--NL----LEI-----KKIYPMDASFDKPEDVPEDIAENKR
YKGISGYTVSEVVERITKDFGHIDILVHSL--ANSPEISKPLLETSRKGYLAALSTSSYS
LVSLLAHFGPIMPQGSTSVSLTYLASSRAVPGYGGGMSAAKAALESDTKMLAWEAGRKWG
VRVNTISAG-PLASRAGKAIG---------------------------------------
----FIEQMVDYYLDWTPIP-EPMTTEQVGAVAAFLASPLASAITGETLYVDHGANIMGI
GPEMLPKRS---------
>gi|89898427|ref|YP_515537.1|	   299 residues, 50 /line  enoyl-[acyl-carrier-protein] reductase [Chlamydophila felis Fe/C-56]
------------------------------------------------------------
------------------------------------------------------------
---MLKIDLTGKVAFIAGIGDDQGYGWGIAKVLAEAGATIIVGTWVPIYKIFSQSWDLGK
FDESRKLS---------DG--SL----LEI-----KKVYPMDASFDKPEDVPSDIAENKR
YKGISGYTISEVVEQVTKDFGHIDILIHSL--ANSPEISKSLLETSRKGYLSALSTSSYS
LVSLLAHFGPIMNPGGSSISLTYLAASRAVPGYGGGMSAAKAALESDTKMLAWEAGRKWG
IRVNTISAG-PLASRAGKAIG---------------------------------------
----FIEKMVDYYLDWSPIP-EPMTTEQVGAAAAFLVSSLASAITGETLYVDHGANIMGI
GPEMLPKNS---------
>gi|122921324|pdb|2O2S|A	   315 residues, 50 /line  Chain A, The Structure Of T. Gondii Enoyl Acyl Carrier Protein Reductase In Complex With Nad And Triclosan
------------------------------------------------------------
------------------------------------------------------------
--SAFPIDLRGQTAFVAGVADSHGYGWAIAKHLASAGARVALGTWPPVLGLFQKSLQSGR
LDEDRKLP---------DG--SL----IEF-----AGVYPLDAAFDKPEDVPQDIKDNKR
YAGVDGYTIKEVAVKVKQDLGNIDILVHSL--ANGPEVTKPLLETSRKGYLAASSNSAYS
FVSLLQHFGPIMNEGGSAVTLSYLAAERVVPGYGGGMSSAKAALESDTRTLAWEAGQKYG
VRVNAISAG-PLKSRAASAIGK--------------------------SGEK--------
---SFIDYAIDYSYNNAPLR-RDLHSDDVGGAALFLLSPLARAVSGVTLYVDNGLHAMGQ
AVDSRSMPPLQRATQEIN
>gi|50295340|gb|AAT73042.1|	   410 residues, 50 /line  enoyl-acyl carrier reductase [Eimeria tenella]
-------MTRFLVLGVFLMLLLEQQQGQLAAA-------FR----VGPGPEARGAELQQR
LRPTAAVPTASQQQQPVQQVAVVP-----RGVSSSSSSSTAAAAGPTGTAEPL-------
-SGPLPVDLRGKTAFVAGVADSNGYGWAICKLLRAAGARVLVGTWPPVYSIFKKGLESSR
FEQDSFYAQEPSSKVAAEA--AEKPVDLVF-----DKIYPLDAVFDTPQDVPPEVSSNKR
YAGVGGFTISEVAEAVRADVGQIDILVHSL--ANGPEVTKPLLQTSRKGYLAAVSSSSYS
FVSLLQHFLPLMKEGGSALALSYIASEKVIPGYGGGMSSAKAALESDCRTLAFEAGRARA
VRVNCISAG-PLKSRAASAIGK--------------------------AGDK--------
---TFIDLAIDYSEANAPLQ-KELESDDVGRAALFLLSPLARAVTGATLYVDNGLHAMGQ
ALDSKSLT---------P
>gi|46446786|ref|YP_008151.1|	   303 residues, 50 /line  enoyl-(acyl carrier protein) reductase [Candidatus Protochlamydia amoebophila UWE25]
------------------------------------------------------------
------------------------------------------------------------
----MQINLKGKKAFIAGVGDDQGFGWAIAKALAEAGAEIIIGTWTPILKIFTSSLQAGK
FDASRRLP---------NG--SL----LTF-----AKIYPLDASFDKPEDVPEEIRENKR
YKGVGGYTISEVCEAIGKDFGKIDIFVHSL--ANAPEVQKPLLETSRKGYLAALSSSSYS
FVSLLSHLGPYLNSQGSALTLTYLASEKIIPGYGGGMSSAKAALESDTRTLAWEAGRKWN
IRVNTISAG-PLRSRAARAIG---------------------------------------
----FIDRMINYSQVNAPLQ-EELKACEVANVAAFLGSDLACAITGSTIYVDYGLHAMGV
GMDSPTLKEAEQE----V
>gi|14422255|emb|CAC41366.1|	   385 residues, 50 /line  enoyl-[acyl-carrier protein] reductase [Brassica napus]
----------MAAT-AASSLQFATIRPSISSK-VV--KAGT----YIVGANPRNASWDK-
----LACTRHLSKHGCLRNNSSLP-----TSKKSF-SFSTKAMS--ESSENKA-------
-SSGLPIDLRGKRAFIAGIADDNGYGWAIAKSLAAAGAEILVGTWVPALNIFETSLRRGK
FDQSRVLP---------DG--SL----MEI-----KKVYPLDAVFDSPEDVPEDVKANKR
YAGSSNWTVQEAAECVRKDFGTIDILVHSL--ANGPEVSKPLLETSRKGYLAAISASSYS
FVSLLRHFLPIMNPGGASISLTYIASERIIPGYGGGMSSAKAALESDTRVLAFEAGRKQK
IRVNTISAG-PLGSRAAKAIG---------------------------------------
----FIDTMIEYSYNNAPVQ-KTLTADEVGNAAAFLVSPLASAITGATIYVDNGLNSMGV
AIDSPVFKDL-K------
>gi|14422259|emb|CAC41368.1|	   387 residues, 50 /line  enoyl-[acyl-carrier protein] reductase [Brassica napus]
----------MAATSAASSLQMATTRASISAA-SS--KART----CIVGANPRNASWDK-
----IACTPHLSNLGCLRNDSALP-----ASKKSF-SFSTKAMS--EFSESKA-------
-SSGLPIDLRGKRAFIAGIADDNGYGWAIAKSLAAAGAEILVGTWVPALNIFETSLRRGK
FDQSRVLP---------DG--SL----MEI-----KKVYPLDAVFDTPDDVPEDVKANKR
YAGSSNWTVQEAAECVRQDFGSIDILVHSL--ANGPEVSKPLLETTRKGYLAAISASSYS
FVSLLSHFLPIMNPGGASISLTYIASERIIPGYGGGMSSAKAALESDTRVLAFEAGRKQN
IRVNTISAG-PLGSRAAKAIG---------------------------------------
----FIDTMIEYSYNNAPIQ-KTLTADEVGNAAAFLVSPLASAITGATIYVDNGLNSMGV
ALDSPVFKDLNK------
>gi|14422261|emb|CAC41369.1|	   387 residues, 50 /line  enoyl-[acyl carrier-protein] reductase [Brassica napus]
----------MAATAAASSLQMATTRPSISAA-ST--KTRT----YVVGANPRNASWDK-
----IACTPHLSNLGCLRNDSALP-----ASKKSF-SFSTKAMS--ESSESKA-------
-SSGLPIDLRGKRAFIAGIADDNGYGWAIAKSLAAAGAEILVGTWVPALNIFETSLRRGK
FDQSRVLP---------DG--SL----MEI-----KKVYPLDAVFDNPEDVPEDVKANKR
YAGSSNWTVQEAAECVRQDFGSIDILVHSL--ANGPEVSKPLLETSRKGYLAAISASSYS
FVSLLSHFLPIMNPGGASISLTYIASERIIPGYGGGMSSAKAALESDTRVLAFEAGRKQN
IRVNTISAG-PLGSRAAKAIG---------------------------------------
----FIDTMIEYSYNNAPIQ-KTLTADEVGNAAAFLVSPLASAITGATIYVDNGLNSMGV
ALDSPVFKDLNK------
>gi|2204234|emb|CAA74177.1|	   393 residues, 50 /line  enoyl-ACP reductase [Nicotiana tabacum]
----------MAAT-AASSLQITIARPSIFST-KRISSVCS----IKFSANTRKQSWNR-
----LASSSCVSSIQDFWRNFTS------TSQKLE-KVVTKAKS--EADESKA-------
-ASGLPIDLKGKRAFIAGIADDNGYGWAIAKSLAAAGAEILVGTWVPALNIFETSLRRGK
FDESRILP---------DG--SL----MEI-----TKVYPLDAVFDSLEDVPEDIKANKR
YAGSSKWTVSEVAESVKEDFGSIDILVHSL--ANGPEVTKPLLETSRKGYLAAISASSYS
YVSLLKHFLPIMNPGGSSISLTYIASERIIPGYGGGMSSAKAALESDTRVLAFEAGRKKK
VRVNTISAGSPLRSRAAKAIG---------------------------------------
----FIDMMIEYSIANAPLQ-KELSADEVGNTAAFLASPLASAITGAVLYVDNGLNAMGV
GIDSPLFKDLNIPKNE-G
>gi|2204236|emb|CAA74176.1|	   392 residues, 50 /line  enoyl-ACP reductase [Nicotiana tabacum]
----------MAAS-AASSFQITIARPSIFST-KRISSVCS----TKFCADTRKQSWNR-
----LASSCQVSSTQNFWRNFTS------TSQKLE-KVVTKAKS--EADGSKA-------
-ASGLPIDLKGKRAFIAGIADDNGYGWAIAKSLAAAGAEILVGTWVPALNIFETSLRRGK
FDESRVLP---------DG--SL----MEI-----TKVYPLDAVFDSLEDVPEDIKSNKR
YAGSSKWTVSEAAESVKEDFGSIDILVHSL--ANGPEVTKPLLETTRKGYLAAISASSYS
YVSLLKHFLPIMNPGGSSISLTYIASERIIPGYGGGMSSAKAALESDTRVLAFEAGRKKK
VRVNTISAG-PLRSRAAKAIG---------------------------------------
----FIDMMIDYSIANAPLQ-KELSADEVGNTAAFLASPLASAITGAVIYVDNGLNAMGV
GIDSPLFKELNIPKSE-E
>gi|25989478|gb|AAL93621.1|	   393 residues, 50 /line  enoyl ACP reductase [Olea europaea subsp. europaea]
----------MAGT-TIPRAQIATPKPCISAA-RRIPSSSI----LCFGNDIKGISCAK-
----LQSSSFISSTKSFSKSFDL------NLLKCE-RNVIKAMS--GASDNQP-------
-LPGLPVDLRGKRAFIAGIADDNGYGWAIAKSLAAAGAEILVGTWVPAVNIFENSLRRGK
FDESRVLP---------DG--SL----MEI-----TKVYPLDAVYHSPEDVPEDVKTNKR
YMGSSNWTVKEVAELVKQDFGTIDILVHSL--ANGPEVIKPLLETSRYGYLAAISASSYS
FVSLLKHFVPIMNPGGTTISLTYIASERIIPGYGGGMSSAKAALESDTQVLAFEAGRKHK
IRVNTISAG-PLRSRAAKAIG---------------------------------------
----FIDMMIDYSLENAPLQ-KELTAEEVGNAAAFLASPLASAITGAVVYVDNGLNAMGV
GVDSPVFRDLDIPKADRS
>gi|2653290|emb|CAA05879.1|	   392 residues, 50 /line  enoyl-ACP reductase [Petunia x hybrida]
----------MAAN-GLLACKLEPPNNAFPHH-TTFQKLSN----ISFGFESKRKSVTD-
----FRSASYISLTKQI-HSSNL------APIKFE-RMVTKAMS--GASENVP-------
-VSGLPIDLQGKRAFIAGIADDNGYGWAIAKSLAAAGAEILVGTWVPALNIFETSLRRGK
FDESRVLP---------DG--SL----MEI-----AKVYPLDAVFDSPEDVPEDVKSNKR
YAGSSNWTVKEVAESVKQDFGTIDILVHSL--ANGPEVSKLLSETSRKGYLAAISASSYS
FISLLRHFLPIINPGGATISLTYIASERIIPGYGGGMSSAKAALESDTKVLAFEAGRKHK
VRVNTISAG-PLASRAAKAIG---------------------------------------
----FIDMMINYSLENAPLQ-KELYAEEVGNTAAFLASPLASAITGATVYVDNGLNAMGV
GVDTPSFRGLDIPKDNKS
>gi|13676783|gb|AAK38274.1|	   432 residues, 50 /line  enoyl-ACP reductase [Plasmodium falciparum]
-MNKISQ------RLLFLFLHFYTTVCFIQNN-TQKTFHNVLQNEQIRGKEKAFY-----
----RKEKREN-----IFIGNKMKHVH---NMNNTHNNNHYMEK--EEQDASN-------
INKIKEENKNEDICFIAGIGDTNGYGWGIAKELSKRNVKIIFGIWPPVYNIFMKNYKNGK
FDNDMIID---------KD--KK----MNI-----LDMLPFDASFDTANDIDEETKNNKR
YNMLQNYTIEDVANLIHQKYGKINMLVHSL--ANAKEVQKDLLNTSRKGYLDALSKSSYS
LISLCKYFVNIMKPQSSIISLTYHASQKVVPGYGGGMSSAKAALESDTRVLAYHLGRNYN
IRINTISAG-PLKSRAATAINKLNNTYENNTNQNKNRNRHDVHNIMNNSGEKEEKKISAS
QNYTFIDYAIEYSEKYAPLR-QKLLSTDIGSVASFLLSRESRAITGQTIYVDNGLNIMFL
PDDIYRNEN--------E
>gi|148805040|gb|EDL46439.1|	   403 residues, 50 /line  enoyl-acyl carrier protein reductase [Plasmodium vivax]
-----MM------MHVRRVVQLATLLLYIASV-SAMLRS------ALKGGGQPKWEIER-
----RGNSREM----QFITSKAIKGVAHKRKISQHSSPAEHMVS--EQSGQAE-------
-GINGKGEPLGDICFIAGVGDTNGYGWGIAKELSKKNVKIILGVWPPVYNIFMKNLQSGK
FDSDMIIG---------EG--KK----MEL-----LDILPFDAAFDSASDVDEETRKNKR
YASLDSYSIEEVANLVYKKYGKINMLVHSL--ANGREVERSLLETSRGGYLDALSKSSYS
LIALCKHFCKIMHPQSSVISLSYYASQKVVPGYGGGMSSAKAALESDTRTLAYHLGRKHK
IRVNTISAG-PLKSRAATAIKKATPQSGGN------------------EGEK--------
KNLAFIDYAIDYSEKYAPLQ-QKLYSTDVGAVAAFLLSKESRAVTGQTIYVDNGLNIMFG
PDDLFQGGA--------A
>gi|37695600|gb|AAR00332.1|	   396 residues, 50 /line  enoyl-acyl carrier protein reductase [Plasmodium berghei]
MYKKLIV------FLTILIFNYLKITCFTNNGYEKKTFSSLRMNKE--------------
---------------NYWKNKIL------RKKKNENNLRINVES--NQNDKIDNIK----
----NKNENENEICFIAGVGDSNGYGWGIAKELSKRNVKVIFGVWPPVYNIFIKNLESGK
FDKDMIIN---------NDNSKR----MQI-----LDVLPLDAGFDNYDDIDEDTKNNKR
YNNLKNYSIEEVANLIYNKYGKISMLVHSL--ANGREVQKSLLDTSRDGYLDAISKSSYS
LISLCKHFCKFMNSGGSVVSLTYQASQKVVPGYGGGMSSAKAALESDTRVLAYYLGRKYN
IRINTISAG-PLKSRAATAINKFNNNQKNN---------------MNSSGETDK------
QNYSFIDYAIDYSEKYAPLK-KKLLSTDVGSVASFLLSKESSAVTGQTIYVDNGLNIMFG
PDDLFQSSD--------S
>gi|70951952|ref|XP_745177.1|	   356 residues, 50 /line  enoyl-acyl carrier reductase [Plasmodium chabaudi chabaudi]
------------------------------------------MNNQ--------------
---------------NYWKNKIL------RKIKNENNLRINVES--NQSDKIEDIK----
--------NENEICFIAGVGDSNGYGWGIAKELSKRNVKVIFGVWPPVYNIFIKNLESGK
FDKDMIID---------NDNSKR----MEI-----LDVLPFDAAFDNYDDIDEDTKNNKR
YNNLKNYSIEETANLVYNKYGKISMLVHSL--ANGREVQKNLLDTSRDGYLDAISKSSYS
LISLCKHFCKYMNPGGSIVSLTYLASQKVVPGYGGGMSSAKAALESDTRVLAYHLGRKYN
IRINTISAG-PLKSRAATAINKFNDNQKNN---------------MNSSGENDK------
QNYSFIDYAIDYSEKYAPLR-KKLLSTDVGSVASFLLSKDSSAVTGQTIYVDNGLNIMFG
PDDLFQSVD--------S
>gi|82539314|ref|XP_724054.1|	   404 residues, 50 /line  enoyl-acyl carrier reductase [Plasmodium yoelii yoelii str. 17XNL]
MYKKVIL------FLIISIFNYLKITCFTNTGYEKKTFPSLRMNKE--------------
---------------NYWKNKIL------RKNKNENNLRINVGS--SQNDIIENIKNGSE
NGSVSGSESGSEICFIAGVGDSNGYGWGIAKELSKRNVKVIFGVWPPVYNIFIKNLESGK
FDKDMIIN---------NDNLKR----MEI-----LDVLPLDAGFDNYDDIDEDTKNNKR
YNNLKNYSIEEVANLIYNKYGKISMLVHSL--ANGREVQKSLLDTSRDGYLDAISKSSYS
LISLCKHFCKFMNPGGSIVSLTYQASQKVVPGYGGGMSSAKAALESDTRVLAYYLGRKYN
IRINTISAG-PLKSRAATAINKFNNNQKNN---------------MNSSGENDK------
QNYSFIDYAIDYSEKYAPLK-KKLLSTDVGSVASFLLSKESSAVTGQTIYVDNGLNIMFG
PDDLFQASD--------S
>gi|37695602|gb|AAR00333.1|	   413 residues, 50 /line  enoyl-acyl carrier protein reductase [Plasmodium knowlesi]
-MEKIYSGGSRGRMHTGRLVHLAALLLWTAAV-SGILRN------GTKGGVQPKWAIEK-
----RGNSREM----QFMVSKVIKGVAQNRKISQHLSHSEKMLS--EQNGQGE-------
-ETNKKGETLGDICFIAGVGDTNGYGWGIAKELSKKNVKVILGVWPPVYNIFMKNLHNGK
FDNDMEIG---------EG--RK----MDL-----LDILPFDAAFDSFNDIDEETRKNKR
YANLESYSIEEVANLIYKKYGKINMLVHSL--ANGREVEKSLLDTSRNGYLDALSKSSYS
LIALCKCFCPIMHPQSSVISLTYYASQKVVPGYGGSMSSAKAALESDTRTLAYHLGRKHK
IRINTISAG-PLKSRAATAIKKANPQSGEN--------------------ETEK------
KNLAFIDYAIEYSEKYAPLQ-QKLYSTDVGAVAAFLLSKESRAVTGQTIYVDNGLNIMFG
PDDLFQDKG--------A
>gi|32476624|ref|NP_869618.1|	   299 residues, 50 /line  enoyl-[acyl-carrier-protein] reductase [NADH] [Rhodopirellula baltica SH 1]
-MSVLETAAMMFT-----------------------------------------------
-------------------------------------------A--GQSNRTKPKR----
----LKMQFEGKKGLIIGVANDHSIAWAIAQEILKQGGKCGFTHLP------------DR
ADDEKQRN---------RRRVAK----LTDPEDGAEFLLPMDANND--D-----------
-------DIRTIFEHTEKTFGKIDFLLHSIAFADRDDLGRETMHTSRSGFKLAMESSVFS
LLAVTAAAEPIMNPGGSVLTMTYYGGEKCVPGYNV-MGVCKAALDASMRYLAFDMGAR-G
VRVNALSAG-PIRTLAGRAAG---------------------------------------
-----VEEMLTMYEHMAPMG-RNVTHEEVGKSGAFLLSDASSGISGEILHVDGGYHAMGS
PGRLLDEIK-----KQTK


Ad blocker interference detected!


Wikia is a free-to-use site that makes money from advertising. We have a modified experience for viewers using ad blockers

Wikia is not accessible if you’ve made further modifications. Remove the custom ad blocker rule(s) and the page will load as expected.