Fandom

Proteins Wiki

At2g05710.1/MSA

< At2g05710.1

47,922pages on
this wiki
Add New Page
Talk0 Share
>gi|30678219|ref|NP_178634.2|	   990 residues, 50 /line  aconitate hydratase, cytoplasmic, putative / citrate hydro-lyase/aconitase, putative [Arabidopsis thaliana]
---MYLT--ASSSASSSI------------------------------------------
------IRAASSRSSSL----------------FSFRSVLSPSVSSTSPSSLLARRSFGT
ISPAFRRWSHSFHSKPSPFRFTSQIRAVSPVLDRLQR-TFSSMASEH----PFKGIF-TT
LPK-PG-GG-EFGKFYSLPALND-------------------------------------
------------------------------------------PRVDKLPYSIRILLESAI
RNCDN--FQVTKEDVEKIIDWE-KTSPKQVEIPFKPARVLLQDFTGVPAVVDLACMRDAM
NKLGSDSNKINPLVPVDLVIDHSVQVDVARS-ENAVQANMELEFQRNKERFAFLKWGSTA
FQNMLVVPPGSGIVHQVNLEYLGRVVFNTK---------------GLLYPDSVVGTDSHT
TMIDGLGVAGWGVGGIEAEATMLGQPMSMVLPGVVGFKLAGKMRNGVTATDLVLTVTQML
RK-H-GVVGKFVEFYGNGMSGLSLADRATIANMSPEYGATMGFFPVDHVTLQYLKLTGRS
DETVAMIEAYLRANNMFVDYNEPQQDRVYSS-YLELNLDDVEPCISGPKRPHDRVTLKEM
KADWHSCLDSKVGF---------------------------------------KGF----
-------AIPKEA---QE-KVV--NFSF---DGQPAELKHGSVVIAAITSCTNTSNPSVM
LGAGLVAKKACDLGLQVKPWIKTSLAPGSGVVTKYLLKSGLQEYLNEQGFNIVGYGCTTC
IGNSGEINESVGAAITENDIVAAAVLSGNRNFEGRVHPLTRANYLASPPLVVAYALAGTV
NIDFETEPIGK-GKNGKDVFLRDIWPTTEEIAEVVQSSVLPDMFRATYESITKGNPMWNK
LSVP-ENTLYSWDPNSTYIHEPPYFKDMTMDP-P-GPHNVKDAYCLLNFGDSITTDHISP
AGNIQKDSPAAKFLMERGVDRKDFNSYGSRRGNDEIMARGTFANIRIVNKLMNGE-----
VGPKTVH-------I----PS--------GEKLSVFDAAMRYKSSGEDTIILAGAEYGSG
SSRDWAAKGPMLQGVKAVIAKSFERIHRSNLVGMGIIPLCFK-SGEDADTLGLTGHERYT
IHLPTD--ISEIRPGQDVT--VTTDNG--KSFTCTVRFDTEVELAYFNHGGILPYVIRNL
SKQ------
>gi|114320610|ref|YP_742293.1|	   914 residues, 50 /line  aconitate hydratase 1 [Alkalilimnicola ehrlichei MLHE-1]
------------------------------------------------------------
------------------------------------------------------------
----------------------------------------------------MSDSF-NA
RGTLEVG-G-RSYEIFHFDGLRKH------------------------------------
------------------------------------------FDIDRLPYSLKVLMENLL
RKEDG--VNVTREHIEALANWD-PKSKPKDQIGFTPARVVLQDFTGVPAVVDLAAMRDAM
KSMGRDPNLINPLSPVDLVIDHSVMVDHFGS-PEALGLNTKIEFQRNGERYEFLRWGQKA
FSNFRVVPPGTGIVHQVNLEYLGQVVFTREE-D---G------V-LRAYPDTLVGTDSHT
TMINGLGVLGWGVGGIEAEAAMLGQPISMLIPEVVGVRLTGKLAEGATATDLVLTVTEML
RK-H-GVVGKFVEFFGDGLDHLPLADRATIGNMAPEYGATCGIFPIDRETLNYLELSGRD
AEQIELVEAYAKRVGLWRETGAR--EAEYSA-VLDLDLSSVVPSIAGPKRPQDRIPLDRA
KVAFLDTLDQYLEQHHSAP-------------------ANKD-EERFEGEGGHAAP----
-------GVDDAH---EK-GAV--EYEM---DGEKHLLKHGSVVIAAITSCTNTSNPAVL
LAAGLVAKKAAEKGLKPKPWVKTSLAPGSQVVPAYLERAGLLKPLEALGFHVVGFGCTTC
IGNAGPLPEPIQNAVREGDLCVSSVLSGNRNFEGRIHGDVRTNYLASPPLVVAYALAGNM
AVDLYKEPLGH-DQDGNPVYLKDVWPSQQEVAELAQKHITSQIYRDKYADVFKGDETWQA
IKVT-GGELYDWQP-STYVKNPPYFEGMAAEA-Q-GSAAIEDARCLVYVGDSITTDHISP
AGAIHPESPAGHYLREQGVEPKDFNSYGSRRGNHEIMMRGTFANVRLRNKMAPGT-----
EGGWTTH-------V----PS--------GEQMFIYDAAMKYRQEGTPLVVLAGKEYGTG
SSRDWAAKGTNLLGIRAVIAESFERIHRSNLVGFGVLPLQFK-EGDSAEGLGLTGQEAFS
ISSLEG----D---PETVEVKAEGANGTT-TFEALVRIDTPKEWDYFRNGGILHYVLRQL
AAKAA----
>gi|149377906|ref|ZP_01895634.1|	   919 residues, 50 /line  aconitate hydratase 1 [Marinobacter algicola DG893]
----MSK-----------------------------------------------------
------------------------------------------------------------
-------------------------------------------------QSLSKDSL-NT
LSSLEAG-G-KTYHYYSLPKAADT-L----------------------------------
------------------------------------------GNIDKLPFSLKVLLENLL
RNEDD--ATVGRGHIDAMVQWM-KDRKSDTEIQFRPARVLMQDFTGVPGVVDLAAMREAV
KAAGKDPAMINPLSPVDLVIDHSVMVDKYGD-PSAFKDNVTIEMERNQERYEFLRWGQQA
FDNFRVVPPGTGICHQVNLEYLGKTVWSKDQ-D---G------K-TIAYPDTLVGTDSHT
TMINGLGILGWGVGGIEAEAAMLGQPVSMLIPEVVGFKITGKLREGITATDLVLTVTEML
RK-K-GVVGKFVEFYGDGLKDMPVADRATIANMAPEYGATCGFFPVDEQTIKYMQLTGRE
DDQLELVEAYAKAQGLWRQPG-Q--EPVYTD-NLELDMGEVEASLAGPKRPQDRVALKNM
KASFELLMETAEGPAES------------------------R-EDKLESEGGQTAV----
-------GVQDSY---EH-AASQ-PMEM---NGEKTRLDPGAVVIAAITSCTNTSNPSVM
MAAGLIAQKAVARGLNTKPWVKTSLAPGSKVVTDYLKVGGFQDDLNKLGFNLVGYGCTTC
IGNSGPLPDAVEKAIADGDLTVASVLSGNRNFEGRVHPLVKTNWLASPPLVVAYALAGNV
RLDLSNDPLGD-DKDGKPVYLKDLWPSQQEIAEAVE-KVKTSMFHKEYAEVFDGDATWKA
IKVP-ESKVYEWSDNSTYIQHPPFFQGLKEEP-D-AINDIKDANILALLGDSVTTDHISP
AGSFKADSPAGKYLQERGVEPKDFNSYGSRRGNHEVMMRGTFANVRIRNEMLDGV-----
EGGFTKH-------I----PS--------GEQMPIYDAAMKYQEEDTPLVVIAGKEYGTG
SSRDWAAKGTRLLGVKAVVAESYERIHRSNLIGMGVMPLQFR-DGVDRKSLKLTGEETIS
IKGLSG----DIKPGQTLEMTVTYPDGKTETCELLSRIDTANEAVYYRHGGILHYVVREM
LKSA-----
>gi|72162324|ref|YP_289981.1|	   916 residues, 50 /line  aconitate hydratase [Thermobifida fusca YX]
------------------------------------------------------------
------------------------------------------------------------
---------------------------------------------------MSANSF-GS
RDTLRVG-D-ESYEIFRLDAI---------------------------------------
------------------------------------------DGVQRLPYSLKVLLENLL
RTEDG--VNVTADHIRALANWD-SKAQPSQEIQFSPARVIMQDFTGVPCVVDLATMREAV
RDLGGDPTKINPLAPAELVIDHSVIVDVFGR-PDAFERNVEMEYERNRERYQFLRWGQNA
FEGFKVVPPGTGIVHQANIEHLARVTMVRN---------------GQAYPDTCVGTDSHT
TMQNGLGILGWGVGGIEAEAAMLGQPISMLIPRVVGFKLTGELPPGTTATDLVLTITEML
RE-H-GVVGKFVEFYGEGVASVPLANRATIGNMSPEFGSTAAMFPIDDETIRYLKLTGRS
DEQTALVEAYTKEQGLWHDPS-V--EPEYSE-YLELDLSEVVPSIAGPKRPHDRIALSDA
KTAWRRDVRDHVNNDGIVT----------------------R-ADEASAESFPASDAPAI
SSN----GVVTER---PR-KPVKVTL-G---DGTEFTIDHGSVVIAAITSCTNTSNPSVM
LGAALLAKKAVEKGLSRKPWVKTSLAPGSKVVTDYYERSGLTPYLDKLGFNLVGYGCTTC
IGNSGPLPEEISKAINDNDLAVAAVLSGNRNFEGRINPDVKMNYLASPPLVVAYALAGTM
DIDFDTEPLGT-DTDGNPVYLRDIWPSPEEIQEVIDSAIAAEMYQRAYSDVFAGDERWRS
LPTP-TGDTFSWDPNSTYVRKPPYFDGMPLEP-E-PVSDIVGARVLAKLGDSVTTDHISP
AGAIKPGTPAAEYLMANGVERKDFNSYGSRRGNHEVMIRGTFANIRLRNQIAPGT-----
EGGYTRDFT-----Q----EG--------GPVTFIYDAAQNYAAQNIPLVVLGGKEYGSG
SSRDWAAKGTRLLGVRAVIAESFERIHRSNLIGMGVLPLQFP-EGQSADSLGLTGEETFS
ITGVT-----ELNEGR-IPETVKVTTDTGVEFDAVVRIDTPGEADYYRHGGILQYVLRQL
INKK-----
>gi|82702004|ref|YP_411570.1|	   946 residues, 50 /line  aconitate hydratase 1 [Nitrosospira multiformis ATCC 25196]
------------------------------------------------------------
------------------------------------------------------------
---------------------------------------------------MAHNLF-NT
LKELSLPTG-KKAKYYSLPALEAAGL----------------------------------
------------------------------------------GRISRLPVSIRIVLESVL
RNCDN--RKVTEAHIKRLADWQ-PTAPRLDEIPFVVSRIVLQDFTGVPLLVDLAAMRSTA
KKMGKDPEMVEPLVSVDLVVDHSVQVDYYGT-DDALKLNMEMEFHRNRERYQFIKWGMQA
FDTFKVVPPGIGIVHQVNLEYLARGVHEKE---------------GILYPDTLVGTDSHT
TMINGIGVVGWGVGGIEAEAGMLGQPVYFLTPDVVGVNLTGKLSTGVTATDLVLTVTELL
RK-S-GVVGKFVEFFGEGTASLTVPDRATIGNMAPEYGATMGFFPVDDATVEYFRGTGRS
EEEVAAFQSYFKAQELYGVPRKG--EIDYTR-ELELDLSTVKPSLAGPRRPQDRIELDDV
KTRFTELFSRPVMQGGYGRDAAALKLRYKVHGSEEPGPAAAA-ADSASADRNTAAVRPGT
ERNIT--EMVNNR---PILAPAEAPVYG---ANDLFDLAHADILIAAITSCTNTSNPSVL
LAAGLLAKKAVEKGLSVKCHIKTSLAPGSRVVTEYLRETGLLPYLDKLGFNLAGYGCTTC
IGNSGPLSVPIEETVVSNDLVCAAVLSGNRNFEARIHPNIRANFLASPPLVVAYALAGTM
LKDLTAEPLGY-GENGQPVWLADIWPRDDEIQSLMKFAANGETFRRLYSNLTQDHPLWND
ISSV-SGEVYDWP-KSTYIAEPPFFQDFSLQP-R-PYNEIRNARALAIFGDSVTTDHISP
AGSIKDTSPAGKYLLASGVSRSDFNSYGARRGNHEVMMRGTFANVRIKNLMIPGS-----
EGGITLH-------Q----PD--------GEQMSIYDAAMRYIAEGIPTVIFGGEEYGSG
SSRDWAAKGTQLLGVKAVIAKSFERIHRSNLIGMGVLPLQFK-GDDSVESLGIQGNEAFD
IEGLS-----SIRPQQDVTLVVRDNTGSRREIDLLCRIDTGIEIDYYRHGGILPYVLREL
MKA------
>gi|83814227|ref|YP_445978.1|	   910 residues, 50 /line  aconitate hydratase 1 [Salinibacter ruber DSM 13855]
---MSAP-----------------------------------------------------
------------------------------------------------------------
-------------------------------------------------ADLAPDPF-DA
LDTFATG-H-GRAYLYRLSALDGV------------------------------------
-------------------------------------------DLDRLPVSIRVLLEGLL
RECDG--DLVTEEHVRRLAQYD-PAAPTEAAVPFTPSRVLLQDFTGVPSVVDLAALRSAM
DRFGAAPDGISPEVPVHLIIDHSVQVDHFGL-PNAVQLNSELEFRRNQERYKFLKWGQQA
FDDFRVVPPASGICHQVNLEYVGRGVWTRDTAD---G------T-PLAYPDTLVGTDSHT
TMINGLGVLGWDVGGIDAEAALLGQPLYMLMPEVVGVELTGELSEGATATDLVLTITQML
RE-Y-GVVGRFVEFFGAGLRTLTVPDRATIANMSPEYGATMGFFPIDGETLDYMRRTNRS
EEQVDLVERYTKEQGLFHTPDTP--APDFLD-VLELDLGDVTPSVAGPKRPQDRIRVPEL
PDAFADSLTAPSGPTGFGLDADDLGA----------------------------------
----------------------TGTYDD---GTHTLDLTHGDVVIAAITSCTNTSNPSVM
LGAGLLARNAVEAGLTVPPYIKTSLAPGSKVVTDYLQESDLLPFLQELGFATVGYGCTTC
IGNSGPLPDPVEDAIEEGDLIVSGVLSGNRNFEGRIHPLVQANYLGSPPLVVAYALAGTV
DIDLTTDPIGE-TADGDEVYLRDLWPSSEAVKRLVDTAVKPDFFAAEYEGIEDANETWNE
IEIP-EGAVYDWEEDSTYIKEPPFFVDLTPEV-P-PVDSIEDARVLVKVRDSTTTDHISP
AGAIPPDSPAGTYLIEQGVEPRQFNSYGARRGNHEVMMRGTFANIRIKNELVPGT-----
EGGVTKNF------L----RD--------GEVTSVYEAAMDYQAHDVPLVVLAGEDYGMG
SSRDWAAKGTDLLGVEAVLAASYERIHRSNLIGMGVLPLQFA-DGADADSLGLDGTETFD
IPLDD-----DLAPGQEIAVTATAEDGTATTFPTIARCDTPVEVRYYRHGGILHYVLRET
LREAPVT-A
>gi|114778400|ref|ZP_01453247.1|	   929 residues, 50 /line  aconitate hydratase [Mariprofundus ferrooxydans PV-1]
---MICKALFSDSV---FLSACRD---IVSHLW---IITDVSAI------------FADI
F-----------------------------------------------------------
----------------------------------------------HNIGAAMNNSF-GA
KTSLSVG-D-KTYTYYALKAA---------------------------------------
------------------------------------------GDIDRLPYAMKILLENML
RREDG--VNVTADDINFLAKWD-EKAEPNHEIAYMPARVLMQDFTGVPAVVDLAAMRDAV
AALGGDTAKIEPLAPAELVIDHSVQVDTFGT-ADAATKNTGIEFQRNRERYNFLKWGQNA
FETFKAVPPGTGIVHQVNLEFLARTVFVNNE--------------GVAYPDTLVGTDSHT
TMINGLGVLGWGVGGIEAEAAMLGQPVSMLVPKVVGFKLTGELPEGATATDLVLTIVEML
RK-H-GVVGKFVEFYGSGLDSLPLADRATIANMAPEYGATCGIFPIDDETLNYLRLSNRS
AENVALVEAYAKAQGMFRDADSP--EAIYSE-YVALDMSTVVPSLAGHKRPQDRIALTES
KAKYQQAVETVKAEAG------------------------------------ITT-----
-------------------HAV--NTTI---NGENVTIDDGAVVIAAITSCTNTSNPSVM
VAAGLVAKKAAALGLSAAPWVKTSLGPGSLVVTEYLDKAGLSPELDKLGFNTVGYGCTTC
IGNSGPLPAAVSAAIAEGNLAVTSVLSGNRNFEGRVHAEVRMNYLASPPLVVAYAIAGTM
NIDLYNDPIGQ-DANGKDLFLRDIWPTQKEVADTVASCVTAEQFEAAYGNVYAGDANWQN
LQAP-SGDRFAWDNDSTYIQHPPYFEGMSFEL-D-PVTDIKGARVLALLGDSVTTDHISP
AGAIKADSPAGRYLQERGVEAKDFNSYGSRRGNHQIMMRGTFANIRLRNRLAPGT-----
EGGVTLH-------Q----PS--------NTLMSIYDAAMQYIDEGVASIILAGKEYGSG
SSRDWAAKGPRLQGVQAVIAETYERIHRSNLVGMGILPLQFK-AGESAESLGLTGQESYD
FSGIG-----DG-SAKELHVTATATDGSVKSFTVDVRIDTPKEVEYYQHGGILHYVLRQL
AAEKA----
>gi|71066615|ref|YP_265342.1|	   939 residues, 50 /line  aconitate hydratase [Psychrobacter arcticus 273-4]
------------------------------------------------------------
------------------------------------------------------------
----------------------------------------------------MSDIF-NV
KDTIAVD-G-KEYAYYSLPKLTETH-----------------------------------
------------------------------------------ENISKLPFCMKVVLENLL
RNEDD-GQSVGKNHIEAVANWD-AGAEASKEIAFMPARVVLQDFTGVPSVVDLAAMRDAV
VELGGNAEQINPFIPSELVVDHSVQVDAYGR-EDALDLNEKIEFKRNNERYEFLHWGRNA
FKNFVVVPPATGIVHQVNLEYLARVVMAADVDN---G--DGV-E-LTAYPDTVFGTDSHT
TMINGIGVLGWGVGGIEAEAAMLGQPSSMLIPQVVGFELKGKLTEGVTATDLVLRVVEML
RA-H-GVVGKFVEFYGEGLHSMPLADRATIANMSPEYGATCGIFPIDQMAIDYLRLSGRD
EAQIELVEKYAKAQGLWHDADTP--AATYSS-KLELDLSSVQPALAGPNLPQQRINLSDM
HKKFGETLTAMTKDRKS-----------------------EV-EGKVRFDQEG-GEQEQA
KTLAAKPNPFCA----EG-STYC-TVKI---EDEEYSLRDGSVVIAAITSCTNTSNPAVM
IGAGLVAKKAAAKGLTAKPWVKTSLAPGSKVVTDYLEKAKLMDELEKIGFYLVGYGCTTC
IGNSGPLLGAIEGAIEEGDLVAAAVLSGNRNFEGRIHSHVKASYLASPPLVVAYALAGTV
DIDLTTHPLGQ-DQEGNDVYLKDIWPTSDEINELIANNIDADMFRKNYGEVFDGSAAWNA
ISSA-DSQLYPWSEESTYIKNPPFFDGMTMEP-E-GIPDIEGARILGLFGDSITTDHISP
AGNIDADSPAGKYLQERGVMEADFNSYGSRRGNDAVMTRGTFANIRIKNTMMGGK-----
EGGYTYYFNGDSATL----QD--------GEEMAIYDAAMKYKEDKRPLVVLGGAEYGSG
SSRDWAAKGTILLGVKAVLTSSFERIHRSNLVGMGVLPLTFK-AGENAATYNLDGSEVLS
ITGLDN----GES--KTAKVTATRADGSTESFDVNVMLQTPKEREYVRHGGVLHYVLRQL
AADSKNA-A
>gi|84687402|ref|ZP_01015280.1|	   932 residues, 50 /line  aconitate hydratase [Rhodobacterales bacterium HTCC2654]
---------------------MPP---FEGHRV---VQREEPDM----------------
------------------------------------------------------------
------------------------------------------------PIEVGKDTS-KT
RKTLSAG-G-STVAYYSIPAAEEAGL----------------------------------
------------------------------------------GTFSKLPASLKVVLENML
RFEDG-GRTVSTDDIKAFSEWADKGGQNPREIAYRPARVLMQDFTGVPAVVDLAAMRDGI
KALGGDAEKINPLVPVDLVIDHSVMIDEFGN-PRAFQMNVDREYERNMERYQFLKWGQTA
FENFRVVPPGTGICHQVNLEYLAQTVWTDKDQN---G------E-EVAYPDTLVGTDSHT
TMINGVAVLGWGVGGIEAEAAMLGQPISMLIPEVVGFKLTGAMVEGTTGTDLVLKVVEML
RK-H-GVVGKFVEFYGDGLDNLPLAQRATIANMAPEYGATCGFFPIDGETLRYLEQTGRD
KDRIELVEAYAKENGLWRDADY---DPVYTS-TLHLDMGDIVPAISGPKRPQDYVALDQA
AGAFDNVVADYRGVDMS-----------------------DD-AQDMAAEGPI-AT----
-----KPAV-----------YAK-SGKV---EGEDYELKDGSVVIASITSCTNTSNPYVM
IGAGLVARKANELGLNRKPWVKTSLAPGSQVVTEYLEAAGLQDDLDAIGFDLVGYGCTTC
IGNSGPLQPEISKSIADNDLIAVSVLSGNRNFEGRISPDVRANYLASPPLVVAYALAGDM
NIDMANDPIAQ-TPDGKDVYLKDLWPSDAEIAELVEKVVTREAFQEKYADVFKGDEKWQA
VEVS-GGETYDWPPQSTYIQNPPYFQGMSKDP-G-TIADIKDARVLALLGDMITTDHISP
AGSFKAESPAGKYLTERQVAPRDFNSYGSRRGNHEVMMRGTFANIRIKNEMLDGV-----
EGGYTKG------------PD--------GEQTSIYDASMAYQEDGTPLVVVGGIEYGAG
SSRDWAAKGTNLLGVKAVIAESFERIHRSNLVGMGVVPFEFT-GGDTRKTLNLTGEETFT
ITGLSE----DLKPLAVLPCTITYPDGTTKDIELKCRIDTEVEIDYVANGGVLHYVLRNL
AKS------
>gi|94491672|ref|ZP_01298882.1|	   917 residues, 50 /line  hypothetical protein CburD_01001064 [Coxiella burnetii Dugway 7E9-12]
---------------------MAG---CGLTDF---CRTFECVK-------------LQP
K-----------------------------------------------------------
----------------------------------------------IGCEVTMADSL-KT
RRELTAG-G-KTYHYHSLKAAEDAGL----------------------------------
------------------------------------------SNIHRLPYSLKILLENQL
RHEDG--ETVAQTHIEAFAHWL-KDKHSDREIAYRPARVLMQDFTGVPAVVDLAAMRDAM
ARMKGDPTKINPHCPVDLIIDHSVQVDEFGN-EEAFRDNVRIEMERNHERYTFLKWGQQA
FRHFQLVPPGTGICHQVNLEYLGRGVWSSQQ-D---G------E-WLAYPDTLVGTDSHT
TMINGLGVLGWGVGGIEAEAAMLGQPISMLIPEVIGFYLSGQLREGITATDLVLTVTQML
RQ-K-GVVGKFVEFYGPGLAELPLADRATIGNMAPEYGATCGLFPIDAETIKYLELTGRD
AEAIELVKAYSKAQGTWHDENTP--EPIFSD-TLSLDLSTVEPSLAGPKRPQDRVPLAKL
KKTIEGVIATAERDQEL-----------------------DH------------------
--------SFQS----T----------------GDFDLHHGDVVIAAITSCTNTSNPSVM
LAAGLLAKNAVEKGLQRKPWVKSSLAPGSKVVTDYLHKTGLIDYLEKIGFYLVGYGCTTC
IGNSGPLPETVAKTVTENDLIVSSVLSGNRNFEGRIHPLVKTNWLASPPLVVAFALAGTT
RIDLTKDPLGH-NDRGEPIFLNDIWPSNAEIAKTVMQ-VRNDMFRKEYADVFEGDEEWQR
IHVS-AGDTFSWQTNSTYVKNPPFFENMSAKP-E-PLKNIIDARILAILGDSVTTDHISP
AGAIKADSPAGKYLIEHGIDIKDFNSYGSRRGNHEVLMRGTFANIRIRNEMLSKV-----
EGGFTKH-------F----PD--------GEQLPIYDAAMKYHSENIPLVVIAGKEYGTG
SSRDWAAKGPRLLGVKAVVAESFERIHRSNLVGMGVLPLEFK-NDDNRHSLKLEGNEVID
ITGLEN----DLQPGGDVIMTVKRKDGTIEKIPLHCRIDTQNELAYYQHGGILQFVLRQM
LRSS-----
>gi|92115078|ref|YP_575006.1|	   910 residues, 50 /line  aconitate hydratase 1 [Chromohalobacter salexigens DSM 3043]
------------------------------------------------------------
------------------------------------------------------------
---------------------------------------------------MSEAPQ-NT
LSTLDVG-D-RTYHYYSLDKAAQA-F----------------------------------
------------------------------------------GDASRLPMTLKVLLENQL
RYSDD--ESVSPEDMQALVDWQ-KEARSTREIGYRPARVLMQDFTGVPGVVDLAAMRDAV
KRLGESADRINPLSPVDLVIDHSVMVDHFGD-PSSFKDNVAIEMERNRERYEFLRWGQQA
FDNFRVVPPGTGICHQVNLEYLGKTVWTKEE-D---G------K-TFAYPDTLVGTDSHT
TMINGLGVLGWGVGGIEAEAAMLGQPVSMLIPEVVGFKLTGKLREGITATDLVLTVTQML
RQ-K-GVVGKFVEFYGDGLKDLPLADRATIGNMAPEYGATCGFFPVDEETLNYMRLTGRD
EHQIALVEAYTKAQGLWREPGA---EPIFSD-TLHLDMGEVESSLAGPKRPQDRVALTDM
KSTFEKILEDRKPDAAP-----------------------TE-QGKWLSEGGQ-------
----TAVGNEEGA---ES-GDSQ-ACEI---DGENFQLDHGAVVIAAITSCTNTSNPSVM
LAAGLLAQKAVEKGLTTKPWVKTSLAPGSKVVTDYLDASGTQNDLNELGFNLVGYGCTTC
IGNSGPLPEAIEKAIDDGDLTVASVLSGNRNFEGRIHPLVPTNWLASPPLVVAYALAGNM
RIDLSKDPLGN-DRDGNPVYLKDIWPSQAEIATAVE-QVRTEMYRKEYGEVFEGDEIWKS
LEVP-ESDVYAWNKNSTYIQHPPFFEGMGKEP-A-PLEDVKNASVLAMLGDSVTTDHISP
AGAIKPDSPAGRYLQENGVKPKDFNSYGSRRGNHEVMMRGTFANVRIKNEMLDDV-----
EGGYTRH-------V----PS--------GEQMAIYDAAMKYAEESTPLVVVAGKEYGTG
SSRDWAAKGTRLLGVRAVIAESYERIHRSNLIGMGVLPLQFP-EGEDRKSLGMTGDETIS
IEGIAD-----IEPGGKVTVTIASSKGE-KKIEALCRIDTANEMAYYRHGGILHYVLRSM
L--------
>gi|146306932|ref|YP_001187397.1|	   913 residues, 50 /line  aconitate hydratase 1 [Pseudomonas mendocina ymp]
------------------------------------------------------------
------------------------------------------------------------
--------------------------------------------------MPSLDSL-NC
RRELKVG-D-ATYHYFSLPEAAQR-L----------------------------------
------------------------------------------GNIDRLPKSLKVLLENLL
RNEDG--KTVQPQDLQAMVDWL-DKRASDREIQYRPARVLMQDFTGVPAVVDLAAMRDAM
AKAGGDPQRINPLSPVDLVIDHSVMVDRYAS-SSAFHDNVELEMQRNGERYAFLRWGQHA
FDNFSVVPPGTGICHQVNLEYLARTVWTKEE-D---G------V-TLAFPDTLVGTDSHT
TMINGLGVLGWGVGGIEAEAAMLGQPVSMLIPEVIGFKLSGKLKEGITATDLVLTVTQML
RK-K-GVVGKFVEFYGDGLADLPLADRATIANMAPEYGATCGFFPVDEITLGYLRLSGRP
DATVQLVEAYSKAQGLWREAGA---EPLFTD-SLSLDLGSVEASLAGPKRPQDRVSLGQV
SQAFDDFVGLQLKP------------------------SAKE-EGRLLSEGGG-------
-----GTAVGGDK---QS-GEI--DYED---EGHTHRLKDGAVVIAAITSCTNTSNPSVM
MAAGLLAKKAVEKGLQRQPWVKSSLAPGSKVVTEYFNAAGLTPYLEKLGFDLVGYGCTTC
IGNSGPLREPIEKAITQADLTVASVLSGNRNFEGRVHPLVKTNWLASPPLVVAYALAGSV
RLDLTRDALGT-GKDGQPVYLKDIWPTQAEIAQAIA-QVDTAMFRKEYAEVFAGDEKWRA
IDVP-KADTYAWQGDSTYIQHPPFFEDIAGDP-P-RITDIRQARILALLGDSVTTDHISP
AGNIKADSPAGRYLREHGVNRADFNSYGSRRGNHEVMMRGTFANIRIRNEMLGGE-----
EGGNTLH-------V----PS--------GEKLAIYDAAMRYQAEGTPLVIIAGKEYGTG
SSRDWAAKGTNLLGVKAVIAESFERIHRSNLVGMGVLPLQFK-PGTDRNSLRLSGREVVA
VEGLEGV---ELRPQMPLTLIITREDGQHEEVEVLCRIDTLNEVEYFKAGGILHYVLRQM
IAS------
>gi|114705365|ref|ZP_01438273.1|	   953 residues, 50 /line  aconitate hydratase [Fulvimarina pelagi HTCC2506]
---MVVPA--------------------SSTRV---FRRAKAVRPSA------VVSVREG
T-----------------------------------------------------------
----------------------------------------------TRSMSNHPDSF-NC
RKTLDVD-G-KPYVYFDLKEAEKNGL----------------------------------
------------------------------------------EGISRLPFSMKVLLENLL
RNEDG--RTVTKEDIHAVSKWLDDKGKAGYEIAYRPARVLMQDFTGVPAVVDLAAMRDAT
KQLGADPKKVNPLVPVDLVIDHSVMVDFFAS-PDAFEKNVDAEYGRNKERYQFLRWGSEA
FQNFRVVPPGTGICHQVNLEYLGQTVWTRDE-N---GE-------TIAYPDTLVGTDSHT
TMINGLSVLGWGVGGIEAEAAMLGQPISMMIPEVIGFRLDGALPDGTTATDLVLTVTEML
RK-K-GVVGKFVEFFGPGLSNLTLEDQATIANMAPEYGATCGFFPIDKDTIAYLEATGRQ
KDRIALVEAYGKAQGMYREDSTP--DPVFTD-TLELDLATVVPSLAGPKRPQDRVALTDA
APAFHKALHEIKGGRKKDDNP--------------------------QSQGDSRFMDEG-
-----ATLPNEVP---SD-VAY--RHEV---EGAAHGLSHGDVVIAAITSCTNTSNPNVL
VAAGLVARKAHEKGLTVKPWVKTSLAPGSQVVTEYLEKSGLQTDLDKMGFNLVGYGCTTC
IGNSGPLPEPISDAINANDLVAASVLSGNRNFEGRVNPDVRANYLASPPLVVAYAIAGTM
FKDITKEPLGQ-DKDGNDVYLSDIWPSTHEIAEIVRETVTRDMFENRYADVFKGDEHWRK
IDVS-GGLTYDWDDTSTYVQNPPYFDGMDQEP-E-PVEDIKGARILGLFADSITTDHISP
AGSIKKDGPAGEYLVSHQVRPVDFNSYGARRGNHQVMMRGTFANIRIKNQMVPGV-----
EGGVTVH-------H----PS--------GEQMPIYDAAMKYKDEGVPLVVFAGKEYGTG
SSRDWAAKGTILLGVKAVIAESFERIHRSNLVGMGVVPFVFAEEGQSWEKLGLKGDEKVT
IEGLT-D----IRPRREMEAVIESADGSKQTVKIKTRIDTDDELSYYKNGGILHYVLRQL
AA-------
>gi|146337539|ref|YP_001202587.1|	   911 residues, 50 /line  aconitate hydratase 1 [Bradyrhizobium sp. ORS278]
---MGFPR----------------------------------------------------
------------------------------------------------------------
--------------------------------------------------MTSLDSF-KC
RKTLKVG-T-KSYIYYSLPTAEKNGL----------------------------------
------------------------------------------KDISKLPYSMKVLLENLL
RNEDG--RTVTKDDIVAVSKWL-RKKSLEHEIAFRPARVLMQDFTGVPAVVDLAAMRNAM
QKLGGDAEKINPLVPVDLVIDHSVIVNYFGD-NKAFGKNVAEEYKQNQERYEFLKWGQKA
FSNFSVVPPGTGICHQVNLEYLAQTVWTKKE-KMTVGRTKG--TFEVAYPDSLVGTDSHT
TMVNGLAVLGWGVGGIEAEACMLGQPLSMLLPDVVGFKLTGALKEGVTATDLVLTVTQML
RK-L-GVVGKFVEFFGPGLDHLSVADKSTIANMAPEYGATCGFFPVDTATIDYLKTSGRK
GPRVALVEAYAKAQGLFRTAKSA--DPVFTE-TLNLDLGDVVPSMAGPKRPEGRIALPAV
AEGFATALAGEY------------------------------------------------
------KKPDAAE--------Q--RFAV---EGKDFDIGHGDVVIAAITSCTNTSNPSVL
IGAGLLARNAAAKGLKAKPWVKTSLAPGSQVVAEYLANSGLQKDLDKVGFNLVGFGCTTC
IGNSGPLPEEISKSINDNGVVAAAVLSGNRNFEGRVSPDVQANYLASPPLVVAYALAGTV
TKDLAVEPIGI-GKDKKPVYLKDIWPTTKEVNDFVKKFVKASIFKKRYADVFKGDTNWRK
IKTV-ESETYRWNMSSTYVQNPPYFEGMKKEP-E-PIKDIVEARVLALFGDKITTDHISP
AGSIKLTSPAGKFLSEHQVRPADFNQYGTRRGNHEIMMRGTFANIRIKNFMLKGADGNIP
EGGLTKH-------W----PD--------GEQMSIYDAAMKYQEEGVPLVVFAGAEYGNG
SSRDWAAKGTRLLGVRAVICQSFERIHRSNLVGMGVLPLTFQ-EGTSWSSLGLKGGEKVT
IKGLQGD----LKPRQTLTAEIVSADGAAQQVPLLCRIDTLDELDYYRNGGILHYVLRKL
AA-------
>gi|76260743|ref|ZP_00768373.1|	   913 residues, 50 /line  Aconitate hydratase 1 [Chloroflexus aurantiacus J-10-fl]
------------------------------------------------------------
------------------------------------------------------------
----------------------------------------------------MANSF-GA
RSTLTVG-D-RTYEIYRLDALTAHG-----------------------------------
------------------------------------------VNLARLPYSLRILLENLL
RHEDG--RTVTADDILALANWQ-PQAEPEREVAFMPARVILQDFTGVPCVVDLAAMRDAM
AELGGDPRRINPLQPVELVIDHSVQVDAYGS-EAALLINKDLEFQRNVERYAFLRWGQTA
FDNFKVVPPGNGIVHQVNLEYLARVVFTSDE-N---PRATG--P-VQAYPDTLVGTDSHT
TMINGLGVLGWGVGGIEAEAAMLGQPLSMLIPQVVGFKLTGRLREGATATDLVLTVTQML
RK-L-GVVGKFVEFFGPGLAHLPLADRATIANMAPEYGATCGIFPVDEETLRYLRFSGRS
EERVALVEAYFKAQGLFHDEHTP--EAEYST-VLELDLSTVEPSVAGPKRPEGRVPLHEV
NRTFHMAVPTIINPTQPDTAL--------------------------SAA----------
----------------DF-AAT--AVAV---PGADYKLHHGSVVIAAITSCTNTSNPSVM
VAAGLLAKKAVEAGLSVKPWVKTSLAPGSKVVTEYLTNAGLLPYLEALRFHVVGYGCTTC
IGNSGPLAPEISQTIEQSGLVAVSVLSGNRNFEGRVQQDVKANYLMSPPLVVAYAIAGRI
DIDLDKEPLGV-GKDGKPVYLRDIWPSQAEVQQTIETAIQSEMYRRSYASVFVGDERWEN
IPVP-AGDRFAWDPQSTYVRRPPYFDQMSPTP-PARVAEIHGARVLAFLGDSITTDHISP
AGSIKVNSPAGKYLIEHGVAPADFNSYGARRGNHEVMVRGTFANVRLRNKLAPGT-----
EGGFTTY-------L----PT--------GEVMTIYDAAMRYQADGTPLVVIAGKEYGNG
SSRDWAAKGPYLQGVKAVIAESFERIHRSNLVGMGIVPLQFM-PGENAASLGLTGHEVYD
VIGLADAIASGFANGRILTVRATAGDGTVREFQVRVRIDTPQEVEYYRHGGILQYVLRQL
LAEDQQ--G
>gi|117928601|ref|YP_873152.1|	   926 residues, 50 /line  aconitate hydratase 1 [Acidothermus cellulolyticus 11B]
------------------------------------------------------------
------------------------------------------------------------
--------------------------------------------------MTEANSF-GS
RSTLAVG-D-ARYTIYRLDAVP--------------------------------------
-------------------------------------------SVHRLPFSLKVLLENLL
RTEDG--VNVTADHIRALANWD-PDKEPDTEIQFTPARVLMQDFTGVPCIVDLAAMREAM
VALGGDPKRINPLSPAELVIDHSVIADVYGR-PDAFVRNAELEFQRNRERYQFLKWGQRA
FDNFKVVPPDTGICHQVNLEYLSRVVFDRD----------G-----VAYPDTLVGTDSHT
TMVNGLSVLGWGVGGIEAEAAMLGQPISMLIPKVVGFRVHGELPDGATATDLVLTVAEML
RR-H-GVVGKFVEFYGPGVGNIPLADRATIGNMSPEYGSTCAIFPIDDETLRYLRFTGRS
PERVALVEAYAKEQGLWHDP-EH--EPEFSE-RLELDLSTVEPSIAGPKRPQDRIPLTGA
KRAFRSALRNYVTDEPADGSL--------DEGLAESFPASDPVAVEHEHPGDKPRVVAS-
----AAQGSNGRP---SK-PTL--VTLS---DGTTVELDHGAVVIAAITSCTNTSNPSVM
IGAALLAKKAVERGLTPKPWVKTTLAPGSKVVMSYYEAAGLVPYLEKLGFALVGYGCTTC
IGNSGPLDEPLSRAINESELAVASVLSGNRNFEGRIHPDTKLNYLASPPLVVAYALAGSM
DVDLTTEPLGI-GADGNPVYLRDIWPSEQEISEVMGRAIESRMFVESYRDVFAGDERWNS
LQVP-DGELFVWDETSTYVRRPPYFDGMTPEP-A-PLADIVGARALVMLGDSVTTDHISP
AGSIKRDSPAGRYLMEHGVQPKDFNSYGSRRGNHEVMIRGTFANIRLRNLLAPGT-----
EGGVTRH-------L----PD--------GELMTVYDAAMRYAAEGVPLIVLAGKEYGSG
SSRDWAAKGTALLGVRAVIAESFERIHRSNLIGMGVLPLQFV-DGQNRESLGLTGEETYT
IAGLAGAD---HIPRQL---VVRADD---KEFPVIVRIDTPGEAEYYRHGGILPYVLRSI
LARPA----
>gi|115378394|ref|ZP_01465556.1|	   933 residues, 50 /line  aconitate hydratase 1 [Stigmatella aurantiaca DW4/3-1]
---------------------------MQAARC---GPRRHLAHPHG-------------
------------------------------------------------------------
----------------------------------------------EGRRTHMTDSF-GT
KSQLKVG-S-ATYDFYSLGKLAQK-N----------------------------------
------------------------------------------AAVSRLPLSLKVLLENLL
RHEDG--RVVKKEHVEKMLAWD-PKATPDTEISFHPARVLLQDFTGVPAVVDLAAMREAL
ASMGGDPAKINPRNPADLVIDHSVQVDTFAT-TASYKENAELEFERNRERYAFLRWGSNA
FKNFGVVPPDIGICHQVNLEYLAQVTFRQG---------------NVACPDTLVGTDSHT
TMINGIGVVGWGVGGIEAEAALLGQPITMLIPQVVGFKLTGQLPAGATATDLVLTVTQML
RK-K-GVVGKFVEFYGNGVKNLSLPDRATIANMAPEYGATIGFFPVDEESLAYLRFTGRP
DEVVALTEAYCREQGLFRLDSAP--EPVFSD-TLELDLATVVPSLAGPKRPQDRVPLTDM
KGAYEKALVEMLAAGKSKGED---------------------------DEGGGKAKAPAA
-------PVPPER---LQ-QTS--TVTS---GSESYKLGHGAVVIAAITSCTNTSNPAVL
VGAGILAKKAVERGLTSKPWVKTSLAPGSRVVTEYLKEAGLLPYLEGVGFHVVGYGCTTC
IGNSGPLTEPVANAVTEGDLVVAAVLSGNRNFEGRINPHVRMNYLASPPLVVAYALAGDV
NRDLNKEPVGH-DRNGKPVFLKDIWPTNEEIREIIRTAVKPEQFRRQYAHAMEGDTLWQQ
LQVN-KGNTFQWEEKSTYVRKPPFFENLPKEP-A-PLKDIHGAHVLAVLGDSVTTDHISP
AGNIAKNSPAAKYLMAEGVEPKDFNSYGARRGNHEVMVRGTFANIRLKNLLVPGV-----
EGGVTVH-------I----PT--------REKTTIYDASMKYQQEGTPLVVLAGAEYGTG
SSRDWAAKGTQLLGVKAVIAKSFERIHRSNLVGMGVLPLQFE-AGQDAQSLGLTGHEKFT
ITGVAE----GLAPQKVLTVKAEG-EGGTKEFKALCRIDTPNELDYYRHGGILQYVLRQL
AKA------
>gi|83317406|ref|XP_731148.1|	   914 residues, 50 /line  aconitate hydratase 1 [Plasmodium yoelii yoelii str. 17XNL]
------------------------------------------------------------
------------------------------------------------------------
-----MKNA-------GVNFSNYVKKYCS----------------------KSNNPFENL
RKSFNK----GNYHYYDLNELND-------------------------------------
------------------------------------------SRIKSLPYSIRILLESAI
RNCDN--LKVTEENVKTILAWK-ENSKKKKEIPFMPARVLLQDLTGVPCIVDLATMRDTA
EFLGGDANKINPLIPVDLVIDHSVQVDYSRS-SKAIEYNEKREFERNLERFKFLKWGMNS
FENMLILPPGSGIVHQINLEYLAHCVFKNKN-N------------NLIYPDSVVGTDSHT
TMINGLGVLGWGVGGIEAEATMLGLPISMTLPEVIGINVVGKLSDNLLSTDIVLYITSFL
RK-EVGVVGKYVEFFGPSLKDLKLADRATIANMAPEYGATIGFFGIDDTTLEYLKQTGRD
NDKINLVRDYLKKNMLYNDY-SE--NLEYTD-VYTLDLSKLSLSVSGPKRPHDNILLHDL
HNDFKICLDSPVGFKGYNISKEDQKK----------------------------------
--------------------EI--TFEYKTGNGATYKLSHGSIVLAAITSCTNTSNSCSM
IAAGLLAKKAVELGIKPIPYIKSSLSPGSKAVQKYLEAGGLLSYLEKLGFYNVGYGCMTC
IGNSGNLDAEVEDVINKHDLVCSSVLSGNRNFEGRIHPLIKANYLASPALVVLLSLIGNV
NTDITKYTF---ECNGKIIKALDLIPKKDEINEYEEKYVKAELYKDIYKNIKYVNKYWND
IQIK-KNKLFEWDKNSTYIHKPPFFDDMKIQP-Q-KIKDIKNANILLLLGDSITTDHISP
AGMIHKKSEAYKFLKSKGVKDDDLNTYGARRGNDEVMIRGTFANIRLINKLCPD------
KGPNTIY-------A----PS--------NELMSVYEAAMKYKQNNKDVIIIAGKEYGCG
SSRDWAAKGSYLLGVKAIIAESFERIHRSNLIGMSVLPLQFL-NNENAQHYNIDGTETFT
ILLN----EGNLKPGQNITIEMNQ-KGKIIKFDVLCRIDTEIEVQYFKNGGILKYVLRSL
VKKEDA---
>gi|18416900|ref|NP_567763.1|	   995 residues, 50 /line  aconitate hydratase, cytoplasmic, putative / citrate hydro-lyase/aconitase, putative [Arabidopsis thaliana]
---MYRRATSGVRSASA--------------------------------------RLSSS
LSRIASSETASVSAPSASSLRNQTNRSKSFSSA---LRSFR-------------VCSAST
RWSHGGSWG-------SPASLRAQARNSTPVMEKFER-KYATMASEH----SYKDIL-TS
LPK-PGG-G-EYGKYYSLPALND-------------------------------------
------------------------------------------PRIDKLPFSVRILLESAI
RNCDN--YQVTKDDVEKILDWE-NTSTKQVEIAFKPARVILQDFTGVPVLVDLASMRDAV
KNLGSDPSKINPLVPVDLVVDHSIQVDFARS-EDAAQKNLELEFKRNKERFTFLKWGSTA
FQNMLVVPPGSGIVHQVNLEYLGRVVFNSK---------------GFLYPDSVVGTDSHT
TMIDGLGVAGWGVGGIEAEAAMLGQPMSMVLPGVVGFKLDGKLKEGVTATDLVLTVTQIL
RK-H-GVVGKFVEFYGEGMSELSLADRATIANMSPEYGATMGFFPVDHVTLEYLKLTGRS
DETVSMIESYLRANNMFVDYNEPQQERAYTS-YLQLELGHVEPCISGPKRPHDRVPLKDM
KADWHACLDNPVGF---------------------------------------KGF----
-------AVPKEK---QE-EVV--KFSY---NGQPAEIKHGSVVIAAITSCTNTSNPSVM
IGAALVAKKASDLGLKVKPWVKTSLAPGSRVVEKYLDRSGLRESLTKQGFEIVGYGCTTC
IGNSGNLDPEVASAIEGTDIIPAAVLSGNRNFEGRVHPQTRANYLASPPLVVAYALAGTV
DIDFEKEPIGT-RSDGKSVYLRDVWPSNEEVAQVVQYSVLPSMFKSSYETITEGNPLWNE
LSAP-SSTLYSWDPNSTYIHEPPYFKNMTANP-P-GPREVKDAYCLLNFGDSVTTDHISP
AGNIQKTSPAAKFLMDRGVISEDFNSYGSRRGNDEVMARGTFANIRIVNKLLKGE-----
VGPNTVH-------I----PT--------GEKLSVFDAASKYKTAEQDTIILAGAEYGSG
SSRDWAAKGPLLLGVKAVIAKSFERIHRSNLAGMGIIPLCFK-AGEDAETLGLTGHERYT
VHLPTK--VSDIRPGQDVT--VTTDSG--KSFVCTLRFDTEVELAYYDHGGILPYVIRSL
SAK------
>gi|71033859|ref|XP_766571.1|	   912 residues, 50 /line  aconitate hydratase [Theileria parva strain Muguga]
------------------------------------------------------------
-------------------------MFVSFGEK---L-----------------------
-----GLKS-------SPSVLRQMKNFSS----------------------SRPNPF-EK
VKK-TLA-G-TNKKYFSLRDLKD-------------------------------------
------------------------------------------PRLFELPFSIRVLLEAAV
RNCDE--FSTTSNDVEKILGWA-KNSLNQTEIPFIPSRVLLQDFTGVPTIVDLAAMRDFV
AKSGKDPTRINPLVPVDLVIDHSVQVDFSRD-SKALALNQETEMNRNSERFRFLKWGAQT
FKNTLIVPPGSGI---VNLEFLARCLFDKN---------------DLLYPDSVVGTDSHT
TMINGLGVVGWGVGGIEAEATMLGQPISMLLPQVVGFELVGKPSENVFSTDVVLAVTSLL
RSGA-GVVGKFVEFFGEGVKYLSLADRATIANMAPEYGATVGFFPIDQLTLDYLLQTGRP
NEKVDLLERYSKENLLHTSSS-NAGEIKYST-VVRLDLSTLTPSIAGPKRPQDNIPLHLV
KSKYSELLTSK-DT---------------------------------------KGY----
-------GLDKL-----S-NKV--KFTY---KGKEYELDNGSVVIASITSCTNTSNPSVM
LAAGLLAKNAVEHGLSVKPYIKTSLSPGSKTVTRYLELSGLIGYLEKLGFYIAGYGCMTC
IGNSGELDPEVTEAVVNNKLVVSSVLSGNRNFEGRVHPHTRANFLASPPLVVAFALAGNV
NFDLMNEPLGVSTKTGKPVFLHDLLPSKEEVSSLEAQFVKASLFNDVYHNITEGSDSWRK
LNAP-KTELYPWDELSTYIQHPPYFKGMHLDKLN-EVKPITDARVLLLLGDSITTDHISP
AGNIAKNSPAARFLMENGVEQKDFNSYGSRRGNDKVMSRGTFANIRINNLLCPG------
QGPNTVH-------F----PT--------NKLMSVYDASELYQRDNTPLVVVAGKEYGTG
SSRDWAAKGPLLLGVKAILAESFERIHRTNLVGCGILPLQFL-DGQNATTLNLTGTEKFT
VHL-----GSDVVPGSLVR--VTTDTG--LSFDTKCRVDTQIESEYYKHGGILQYVLRSI
CKSD-----
>gi|49659878|gb|AAT68238.1|	   1055 residues, 50 /line  iron regulatory protein-like protein [Toxoplasma gondii]
---MRILVPLVFLAAQIPPASLERVSVSGFLPRALLFRRVPLPRPICTARCLEVAQARRP
RNPFLLPVSSFLLPGSMKALSNIVLPRKGISVA---ARSTASATAASQPLPR-NSRALSK
ACALPASQA-------FEGSRRSAGAKEAHVPERHTR-LHSALTQSRKMSTSRGNPF-AY
VAK-TLA-G-TEKTYYDIGALQD-------------------------------------
------------------------------------------DRLKTLPFSIRVLLESAV
RNCDG--FSIKPEDVQTILDWQ-KASQAQKEIPFMPARVLLQDFTGVPAVVDLAAMRDAM
ARLGGPPSSINPLVDVDLVIDHSVQVDFSRS-PEAFEKNLAKEMERNSERFSFLKWGSTA
FSNMLIVPPGSGIVHQVNLEYLARVVMDKKV-G---D------R-AVLYPDSLVGTDSHT
TMINGLGVVAWGVGGIEAEAVMLGQQISMVLPQVVGFELTGQMPPSVTATDLVLTVTNIL
RK-K-GVVGKFVEFYGPGVQTLTLADRATVANMAPEYGATMGFFPVDEQTLRYLKQTGRP
DEKVDLIEAYTKANHLFASPSV-HAEIAFSD-RVSLNLSELEPCVAGPKRPQDRVPLSEV
KEDFQVSLRNPVGF---------------------------------------KGF----
-------GLSEEQ---AE-KKV--EMTF---RGKKYTLTHGSVVIAAITSCTNTSNPGVI
LGAAMLARNALEKGLSVPPYIVTTLSPGSRAVTEYLARSGLLKDLEKLGFYTAGYGCMTC
IGNTGDFDPEVSAAISQGDLVVAAVLSGNRNFEGRVHPLTRANFLASPPLVVAYALAGRV
DFDFEEEPLGN-DKEGNPVFLRDIWPSREQIAEVEAKALSASAFVKVYEHITEGTPAWNA
LKTAKASDLFDWDEKSTYIHNPPFFQTMQKEP-A-PIEDIVDAYCLLNLGDSITTDHISP
AGNIAVNSPAAKYLQSKGVERKDFNTYGARRGNDEIMVRGTFANIRLVNKLCP-K-----
DGPKSVH-------V----PS--------GEVLPVYDVAMKYKAERKPMIVLAGKEYGSG
SSRDWAAKGPYLMGVKAIIAESFERIHRTNLVGMGILPLQFQ-EGQNAESLGLTGKEQFN
ISL--N--KGEIIPGSLMT--VKTSDG--KAFDVRCRIDTELEVKYFQNGGILHYVLRNL
TKQHSGE-N
>gi|118063248|ref|ZP_01531589.1|	   918 residues, 50 /line  aconitate hydratase 1 [Roseiflexus castenholzii DSM 13941]
------------------------------------------------------------
------------------------------------------------------------
-------------------------------------------------MTNLNDPF-NA
RAPLVVG-G-QTFIIYRLDALARRVG----------------------------------
------------------------------------------ADLARLPFSVKVLLEALL
RNVGD--GFTTIDDVAALAQWT-PASAGQREVAFKPARVLMQDFTGVPAVVDLAAMRDAM
AHLGGDPAKINPLVPADLVIDHSVQVDAFGH-GMALVLNAQLEFERNRERYEFLRWGQQA
FANFRVVPPATGICHQVNLEYLATVVMTREI-D---G------E-LVAMPDTLVGTDSHT
TMINGLGVLGWGVGGIEAEAVLLGQPLAMLTPEVVGVKLTGALRPGATATDLVLRVTEML
RR-H-GVVDKFVEFCGPGLSALSLADRATIANMAPEYGATCGFFPVDAETLAYLRGTGRS
DDLVALVEAYCREQGLFRTDDSP--IPEFNT-LLELDLSTVEPSVAGPRRPQDRVPLTDL
KASFNQAMRTIFGREAPA----------------------------YEGNGERRR-----
-------ERRDLY---AA-SRV--PVTL---NGQATALTHGSTIIAAITSCTNTSNPSVM
IAAGLLAKKAVEKGLRVPPYVKTSLAPGSRVVSEYLAQSGLQEYLDQLGFNVVGYGCTTC
IGNSGPVADEIAQAVKAGNLVVSAVLSGNRNFEGRINPVVRANYLASPPLVVACAIAGTV
DIDMNREPLGV-GIDGEPVYLADIWPSAEEVAEVMAASLNADLFRQQYANVFTGNETWNA
IPVS-GGDLYAWNPDSTYIQNPPYFRDMTREV-P-PLASIRGARALALLGDSVTTDHISP
AGSIAKDSPAGRYLIERGVQPADFNSYGARRGNHEVMMRGTFANIRLRNAMVPGV-----
EGGYTIY-------L----PT--------GEQMSIYDAAMRYQADGTPLVVLAGKEYGTG
SSRDWAAKGTFLLGVRAVIAESFERIHRSNLVGMGVLPLTFA-PGESWQSLGITGREIFT
IEGIE-----TLRPGQELTVHAQRPDGSAFTFTVKARINSEGELAYYRNGGILHYVLRQL
AEQEEPAAV
>gi|88812882|ref|ZP_01128126.1|	   917 residues, 50 /line  aconitate hydratase 1 [Nitrococcus mobilis Nb-231]
------------------------------------------------------------
------------------------------------------------------------
----------------------------------------------------MSNSF-NT
RSTLEVD-G-DPYQIYRFEALKSK------------------------------------
------------------------------------------YDVDRLPYSLKILLENLL
RKEDG--RHVTEQDIEALLNWE-PMAEPGVQIAFTPARVVLQDFTGVPAIVDLAAMRDAM
QRLGGEPKLINPLEPADLVIDHSVMVDYFAT-PNALKKNTELEFQRNEERYKFLRWGQKA
FANFRVVPPGTGIVHQVNLEYLAQVVFTKTT-P---P------A-TLAYPDTLVGTDSHT
TMINGLGVLGWGVGGIEAEAAMLGQPITMLLPQVVGFKLTGKLSEGATATDLVLTVTQML
RQ-K-GVVGKFVEFYGDGLDNLPLADRATIANMAPEYGATCGIFPIDRETLRYLELSGRD
PARLALVESYAKLQGLWRESGSR--EADYSD-TLALDLGAVVPSLAGPKRPQDRIALTNA
RQAFLGTLRQDLESRHALP-------------------ANHE-EERFASEGGDTAI----
-------GWQGGH---ET-GAI--EIEL---GAEKHLLKHGAIVIAAITSCTNTSNPAVL
IAAGLVAKKANALGLKVKPWVKTSLAPGSQVVPAYLEKAGLLGELAALGFNVVGFGCTTC
IGNSGPLPEAIAQAIREGDLVVASVLSGNRNFEGRIHQDVRANYLASPPLVVAYALLGSM
ASDPYREPLGR-DRNGKAIYLKDVWPSQREITELMGNNISSTMYREQYADVFAGSEAWQA
LPVP-EGEIYQWP-ESTYVKHPPFFEGMSLEP-P-GPPKIEAARCLIMLGDSITTDHISP
AGAIKPDSPAGHYLQQHGVAPKDFNSYGSRRGNHEVMMRGTFANIRLRNKLAPDT-----
EGGWTTH-------F----PS--------DTQMSIFDAAQRYQETMTPLVVLAGKDYGAG
SSRDWAAKGTKLLGIRAVIAESFERIHRSNLVGFGVLPLQFK-PEESAERLGLCGKEIFS
IGTLAG------EPG-SVSVKAVTETGEVTEFEATVRIDTPTEWDYYQHGGILHYVIRAL
AKQSEA--S
>gi|121998188|ref|YP_001002975.1|	   914 residues, 50 /line  aconitate hydratase 1 [Halorhodospira halophila SL1]
------------------------------------------------------------
------------------------------------------------------------
----------------------------------------------------MTDSF-NA
RTTLQAG-G-KAYEIYSLDGPRRD------------------------------------
------------------------------------------YDVDRLPFSLKILLENLL
RKEDG--VNVTREHIEAVLNWD-PKATPKDQIAFTPARVVLQDFTGVPAVVDLAAMRDAM
KNLGGDPSRINPLSPADLVIDHSVMVDHFGN-RQALQLNTEIEYQRNRERYEFLRWGQTA
FSNFRVVPPGTGIVHQVNLEYLGQVVFRNEN-G---D------T-PQAYPDTLVGTDSHT
TMINGLGILGWGVGGIEAEAAMLGQPISMLVPEVVGFRLEGKLPEGATATDLVLTVTEML
RK-K-GVVGKFVEFFGDGLDHLPLADRATIANMAPEYGATCGIFPVDKETLAYMELSGRE
QELIDLTEQYAKAQGMWRETGSR--EAEYSD-TLSLDLSTVVPSLAGPKRPQDRVSLDAA
KASFKQTLQDHLRAHHTVPTD-------------------AA-EEHFESEGGHSAP----
-------GIDDAH---ER-GAV--EIEI---GGRKEMLKHGDVVIAAITSCTNTSNPAVL
VAAGLVAKKARERGLMPKPWVKTSLAPGSQVVPAYLEQAGLLDDLEHLGFSVVGFGCTTC
IGNSGPLPEAVAEGIREGDLCVTSVLSGNRNFEGRIHQDVRANYLASPPLVVAYALAGTM
ARDLYKEPLGT-DNQGRDVYLKDIWPSQQEVADLVRGNISAEMYREQYANVFDGDAAWQS
IDAP-SGELYDWR-ESTYVKNPPYFQGMNQTP-Q-PLQDIRGARCLIYVGDSITTDHISP
AGAIHPDSPAGQYLQEQGVAPKDFNSYGSRRGNHEVMMRGTFANVRLRNKMAPGT-----
EGGWTTH-------V----PS--------GEQTSVYDASMRYQQADTPLIVLAGKEYGTG
SSRDWAAKGTNLLGIKAVIAESYERIHRSNLVGFGVLPLQFQ-DGENAETLGLKGDEAFD
IEGITE------QP-RTVRVLARRDDGTETTFEARVRVDTPQEWEYYRHGSILHYVLRGL
AGTA-----
>gi|149918462|ref|ZP_01906952.1|	   941 residues, 50 /line  aconitate hydratase [Plesiocystis pacifica SIR-1]
---MGTPAGLRYSP---PAERPLDPPEPALHRN---LISEK-------------------
------------------------------------------------------------
----------------------------------------------Q-PVATSALPN-DI
RESIALA-DGSQGVIYRLGALEAAGW----------------------------------
------------------------------------------TELAKLPFSIRVLLESAL
RNHDG--FLVTDDDVRTIASWK-PQGE-RKEIPFIPARVILQDFTGVPAVVDIAACRNAM
VELGGDPQKVNPAVNVDLVIDHSVQVDVDGSHTDALLRNLDIEYKRNQERYEFLKWGQQN
LANFGAVPPGRGIVHQVNLEWIAQVAFRKQT-T---GP-DGAEE-VRYYPDSLVGTDSHT
TMINGIGVLGWGVGGIEAEAVMLGQPVYMLAPDVIGFKLTGKLRAGVTATDMTLRIVELL
RA-K-GVVGKFVEFYGPGLDHLSLSDRATIANMAPEYGATCGFFPVDDQSLAYMRLTGRD
EDHVKNVETVLRAQGLFRTAETP--DPEFTD-SLELDLADVDPGLAGPKRPQDRVNLSAM
KTHFNESLTAKLGLHGHG------------------------------------------
--------LAEGE---LG-NKA--TVNH---KGTQFELTHGDVVIAAITSCTNTSNPAVM
LAAGLLARNAVAKGLHTKPWVKTSLAPGSRVVTEYYDKAGLSDDLAKLGFNLVGYGCTTC
IGNSGPLPEVIDSAISDNKLVVGSVISGNRNFEGRVHNKVKASYLASPPLVVAYAIAGTL
DINFDEDPIGK-DAAGVDVFLKDIWPGDEELRQVVHSSINPEMFRAKYGDV-TAEPRWDS
IEVA-DSALYPWNSESTYVQQPPFFQGITPEV-P-AVQPIAGARVLLKLGDSVTTDHISP
AGSFPAEGPAGKYLIDKGVQKAAFNSFGSRRGNHEVMMRGTFANVRIRNQIAPGT-----
EGGYTKY-------W----PT--------GEVEFVYDAAMKYVESNTPLVVLGGVQYGTG
SSRDWAAKGTLLLGVKAVITKSFERIHRSNLVGMGVLPLCFA-DGEGADELGLDGSESFD
IPITDD-----VQPLSKLTVTATKADGSKVEFETTVRLDTPVEVDYYKNGGILQTVLRNM
AKG------
>gi|21227630|ref|NP_633552.1|	   942 residues, 50 /line  aconitate hydratase [Methanosarcina mazei Go1]
-------------------------------------MLEV-------------------
------------------------------------------------------------
----------------------------------------------KSKMREGPDPF-GV
RDSIETT-A-GKATIYRLGKLEEKGF----------------------------------
------------------------------------------EGISLLPYSIRILLESLL
RHADTQKKTITVEDVEALARWS-PENISEKDIPFIPSRVIMQDFTGVPAVVDLAALRSAM
ERLGGDPAKINPVIPADLVIDHSVQVDSYGT-AYSLGENEKKEFERNRERYTVLRWAQKA
FDNFRVVPPGRGIIHQVNLEYLTPLVHLSEK-E---G------E-LFAFPDTLVGTDSHT
TMINGIGVLGWGVGGIEAEAVMLGQPYYMPVPEVVGFKLYGKLEPGVTATDLVLTITKML
RK-H-GVVGKFVEFYGPGLNSLSLPDRATISNMAPEYGATLGIFPPDQETLDYMKRTGRS
DEQVDLVKKYLEAQDLLYSANKP--EPVFSS-NLELDMGTVKPCLAGPRRPQDQLFLNEV
SENFCETMRQTFIRKKEGGTDL-----------------ARD-PAYLRWIGE-GGA----
-------PVEETEAQVAR-ETE--KVGP---VEKDFRVTHGSVVIASITSCTNTSNPSVL
IGAGLLAKKAIERGLKVKPFVKTSLSPGSRVATEYLGAAGLLPYLEALGFHQVGYGCTTC
IGNSGPLPEHVSKEIEEKDLTVAAVLSGNRNFEGRINPLVKANYLASPPLVVAYAIAGTV
NINFETDPLAY-DPNGIPVYLRDIWPMQDEIKQVEKESVRPEMFKKEYSGVLEGAKLWKE
LEVP-EGTLYEWIPTSTYIQEPPYFVDFPLTS-P-LLGDIRNARVLALFGDSITTDHISP
AGDIPAESPAGRYLMSWGVDQKDFNSYGSRRGNHEVMMRGTFANIRLRNRLVS-K-----
EGGWTVYH------L----KGEDFPPEACGEGMPIYDASLLYAENNVPLIVIAGKEYGTG
SSRDWAAKGTFLLGVKAVIAESFERIHRSNLVGMGVLPLQFK-AGENADSLGLTGKESYD
ILGIEK-----MEPHGELTVLARDDSGKETEFKATLRLDSAVEIEYYRNGGILHKFLRDS
VKK------
>gi|50086100|ref|YP_047610.1|	   917 residues, 50 /line  aconitate hydratase [Acinetobacter sp. ADP1]
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------------------MASYSKINSF-NA
LKTLNVG-S-TAYQIFSLHQAQAK-L----------------------------------
------------------------------------------GDIEKLPKSLKVLLENLL
RFEDD--QTVLATHIEALVKWQ-NTKTSDQEIQYRPARVLMQDFTGVPAVVDLAAMRAAM
AKAGGDPEKINPLSPVDLVIDHSVMVDHFAS-DAAFEENVDIEMQRNGERYQFLRWGQSA
FNRFSVVPPGTGICHQVNLEYLAQAVWTGED-Q---G------Q-TFAFPDTLVGTDSHT
TMINGLGVLGWGVGGIEAEAAMLGQPISMLIPEVIGFKLTGKLREGITATDLVLTVTQML
RK-K-GVVGKFVEFYGDGLADLPLADRATIANMAPEYGATCGFFPVDDITLDYMRLTGRD
ADRIALVEAYSKEQGLWRHAG-D--EPVFTD-TLTLDMDTVEASLAGPKRPQDRVLLAKV
PEAFQAVMDLSLTAAK------------------------PE-KERLENEGG-GGT----
-------AVDAEQSH-FE-QQP--YYEM---DGQRYELNHGDVVISAITSCTNTSNPSVM
LAAGLLAKKAIEKGLQRKPWVKSSLAPGSKVVTDYLAAAGLTPYLDQLGYNLVGYGCTTC
IGNSGPLPDPIEAAVQKYDLNVASVLSGNRNFEGRVHPLVKTNWLASPPLVVAYGLAGTI
RKDLTSEPIGQ-GKDGEDIYLKDIWPTSAEIAEVLQ-KVNTDMFHKEYAAVFEGDESWQS
IQIP-QSQTYEWAEDSTYIRHPPFFEGIDQPP-E-AITNIESARVLAVLGDSVTTDHISP
AGNIKKDSPAGRYLQEHGIQPKDFNSYGSRRGNHEVMMRGTFANIRIKNEMLGGE-----
EGGNTIY-------I----PS--------GEKLAIYDAAMRYQKDDTPLVIIAGKEYGTG
SSRDWAAKGTNLLGIKAVIAESFERIHRSNLVGMGVLPLQFI-DGQNRQSLKLTGQEEIS
ITGLSD----QIQPHQSLDITVKREDGSTDTFKVLCRIDTLNEVEYFKAGGILHYVLRNL
IAA------
>gi|21231308|ref|NP_637225.1|	   922 residues, 50 /line  aconitate hydratase [Xanthomonas campestris pv. campestris str. ATCC 33913]
------------------------------------------------------------
------------------------------------------------------------
----------------------------------------------------MSDSF-ST
RTSLEVN-G-QRYDYYSLPKLGER------------------------------------
------------------------------------------FDVARLPYSMKILLENLL
RHEDGG-VTVGKDHIEAVAKWD-PTAEPDIEIAFMPARVVLQDFTGVPCVVDLAAMRDAV
VKLGGNADQINPQIPSELVIDHSVQVDVFGK-PEALDLNGKIEFQRNQERYGFLRWGQKA
FDNFKVVPPNTGIVHQVNLENLARVVMSADK-D---G------T-QIAYPDTVFGTDSHT
TMINGIGVLGWGVGGIEAEAAMLGQPSSMLIPQVVGFKLTGKLPEGATATDLVLTVTQML
RK-H-GVVGKFVEFYGEGLQHLPLADRATIGNMAPEYGATCGIFPVDNESLTYLRLSGRS
EEQIALVEAYAKAQGLWHDADTP--HAQYSA-TLELDMGDVKPSLAGPKRPQDRVLLEDM
QSNYRESLKPFAEARSKRLADT------------------KQ-EDRLKNEGG-GGT----
-------AVGAKASQA-----E--SAGD---SGAGWQLRDGSVVIAAITSCTNTSNPAVM
LGAGLLARNAAAKGLKAQPWVKTSLGPGSRVVTDYLSKAGVLADLEQLGFYVVGYGCTTC
IGNSGPLPEDVSAAIAKDDLVVTSVLSGNRNFEGRVHPEVKMNYLASPPLVVAYAIAGTT
DIDLTRDPLGT-GSDGQPVYLRDIWPSNKEIGDTIAATVGPEMFKQNYADVFKGDTRWNT
IASP-DGALYEWDAGSTYIKNPPYFEGMTMQV-G-HVDDVHGARIMGLFGDSITTDHISP
AGNIKKDSPAGRFLQERGVQPADFNSYGSRRGNDDVMVRGTFANIRIKNLMFGGE-----
EGGNTLY-------FGKDGAT--------PEKLAIYDAAMKYKADGVPLVVLAGKEYGTG
SSRDWAAKGTNLLGVKAVVAESFERIHRSNLVGMGVLPLQFL-EGENAQTLGLDGSEVLD
ITGLQD----GAS--RRATIDAKKSDGSVKQFQVKVLLLTPKEVEYFKHGGLLQYVLRQL
AARKA---A
>gi|115450595|ref|NP_001048898.1|	   986 residues, 50 /line  Os03g0136900 [Oryza sativa (japonica cultivar-group)]
MPPLT--SALLSRSSSTR------------------------------------------
------IPAAAAAAAAI----------------SNPAGAAASSSSPSPPPPSSRPRPASP
FASGLAGRIFGGRRAA--------ARSSSSAAAVFER-RFASAAAKN----SYDEIL-TG
LAK-PGGGA-EFGKYYSLPALSD-------------------------------------
------------------------------------------PRIERLPYSIRILLESAI
RNCDE--FQVTGKDVEKILDWE-NSAPKQVEIPFKPARVLLQDFTGVPAVVDLACMRDAM
SKLGSDPNKINPLVPVDLVIDHSVQVDVARS-ENAVQANMELEFHRNKERFGFLKWGSTA
FRNMLVVPPGSGIVHQVNLEYLARVVFNN---G------------GILYPDSVVGTDSHT
TMIDGLGVAGWGVGGIEAEATMLGQPMSMVLPGVVGFKLTGKLRNGVTATDLVLTVTQML
RK-H-GVVGKFVEFYGGGMSELSLADRATIANMSPEYGATMGFFPVDGKTLDYLKLTGRS
DDTVAMIESYLRANKMFVDYNQPEAERVYSS-YLELNLEEVEPCLSGPKRPHDRVTLKNM
KSDWLSCLDNDVGF---------------------------------------KGF----
-------AVPKES---QG-KVA--EFSF---HGTPAKLKHGDVVIAAITSCTNTSNPNVM
LGAALVAKKACELGLEVKPWIKTSLAPGSGVVKKYLDKSGLQKYLDQLGFHIVGYGCTTC
IGNSGELDETVSAAISDNDIVAAAVLSGNRNFEGRVHALTRANYLASPPLVVAYALAGTV
NIDFEKEPIGI-SKDGKEVYFRDIWPSTEEIAEVVKSSVLPDMFKSTYEAITKGNPMWNE
LSVS-ASTLYPWDPTSTYIHEPPYFKDMTMSP-P-GPRPVKDAYCLLNFGDSITTDHISP
AGSIHPDSPAARYLKERGVERKDFNSYGSRRGNDEIMARGTFANIRLVNKFLKGE-----
VGPKTIH-------I----PS--------GEKLSVFDAATKYKNEGHDTIILAGAEYGSG
SSRDWAAKGPMLQGVKAVIAKSFERIHRSNLAGMGIIPLCFK-SGEDADTLGLTGHERFT
VHLPAN--VSEIKPGQDVT--VTTDNG--KSFTCTLRFDTEVELAYYDNGGILPYVIRKI
AEQ------
>gi|118346197|ref|XP_977148.1|	   984 residues, 50 /line  aconitate hydratase 1 family protein [Tetrahymena thermophila SB210]
---MYRKITCNFSALNNP------------------------------------------
------FQ----------------------------------------------------
----------------------------------------------------------KN
FKQ-LKVEG-KNYNFYSLPDLHDARLGNNNKKLALFVYIFLSLLLCFNPPPTFNFQIRPK
CFLLKWIQLKTVERREKKREKKTIFKTSYFSQSIFKIFFIINYKIEKLPYSVRILLESAV
RNCDE--FNVKKADVEKILAWE-KNSTQQIEIPFKPARVILQDFTGVPAVVDFAAMRDAM
VRLGGDPNKINPLCPVDLVIDHSVQADVARD-LKAFEKNEEIEFNRNYERFEFLKWGQKA
LNNFTIVPPGSGIVHQVNLEYLARVVFNNE--N------------GVLYPDSVVGTDSHT
TMINGLGVLGWGVGGIEAEAVMLGQCISMVLPEVVGFKLYGKLKEHVTATDLVLTCTQML
RK-R-GVVGKFVEFFGPGCENLSLADRATIANMAPEYGATMGYFPIDAQSVDYLKLTGRD
SHKVKVIESYLREQGLFRTSSSKD--PVYTGAVLELDLASVQPCISGPKRPHDRVPLNEM
KSEWNQILTAKTGF---------------------------------------KGF----
-------GLTEQQ---SK-KTH--TFNY---KGTDYTLSNGSVVVAAITSCTNTSNPDSM
VAAGLLAKAAVEKGLNVKPYIKTTLSPGSGVVTKYFVESGVQSYLEQLGFTTAGYGCMTC
IGNTGELEPEVDQAIRQGDVVAAAVLSGNRNFEGRIHPLTRANYLASPALVVAYALAGTV
NIDFETEPIGT-DKHGKAVFLKDIWPSRTFTQDTVHKSLRPEMFSEVYKRISQGTARWNA
LKAS-DKKVYDWKAESTYIHNPPFFQTTELVP-K-PVQSIKSAYCLLNLGDSITTDHISP
AGNIAKNSPAARYLNERGIQSKDFNTYGARRGNDEIMARGTFANVRLINKMMDKV-----
-GPETVH-------I----PS--------GQKLAVFDAAEKYQKEGHQLIVLAGQEYGSG
SSRDWAAKGPYLQGIKAVIAQSYERIHRSNLVGMGILPCEFL-NGQNADSLGLNGHETFN
IDLKG----GNLKVNEVLT--VTTSTG--KSFQVKTRLDTDVEIAYFQNGGILQYVLRKL
VKGEA---Q
>gi|149737063|ref|XP_001497856.1|	   1028 residues, 50 /line  PREDICTED: hypothetical protein [Equus caballus]
---MPQQLLSGLLLVTPP-ETGIEVNIPDSFYIPFLDPQEEDRDYLSTRHSRRVEESVLE
RHGHSRYRHVCVTPGALGTLCK-QRRRGGKQEAGRGGAGDAGPSASSIPLPSLVPSPLLP
FRAFLPEFSLSGYPAVPPVRSIRQARLDTNGKLVVHRDTRPAGIMSN----PFAHLA-EP
LD----PAQ-PEKKFFNLNKLKD-------------------------------------
------------------------------------------SRYGRLPFSIRVLLEAAV
RNCDQ--FLVKKNDIENILDWN-VTQHKNIEVPFKPARVILQDFTGVPAVVDFAAMRDAV
KKLGGDPEKINPVCPADLVIDHSIQVDFNRR-TDSLQKNQDLEFERNRERFEFLKWGSQA
FHNMRIIPPGSGIIHQVNLEYLARVVFDQ---D------------GYYYPDSLVGTDSHT
TMIDGLGVLGWGVGGIEAEAVMLGQPISMVLPQVIGYRLMGNPHPLVTSTDIVLTITKRG
QP-C-GVVVKFAQRVSLGVASTLLSDRAPLVEFTPSASAAQSFTGLDPRRLATDVSSGRD
EDKVKQIKKYLQAVGMFRDFSDPSQDPDFAQ-TVELDLKTVVPCCSGPKRPQDKVAVSDM
KKDFESCLGAKQGF---------------------------------------KGF----
-------QVALDH---HN-DHK--TFIY---NNSEFSLAHGSVVIAAITSCTNTSNPSVM
LGAGLLAKKAVDAGLTVKPYIKTSLSPGSGVVTYYLRESGVMPYLSQLGFDVVGYGCMTC
IGNSGPLPEPVVEAITQGDLVAVGVLSGNRNFEGRVHPNTRANYLASPPLVIAYAIAGTI
RIDFEKEPLGV-NAKGQQVFLKDIWPTRDEIQAVERQFVIPGMFKEVYQKIETMNESWNA
LAAP-SDKLYYWNPKSTYIKSPPFFENLTLDL-Q-PPKSIVDAYVLLNLGDSVTTDHISP
AGNIARNSPAARYLTNRGLTPREFNSYGSRRGNDAIMARGTFANIRLLNKFLN-K-----
QAPQTIH-------L----PS--------GEILDVFDASERYQQAGLPLIILAGKEYGSG
SSRDWAAKGPFLLGIKAVLAESYERIHRSNLVGMGVIPLEYL-PGENADTLGLTGRERYT
VSIPE-----NLKPRMKVQ--VKTS--------------------------LLGTALKCC
FGARR---L


Ad blocker interference detected!


Wikia is a free-to-use site that makes money from advertising. We have a modified experience for viewers using ad blockers

Wikia is not accessible if you’ve made further modifications. Remove the custom ad blocker rule(s) and the page will load as expected.