FANDOM


>gi|18396137|ref|NP_565327.1|	   133 residues, 50 /line  PGR5 (PROTON GRADIENT REGULATION 5) [Arabidopsis thaliana]
---------------MAAA---SISAIGCNQ-TLIGTSFYG-GWGSSISGEDYQTMLS--
-KTVAPPQQARV-------------------------------SRKAIR-AV----PMMK
NVNEGKGLFAPLVVVTRNLVGKKRFNQLRGKAIALHSQVITEFC----------------
KSIGAD----------------------------------------------------AK
QRQGLIRLAKKNGERLGFLA
>gi|119514172|gb|ABL75837.1|	   123 residues, 50 /line  PGR5 [Porphyra yezoensis]
-----------MAFCCLSL---FPERPTGLA---LGPASSP-------------------
--------------ALTVGY------------------PVCPIPSSVLFARPAAAKWIMA
RVAK-FGPFTPLLKLTRLVIGDKPLNKLLGKGIALHSQAITAFC----------------
DFSGTG----------------------------------------------------PK
MRQNLIRVAKENGSKLGFLS
>gi|126656384|ref|ZP_01727645.1|	   68 residues, 50 /line  hypothetical protein CY0110_21812 [Cyanothece sp. CCY0110]
------------------------------------------------------------
------------------------------------------------------------
----MLIMFAPIVVLLRNQMGKVKFNKLRGEAIKVRSQTITNFC----------------
ESVGID----------------------------------------------------RT
ARQNMIRTARDNGKKLGLLA
>gi|16329981|ref|NP_440709.1|	   65 residues, 50 /line  hypothetical protein ssr2016 [Synechocystis sp. PCC 6803]
------------------------------------------------------------
------------------------------------------------------------
-------MFAPIVILVRQQLGKAKFNQIRGKAIALHCQTITNFC----------------
NRVGID----------------------------------------------------AK
QRQNLIRLAKSNGKTLGLLA
>gi|5902602|gb|AAD55571.1|AF110789_1	   144 residues, 50 /line  unknown [Volvox carteri f. nagariensis]
MLVAKRNAVQVRASGSAAL---SMSRSAARSVAVSSRIALS-SWDDCRQTA---SSLA--
-QSA-PKLQNTS--------------------------------NAPRR-KPV----TMM
GNKATTGPFAPLVVVVRGAIGEKEFNQFRGKAISLHSQVIKDFC----------------
KLLGVD----------------------------------------------------NK
QVQGVIRLAKKNGEKLGFLA
>gi|63029693|gb|AAY27742.1|	   232 residues, 50 /line  death-specific protein [Skeletonema costatum]
MMKNKQTALVAIMALSAAH---SLT-----------------AFVVNTSTR---NTIS--
-RSR-PLFSTTEESATTNILDDVTATPSEASEVIMDIPPVAPVAPVAPQ-KKSSVPKKKA
NAAHKEGVFSPIVMAASTILGQEQLNKVRAKAISIHSDLIKSFVGTSESAFGQGVLQQLF
KYVDADRSGYIDKEELSAALSSLGFKWLKEKQVNGIFKRADVNGDGMLSLEEFLAEAPRT
LKTNLVKLAKNNGGEMGLLV
>gi|115477893|ref|NP_001062542.1|	   125 residues, 50 /line  Os08g0566600 [Oryza sativa (japonica cultivar-group)]
---------------MAAAAASSVSLPGARA--------LP-TWSSSVSGDSHS-LAL--
-SSW--AARPRS--------------------------------ARPLR-AP----ARMG
NVNEGKGIFAPVVVVVRNIVGRKRFNQLRGKAIALHSQVITEFC----------------
KTIGAD----------------------------------------------------AK
QRQGLIRLAKKNGEKLGFLA
>gi|48093522|gb|AAT40138.1|	   81 residues, 50 /line  unknown [Bassia scoparia]
------------------------------------------------------------
----------------------------------------------PTR-AQ----PMMK
NVNEGKGIFAPVVVVTRNIIGKKRFNQLRGKAIALHSQVITEFC----------------
KSIGAD----------------------------------------------------AK
QRQGLIRLAKKNGEKLGFLA
>gi|147865676|emb|CAN81169.1|	   85 residues, 50 /line  hypothetical protein [Vitis vinifera]
----------------------------------------------------------MA
TSPV--RLRP-----------------------------------------------MMK
NVNEGKGLFAPIVVVTRNIIGKKTFNQLRGKAIALHSQVITEFC----------------
KSIGAD----------------------------------------------------AK
QRQGLIRLAKKNGERLGFLA
>gi|47026897|gb|AAT08671.1|	   79 residues, 50 /line  unknown [Hyacinthus orientalis]
------------------------------------------------------------
------RSRP-----------------------------------------------MMG
NVNEGKGLFAPLVVVARNLVGKKTFNQLRGKAIALHSQVINEFC----------------
KSIGAD----------------------------------------------------GK
QRQGLIRLAKKNGEMLGFLA
>gi|67968361|dbj|BAE00074.1|	   127 residues, 50 /line  PGR5 [Zea mays]
----------------MAA---AVSFSRVRA--------LP-TWSSSVSGDDHHAYSVLA
TSSV--SARPRS-------------------------------GARPLR-SP---AQMMG
NVNDGKGLFAPLVVVARNIIGRKRFNQLRGKAIALHSQVINEFC----------------
KTIGAD----------------------------------------------------SK
QRQGLIRLAKKNGEKLGFLA
>gi|67968363|dbj|BAE00075.1|	   123 residues, 50 /line  PGR5 [Portulaca grandiflora]
---------------MATT---SVSVSTLKG--------AAGSGSSFASGENYG-LLV--
-KSV--PAQVRI-------------------------------PKQAVR-L----RPMM-
SVNEGKGLFAPIVVVTKKILGQKQFNQIRGKAIALHSQVITEFC----------------
KTIGAD----------------------------------------------------AK
QRQGLIRLAKKNGEKLGFLA
>gi|67968357|dbj|BAE00072.1|	   125 residues, 50 /line  PGR5 [Amaranthus hybridus]
-------------MAMATS---SIPATGFKN-A--------GVGCSFASGENYG-MLV--
-KSV--SSQVRF-------------------------------PGRATR-AQ----PMMK
NVNEGKGVFAPLVVITRNIIGKKRFNQLRGKAIALHSQVITEFC----------------
KSIGAD----------------------------------------------------SK
QRQGLIRLAKKNGERLGFLA
>gi|67968359|dbj|BAE00073.1|	   123 residues, 50 /line  PGR5 [Portulaca oleracea]
---------------MATT---SVSASALKG--------YAGLGSSFASGENHG-LLV--
-KSV--KGQARI-------------------------------PKPGVR-A----RPMM-
SINEGKGLFAPIVVVAKNVIGQKRFNQIRGKAIALHSQVITEFC----------------
KTIGAD----------------------------------------------------AK
QRQGLIRLAKKNGEKLGFLA
>gi|116061038|emb|CAL56426.1|	   90 residues, 50 /line  PGR5 (ISS) [Ostreococcus tauri]
------------------------------------------------------------
-----MPTPMAP-------------------------------PRRRVG-P----ATRCG
NANEG-GVFAPIVRIARDAIGVKRFNQIRGKAISLHSQVIGDFC----------------
EEFGVD----------------------------------------------------SK
AKQTLIRTAKKNGGLLGFLA
>gi|145353224|ref|XP_001420920.1|	   65 residues, 50 /line  predicted protein [Ostreococcus lucimarinus CCE9901]
------------------------------------------------------------
------------------------------------------------------------
-------LFAPIVRVARDVIGVKRFNQIRGKAIALHSQVIGDFC----------------
EEFGCD----------------------------------------------------TK
VKQNLIRTAKKNGGKLGFLA


Ad blocker interference detected!


Wikia is a free-to-use site that makes money from advertising. We have a modified experience for viewers using ad blockers

Wikia is not accessible if you’ve made further modifications. Remove the custom ad blocker rule(s) and the page will load as expected.