Fandom

Proteins Wiki

At2g05590.2/MSA

< At2g05590.2

47,922pages on
this wiki
Add New Page
Talk0 Share
>gi|30678208|ref|NP_849938.1|	   303 residues, 50 /line  unknown protein [Arabidopsis thaliana]
-----------------MHALKD--KVSQKLSNLFADS------------PSQSASPRYS
--------------NSDSPKAR---LNSSVGKSLSSYFSFVVPQS---------------
------GNEEDSELCPPLPIRTESYECI--------------------------------
-------------------------------------------ENCKSANGQAKAGTFIS
IGEDKDCELRVSA-----------------------------------------------
-----KVEESGNDYFDGVKKMRELTE--SSVFITANLFEFLHASLPNIVRGC-KWILLYS
TLKHGISLRTLLRRSGE------------------------------------------L
PGPCLLVAG-D---KQGA-VFGALLECPL-----QPT--PKRKYQGTSQTFLFTT-----
---------------------------------------------------IYGEPRIF-
-RPTG---------ANRYYLMCMN--------EFLAFGGG------GNFALCLDEDLLK-
AT-SG-------------PSETFG------------------------NE-CLASS----
---------TEFELKNVELWGFAHASQYL-------------------------------
------------------------------------------------------------
-------S
>gi|108873533|gb|EAT37758.1|	   381 residues, 50 /line  conserved hypothetical protein [Aedes aegypti]
----------------EECYHCMAS---------------LVAPKDKVFITQ--------
-------------------------TKLLYEVTWKTVMQIAKK------------HAKSA
VLYLSRLCPGQKSERIF----MDWCWWILGGLPFP-------H---------------LV
RVMDCFFHEGIKVFYRVALAILILFHKHS-TATNSEWDADTIKNDIDNALPKFCKNIPVS
PAKLLRTAFSIRALSSTYISRIFL---KTEMVLKS-----------KSVLSG-S------
KQMVR-SRSSDNLPTSQS--QVNVQM--MSHTLTIRELFTLWSWLPVRITMY-QPVLLYT
TEEHGCSLTTFYVRVEQHE-----------------------------------------
--PTLLMIK-T---CNNE-VFGAYCSSRWFERNLKDDRGQRQAYFGTGETFLFS-LYP--
------------------------------------------------------ERAKY-
-PWVGIEGDKGLGHASELFMAADS--------KMITIGGG-----EGQ-AIWMDENIRF-
GK-TD-------------RCQTFN------------------------NP-PLCAS----
---------GDFEIRVLE------------------------------------------
--------------------------VYGFVG----------------------------
-------A
>gi|115471831|ref|NP_001059514.1|	   256 residues, 50 /line  Os07g0438700 [Oryza sativa (japonica cultivar-group)]
------------------------------------------------------------
----------------------------------------MLAWK---------------
-----------------------EKVADRLARLLA-------DS----------------
------------------------------------------------------------
-----------------------------------------------PASPS-S------
AAAAAAAVEPQLRVDALA--RRDYSS--VFRI----------------KRLCFGNKPECR
TWKHGTSLRTLFRRSENL------------------------------------------
QGPCLLIVG-D---MRGA-VFGGLLNGPL-----RPT--EKRKYQGTNQTFVFTTIYG--
------------------------------------------------------EPRLF-
-RPTG---------ANRYYYLCLN--------DALAFGGG------GSFALCLDEDLLH-
GT-SG-------------SCQTFG------------------------NS-CLAHS----
---------PDFELKNVEFRSLKSVPRVSK-----------IQSNFCWRK-------EQG
QVVGG--SV--GFYSFMGSFNIVGLGYIINEA--IP--------NP--------------
---NCPLV
>gi|145509883|ref|XP_001440880.1|	   152 residues, 50 /line  hypothetical protein [Paramecium tetraurelia]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------------------------------MSNMYKLS-DPFLIFA
SKTDGHSLKYLYTKCQDLN-----------------------------------------
DYPVLLVIQ-T---NQNI-IFGAFCDKML-----AV----KNKYVGSGETFLFT-LSP--
------------------------------------------------------EERKY-
-NPTS---------GNKDFMMCAP--------DYLAFGSG-----KNGPAFQIDSELNR-
GF-TY-------------QSDTFD------------------------NP-LFTDQ----
---------K--------------------------------------------------
---------------TQNRFKCLCIEVYYLK-----------------------------
--------
>gi|68471798|ref|XP_719942.1|	   345 residues, 50 /line  hypothetical protein CaO19_243 [Candida albicans SC5314]
-----------------MSF--------------------LFRRSTEQPRV---------
-------------------------NEEEPNKEIKDEPQHHQQEK---------------
-----------------------EDDNSKQEKLLS-------DSVT-EKPKEQPK-----
---PVKRRGTFFG-------------------------------------------NLLG
N--------------------------GSKNSSSA-----------SLNSSH-S------
SVSSS-SKFPPLGPLTLT--GYKEST--HHRLLDSELANNIRNLIPARFQLFDNWELVYS
LEQHGISLNTLYRNSNPEHQLRLLKKQ-KAAEKGFADSIVKNMVVGDTSRP-RYSFEPKR
SQSYVLVIK-D---NHNN-KFGAYLSENL-----KPM--EHRRYYGNGECFLWK-CEKYD
P----SKL-DH--------------------------------A-VDKRATQEIRFKAF-
-MYTG---------INDNIIYSNH--------DFIAIGSS-----NGQNGLFIDKSLLS-
GV-SY-------------SCDTFG------------------------NE-ILNSS----
---------PQ-------------------------------------------------
-------------NAKFGSFKIKGLEVWRIGT--LE------------------------
--------
>gi|118794171|ref|XP_321332.2|	   265 residues, 50 /line  ENSANGP00000024072 [Anopheles gambiae str. PEST]
-----------------MWY--LV----------------LVALSATLYF----------
-------------------------ASKRWGRQLYYRWGRLIPFR---------------
-----------------------RAIGNKSRPPTP-------PLIDTSVPAHLPA-----
---EEFDDGRLH--------------------------------------------TVLS
M--------------------------STDDYRKA-----------T--LFA-S------
GSFDQDFQIPDL------------VG--QTEILSEEHREKLCAHLPARAEGY-SWSLVFS
TSQHGFSLNSLYRKMHKL------------------------------------------
ESPILIVIE-D---TDHN-VFGALTSCSL-----HVS--D--HFYGTGESLLYK-FNP--
------------------------------------------------------HFKVF-
-HWSG---------ENLYFIKGNP--------ESLAIGAG-----DGKFGLWLDGDLNQ-
GR-SQ-------------HCSTYS------------------------NE-PLAPQ----
---------EDFVIKTLE------------------------------------------
--------------------------CWAFV-----------------------------
--------
>gi|24644183|ref|NP_730914.1|	   267 residues, 50 /line  l(3)82Fd CG32464-PC, isoform C [Drosophila melanogaster]
-----------------MWF--AIS---------------LFAILAVCGL----------
-------------------------AGRRWGRYLYLHYGRHLLPR---------------
-----------------------SLLSAKNRAPTP-------PLSPTKDDQSLEA-----
---LLDESGEMHE-------------------------------------------TVLS
M--------------------------STDEYRKT-----------S--LFA-T------
GSFDLDFPIPDL------------IG--KTEILTEEHREKLCSHLPARAEGY-SWSLIFS
TSQHGFALNSLYRKMARL------------------------------------------
ESPVLIVIE-D---TEHN-VFGALTSCSL-----HVS--D--HFYGTGESLLYK-FNP--
------------------------------------------------------SFKVF-
-HWTG---------ENMYFIKGNM--------ESLSIGAG-----DGRFGLWLDGDLNQ-
GR-SQ-------------QCSTYG------------------------NE-PLAPQ----
---------EDFVIKTLE------------------------------------------
--------------------------CWAFV-----------------------------
--------
>gi|123487300|ref|XP_001324912.1|	   354 residues, 50 /line  TLD family protein [Trichomonas vaginalis G3]
-----------------MSI--------------------VSKISVQQPSSL--------
-------------------------KNLMPVREEVHRIYGVADFNGFNIEIPSSMYQHGI
ELYIELDSTDFQIPKMTVIRLIGIIKLSISEYPMP-------HGNVDPNDPNLPAVLSIT
YLYDVFNHSSVNVINFIAIRRLL----------------ENFKDEVESIIRVLKSGLNMS
P--------------------------SLDNLNKK-----------L--RMR-A------
QSFDLEYLANQQQLLRQN--KFKITG--ESTILTSAEIEHIRLFMPKRYRLL-SWELLYS
ADNDGVSFSTFYSKAMK-------------------------------------------
KMPAILIVL-G---RDGS-RVGAFLSSGI-----EE----KHGFYGTGETFVFH-FDP--
------------------------------------------------------YFAGF-
-RWSQ---------NNDLFISTTR--------KDLMIGGGSRDSVNNGSAIYIDDNFMN-
CY-SQ-------------DCETFN------------------------SP-KLGKS----
---------ESFPIVAVE------------------------------------------
--------------------------LWHAH-----------------------------
-------P
>gi|50288659|ref|XP_446759.1|	   271 residues, 50 /line  unnamed protein product [Candida glabrata]
----------------------------------------MFNVKGALNRL---------
------------------------------------------------------------
------------------------------------------------------------
----------------------R----------------TTWSNSEESD---------RD
P--------------------------RHLKSSDD-----------LS-----N------
YTGSRMSYEETLPPVTLL--GYSPKT--KNRLLHPEMCDELRPLMPTRIQLYTEWTLLYS
LEQHGASLHSLYDKLREDAS-------------------------------------TPR
RVGYVLVIK-D---RKDG-IFGAYSNEPF-----HPH--EHMRYSGNGECFLWK-MESVP
N----KIL-RAKIREDKDED------------LIDVNDDEDKIN-NSGTVNESWKLCAY-
-PYTG---------ANDFMIYCTS--------KFLSLGAG-----EGHYGLWCDDGLMK-
GV-TN-------------PTQTYG------------------------ND-VLSRE----
-------G-RKFTIMGLE------------------------------------------
--------------------------VWRVG-----------------------------
--------
>gi|6325060|ref|NP_015128.1|	   273 residues, 50 /line  Oxr1p [Saccharomyces cerevisiae]
----------------------------------------MFGVKDAIFKI---------
------------------------------------------------------------
------------------------------------------------------------
----------------------K----------------RSIAGTDSSDSTAYTTASESS
P--------------------------QLKDSHNP-----------FR--NK-T------
TSERTIVEEGSLPPVRLN--GYLPST--KNKLLTPEMCDEIRTLMPTRIQLYTEWNLLYS
LEQHGSSLHSLYSNVAPDSK-------------------------------------EFR
RVGYVLVIK-D---RKNG-IFGAYSNEAF-----HPN--EHRQYTGNGECFLWK-LDKVP
D----VNI-SEK--EESEQE------------GKEGK--------EEGDKEERWRFSGY-
-PYTG---------VNEFAIYCTS--------EFLSMGAG-----DGHYGLLCDDGLLH-
GV-SN-------------PCQTYG------------------------NE-VLSKE----
-------G-KKFSIVALE------------------------------------------
--------------------------VWRVG-----------------------------
--------
>gi|50511015|dbj|BAD32493.1|	   274 residues, 50 /line  mKIAA1609 protein [Mus musculus]
---------------------------------------------TKAESSR--------
-------------------------EQARWG-----------------------------
----------------------------------------------------MPRACRA-
------------------------------------------------------------
------------------------------------------------------------
----------------RR--WPQGSC--PRSILDVLSVIYLSSHLAPEHR--QRWRLLFS
TQLHGQSFSQLCSHITS-------------------------------------------
QGPSLLVLE-D---RDGY-VFGGFASCSW-----EVK----PQFQGDNRCFLFS-IAP--
------------------------------------------------------RMATH-
-LHTG---------YNNHFMYLNY--GQQTMPNGLGMGGQ-----HHYFGLWVAADFGK-
GH-SK----------AKPACTTYN------------------------SP-QLSAQ----
---------EDFLFDKMEVWGLGNLLENMRARTRRASWTQIPKPVACWRS-------ADG
LGTAR--DC--GKSPGMRTEIRQPLRALLDGE--HPGAGAGLPQGC--------------
---RAESV
>gi|116056824|emb|CAL53113.1|	   240 residues, 50 /line  Oxidation resistance protein (ISS) [Ostreococcus tauri]
----------------------------------------MEEGTTGGTEVD--------
-------------------------VL---------------------------------
------------------------------------------------------------
-----------------------YRRRDG-TAASARVRA---------------------
-----------EDGHDGFLGKVL------KSWTAA-----------MADETP-E------
ERRGASALAATSERVTKS--ELKRSA--SSDIMSAEQMETLREALPAMCRMR-EWTLTYS
TKRDGISLKSLYRRSSGKE-----------------------------------------
--NTVLVVS-D---SGGA-IFGAFCTEAW-----KL----HSRYVGTGESFVFS-LAP--
------------------------------------------------------EGMKY-
-AWSG---------ENDYFMLGAA--------DSLSVGGG-----SAH-AIRLEEDLLQ-
GS-SG-------------ECETFD------------------------SP-PLASS----
---------DMFRVSRIE------------------------------------------
--------------------------LWSLD-----------------------------
--------
>gi|123500110|ref|XP_001327772.1|	   385 residues, 50 /line  TLD family protein [Trichomonas vaginalis G3]
------MKKWINYIRFCKFFTILNQIFRHFFDFKKQKMSILSPVSVCRPSSL--------
-------------------------KEFMPLREEVHKIYGVADFNNLGVQIPSSLYYHGI
ELYFEHDSIEYNMPRSTVISIIGIIKITISDYFSP-------HGDMDPSDPDKPALLVIT
HLADVFNQNTVNVITFTAIRSDL----------------EKFKREVEAIIQKLKSGINIS
I--------------------------STDNLHKK-----------L--RTR-A------
QSFQIEALMNEQAMLREN--KFIMSQ--ESSIVSLPEIENIRLFLPKRFRLL-PWKLLFS
AAEHGVSFSTLYEKTDKK------------------------------------------
-TALVLILL-G---KDGS-RVGAFLPEGI-----QIR--D--GFYGNGETCVFH-FNP--
------------------------------------------------------YFAGF-
-RWTQ---------NNDLFLSCSK--------KDIIIGGGSQRSLDHGSAIYIDDNFMN-
CF-TS-------------QCKTFD------------------------SP-PLANN----
---------ESFKIIAVE------------------------------------------
--------------------------VWHVH-----------------------------
-------H
>gi|125578565|gb|EAZ19711.1|	   408 residues, 50 /line  hypothetical protein OsJ_033920 [Oryza sativa (japonica cultivar-group)]
------MASRAFSRQE--------------------------------------------
---------------------------LDDLRALFVSLAAQSQTGGRAISRPVFLEYFGI
RGALGDRLFQLVARESGGGEGVTFEDLIVSKATYE-------RGTRDEVDEFIYQLCDVT
GDE-----------------------------VLERSDLETILASIRETIFSENKEAGEG
SNKRTFEAFINSAVFSKDAEGVARKSMSLSDFRSWCILIPSLRKFLGSLLMP-P------
DSGRPGFQVPALHYLE------NISP--DLLLLNKEYAWHIGGGFSQ--QEVQEWRLLYH
SSLHGQSFNTFLGNVTNG------------------------------------------
DAQTVIIVK-D---TEGF-VFGGYASHPW-----ER----HSDFYGDMKTFLFK-LYP--
------------------------------------------------------EASIF-
-RPTG---------GNRNLQWCAVNFSSDSIPNGIGFGGQ-----PHHFGFFLSANFDQ-
GH-SF-------------TCTTFT------------------------SP-ALSKT----
---------NRFRPEVIECWGIQTKGALD----------------------------EKA
ELVKG--TVLERFKEDRNMLKLVGLANAS-------------------------------
-------D
>gi|55730305|emb|CAH91875.1|	   349 residues, 50 /line  hypothetical protein [Pongo pygmaeus]
-------MGAAHSVWE--------------------------------------------
---------------------------VDHLY-------------AFFVQWSPDVY----
-----------------------------GKDAKE-------QGFVVVEK-------EEL
NMIDNFFSE----------------------PTTKSWEI---------------------
--------------------------ITVEEAKRR------------KSTCS-Y------
YEDEDEEVLPV------------LRP--HSALLENMHIEQLARRLPARVQGY-PWRLAYS
TLEHGTSLKTLYRKSASL------------------------------------------
DSPVLLVIK-D---MDNQ-IFGAYATHPF-----KFS--D--HYYGTGETFLYT-FSP--
------------------------------------------------------HFKVF-
-KWSG---------ENSYFINGDI--------SSLELGGG-----GGRFGLWLDADLYH-
GR-SN-------------SCSTFN------------------------ND-ILSKK----
---------EDFIVQDLEVWAFEMPCVFIS----IIFITKMYSYYLPWKRLVSFRKIESA
QHLKG--IYEVFFKKKKTF--IYYLMCWCEISGMSHDITFTIYTVCNHMLLIKWKKTKWS
FCIYFTLT
>gi|71665299|ref|XP_819621.1|	   323 residues, 50 /line  hypothetical protein Tc00.1047053510303.299 [Trypanosoma cruzi strain CL Brener]
-------------MTL----------CVHLWGSVEGEGP------------R--------
-------------------------KNNRKQNEKGGAHPPRWW--GVGAVFPGEEFYQMG
GLFTR-------------------------------------------------------
------------FIPFMCFDR---------------------NDDAEGMQATPPPPFDVG
V-----------------------------------------------------------
------ALEEVPPDVYLK--RETAIK--PSIPITGKQFLTLQEHIPPRFQG-RRWRLLFC
SGLHGFSRLALQQNCAEE-----------------------------------IRSARGN
ERPAVLIVSAG---SEGKILLGAYISCIP-----QTS---NKKYVGTEESFLFC-VPSPS
S----------------------------------------SSS-ALSS---SDDLHIFT
APADA---------ANRYFMRCDN--------GAIAFGGGG-----KGPALFLHSDFASV
SC-ST-------------FCPTFGIRESLLLLNARPGGDGDAAVFDLPND-VHLEG----
-------GEPTTSVRAVQLWTIGDE-----------------------------------
------------------------------------------------------------
---YFSLL
>gi|109092158|ref|XP_001097769.1|	   341 residues, 50 /line  PREDICTED: similar to oxidation resistance 1 [Macaca mulatta]
---------------------------------------MSRASGDPGPLHQ--------
-------------------------VQQNRVSSSCGKMAQAICEMAFPVGTRVGTGPRLA
ALWADIRAREESPEPEPGQRASHLPGDQGSELNRP-------HTDHQVGRVSAMCGPLSG
DQGDTLKAGAEDSLTAHGRPGRDRR------MRGLRWRYTRLPTQVEDTL----------
---------------------------SGEEGNE--------EEEEEEAAPD-P------
AAAPEDPMVPQL------------TE--ASQVLSASDIRQLSFHFPPRVTGH-PWSLVFC
TSRDGFSLQSLYRRMEGC------------------------------------------
SGPVLLVLR-D---QDGQ-IFGAFSSSAI-----QLS--K--GFYGTGETFLFS-FSP--
------------------------------------------------------QLKVF-
-KWTG---------SNSFFVKGDL--------DSLMMGSG-----SGRFGLWLDGDLFH-
GG-SS-------------PCATFN------------------------NE-VLARR----
---------EQFCVQELEAWLL--------------------------------------
------------------------------S-----------------------------
--------
>gi|109471193|ref|XP_001067715.1|	   262 residues, 50 /line  PREDICTED: similar to oxidation resistance 1 [Rattus norvegicus]
--------------------------------------MTVVAKGTPMHLEA--------
-------------------------MEKGCVLLR--------------------------
------RARHCWPE--------------------A-------RTQHFLRQAQGLHPVLSS
D-----------------------R------MKGRQWRYTQLPTEMEDTL----------
---------------------------SGEEGEE--------EE-EEEP-----------
APAPQDPVEPQL------------TE--ASQVLGASEIKQLSLHLPPRVTGH-PWNLIFC
TSRDGFSLQRLYRQMEGH------------------------------------------
SGPVLLLLR-D---QDGQ-MFGAFSSSAL-----RLS--K--GFYGTGETFLFS-FSP--
------------------------------------------------------QLKVF-
-KWTG---------HNSFFVKGDL--------DSLMMGSG-----SGQFGLWLDGDLYH-
GG-SY-------------PCATFN------------------------NE-VLARR----
---------EQFCIRELEAWAL--------------------------------------
------------------------------S-----------------------------
--------
>gi|126291249|ref|XP_001371863.1|	   213 residues, 50 /line  PREDICTED: similar to chromosome 20 open reading frame 118 [Monodelphis domestica]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------------------------------MRGLRWRYTQLPTQPDDPL----------
---------------------------PGEN-EA--------EV-MAQAMPTAQ------
GPGIEEAWVPTL------------G---ESKVLHVEEFRQLVPHFPPRFIGH-SWTLVYC
TARDGFSLKNLYRRMEGQ------------------------------------------
SSPVLLVLR-D---RDGQ-IFGAFSSTAI-----RVS--S--CFYGTGETFLFS-FSP--
------------------------------------------------------QLKVF-
-KWTG---------RNSFFIKGDQ--------DLLVMGSG-----SGHFGLWLDGDLNH-
GG-SR-------------PCATFN------------------------NE-VLARQ----
---------EEFFLQELEAWTL--------------------------------------
------------------------------S-----------------------------
--------
>gi|149733621|ref|XP_001499534.1|	   180 residues, 50 /line  PREDICTED: hypothetical protein [Equus caballus]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------------------------------MKGLRWRYTRLPSQVEDAL----------
---------------------------SAEAGEEE-------EEEEEETAPA-P------
APAPEEPTEPSL------------AE--ASQVLGASEIRQLSLHLPPRVRGY-SWSLAFC
TSRDGFSLRSLYRQMEGH------------------------------------------
SGPVLLVLR-D---QDGQ-MFGAFSSSAI-----RLS--K--GFYGTGETFLFS-FSP--
------------------------------------------------------QLKIT-
-DWW------------------------------FPEGKG-----VGEDGTGEGGRASG-
DG----------------------------------------------------------
--------------RKLDS-----------------------------------------
------------------------------V-----------------------------
--------
>gi|116179622|ref|XP_001219660.1|	   361 residues, 50 /line  hypothetical protein CHGG_00439 [Chaetomium globosum CBS 148.51]
-----------------MAFDAPNHNQPPR--------TRHTPDLNLSP-----------
---------------ASSR------SVTPPGTASPSSSTFLTSSVSS-L-----------
------------------------------------------------------------
-------------------------------WGGFMRRFSSEPSPSTP------------
-------------HPPGLPHARTFQPDGGDKRQHH-----EDSHGNGLDGVYTPPHTLYP
HRTASPMGLPPLEPLQLL--GFSEETPQDARLLTAPVAEEIRIMVPARLGIVDEWRLVYS
LEQDGASLATLYEKCAQYQ---------------------------------------GV
RVGFVLCVK-D---CDGG-LFGAYLSDYP-----HP----APKYFGTGECFLWR-ASVLS
PLPPPPSLIDNDDTNANLRTTTISAAPHNINTNGNG-NNNNVKPPSRTPTPQPIRFKAF-
-PYSG---------INEYYMLCEA--------HFLSLGAG-----DGKYGLWLDDSLER-
GV-SS-------------TSQTFG------------------------NE-PLSDE----
-------G-EKFGVLGIEVWVIGA------------------------------------
------------------------------------------------------------
--------
>gi|46124017|ref|XP_386562.1|	   326 residues, 50 /line  hypothetical protein FG06386.1 [Gibberella zeae PH-1]
-----------------MSFS----------------------DRNDSP-----------
---------------ETPESSG---TGTPVNSNRASA-----SYITN-M-----------
------------------------------------------------------------
-------------------------------WTGLIRRFSSEGSFPSQ------------
--------------------ADTAYDDNFNYHDGN-----GHNTKDGINGVFSPVR----
-RTASPMRPPPLDPLILH--GYRQGTPSSAKLLSAAVAEEIRTMVPERLRIVDDWNLIYS
LEQDGASLATLYQRCRQFE---------------------------------------GK
RAGFVLVVK-D---LEGG-VFGAYLSEYP-----HP----AHTYFGNGECFLWR-ASNIT
PLPPPPSA---DTTNLNSRNTTLAPPPPSSEAN----TPTHSRP-ASPTPSEAVRFKAF-
-PYSG---------LNDFCINCET--------GFLSVGSG-----GGHYGLWLDNGLEV-
GH-SS-------------RCETYG------------------------NE-PLSDE----
-------G-TKFGVIGVELWVMGV------------------------------------
------------------------------------------------------------
--------
>gi|74620175|sp|Q874Z5|OXR1_PODAN	   346 residues, 50 /line  Oxidation resistance protein 1
-----------------MSFYTSSSSQKTH-----NLNTRQSPDPDSSP-----------
---------------ASSP--G---AITPTTSHTE---TAGSSYFSNLL-----------
------------------------------------------------------------
-------------------------------WGGLFRRFTSEPSPSLST-----------
-----------ENSPPTLRHAHTYQPDGEDDGR---------NLGKSVDGIYTPPH--FH
HRVPSPMGLPQLEPLQLL--GFSARTRTESRLLTPAIAEEVRNLVPTRLSIVDEWNLVYS
LDQDGSSLATLYDKCDRYR---------------------------------------GK
RVGFVLAVR-D---TEGG-IFGAYLSDVP-----HI----APNYFGTGECFLWR-ASVQA
PLPPPPSLIDSEDTPDVGRSTTIRAEQNVAS---------------GQVNAHSIRFKAF-
-PYSG---------VNEYYMLCGQ--------QFLSVGAG-----DGRFGLWLDSGLEK-
GV-SS-------------TCQTFG------------------------NE-PLSDE----
-------G-EKFGVLGVELWVIGA------------------------------------
------------------------------------------------------------
--------
>gi|119112668|ref|XP_317751.2|	   407 residues, 50 /line  ENSANGP00000010196 [Anopheles gambiae str. PEST]
WGSQMD------------------PRLAQY------------------------------
----------ITNFLFGPLGARSPVVEFQRFAELYVY----CVRGTIDERINVLLCSLGQ
QPESESTEI-------AYPLIKEYVEAVVSSYMRAIRLEGGPQYKSWESRGFRIVKDCIQ
KLAESLAYDVVQQGTQKVTRA---------------------------------------
---DAERWLHKNPTFLKMLEHVFSHLYHYRNTDGNARKSII-------------------
PQEALQSMLPYCEGLQYVPDYPAFTD--------LSQMLFINSNLPGT-QQN-KWRFLFS
SQIHGESFSTLLGRIMD-------------------------------------------
QGPTVVIVE-D---ANGY-IFGGYATDSW-----ALS----PNYVGNENSFLFT-LRP--
------------------------------------------------------KMRCF-
-SSTG---------YNDHYQYLNL--HQQTMPNGMGMGGQ-----HNYWGMWLDSEYGL-
GECSE-------------SCTTYK------------------------GYFQLSAT----
---------KKFNIRNVEVWGVGDKPVKE----------------------------DEG
DEKSGARSVLDGNADS----------------KAILKMSGREQYSDGYREEPK-------
-------D
>gi|146413449|ref|XP_001482695.1|	   309 residues, 50 /line  hypothetical protein PGUG_04650 [Pichia guilliermondii ATCC 6260]
------MSEEKLTSNPEDQRVY--------------------------------------
-----------------------------------NEKEEVVDIETS-------------
---------------------------------------------------------SSL
PRKQIEKRPSLLD------------------------RLMRRGSESKEQ-----------
-------------------------------------------------------ENSNP
QAPEREDELPPLSDLKLV--GYKETT--RRRLLGGELAHNIRNLVPRRLQLASEWNLVYS
MEQDGISLRSLYRNNDRDQQVAQVKRQRKTVDAGYASLVVNSMVGS-----HEYHNEIRR
PVGYVLVIQ-D---STGA-IFGSYLNENL-----RLM--EHKRYYGNGECFLWK-CERTG
D--------------------------------------------------GSMRFKAF-
-VYTG---------INDNIIYSNS--------QFIAIGSS-----DGHNGIWIDKLLCS-
GV-SA-------------YCETFG------------------------NE-VLCGSSHAS
GSRPNAKE-SRFEIIGLEVWRIGDP-----------------------------------
------------------------------------------------------------
--------
>gi|66803773|ref|XP_635716.1|	   308 residues, 50 /line  hypothetical protein DDBDRAFT_0188865 [Dictyostelium discoideum AX4]
-------MGSSSSKHH--------------------------------------HHHHHH
NNNN--------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------NNQTNIEQQEKNEINNNN-------
NKNQFYVKVPE------------LTE--KSKLLNDEHIRWISRYLPDDSYRE-TWKLLFS
SSRDGHSFNRFQHHSTEK------------------------------------------
GSII-VIVKEE--GEEGH-IFGGFCDENL-----KIK---YPKFYGNKNNFVFT-LKP--
------------------------------------------------------EIEIF-
-RSTG---------LDQCFQYFNA--------DSKTLFNGFAMGGELLYAFSIDHLMEN-
GE-SKGSDEILSNGDGKPRASTYG------------------------NT-MLSSQ----
---------AEYKIEYVEVYGCKDLELTEE-----------QILNIQYQNRNKKGGITGA
GQKSV--LRDEDNAD-----------------KVIKGMMGDHEFTNYHEDINEANKDKKI
TTPLH--K
>gi|123412450|ref|XP_001304065.1|	   387 residues, 50 /line  TLD family protein [Trichomonas vaginalis G3]
----MSDQDLTYEVQPNDSLSSISLKFRVTVAWIKLL-NPNLDSNIHPGQSIIIMKPE-I
LDECITIKNI--------------------------------KVFPAEANDKGILRCDKV
SLRYLPDS---SYGKPLVINLLGHLESAIMPHPTFMLT----PGFTDPFADNALSLFVIS
YITD-FNTNKFETISFEGLRGDL----------------LKLHHNLLLKAEAAQSAKQFV
VP--------------------------------DINSAAAQRRN----RTISD------
LTVEMNAHRNATNKKRNKLRQINVVG--SNKILTLQEMEEIRLCLPYQYINA-GWKLLFQ
LSNDGSSYLSFFEKTRNI------------------------------------------
QPVVLLIL-TD---KKEK--IGAYISKGL-----KV----QRNFYGNGETFVFK-YHP--
------------------------------------------------------TFSYY-
-RWTN---------ANQYFVSSSK--------DEIAIGGG------GASALWVDSCFIS-
AI-SE-------------PCPTFN------------------------SP-ALTSV----
---------PHFKIVDCEVWQLSEH-----------------------------------
------------------------------------------------------------
-------I
>gi|123415681|ref|XP_001304737.1|	   377 residues, 50 /line  TLD family protein [Trichomonas vaginalis G3]
MQQPAEEKEEIYAVQPHDTLVTIAVKFGLTVQWLRDL-NNISSDFIYNDMKLIIK-PPNI
LDTILVAENVSILSEDLQILPE-------------------------NEQVLGKLTCKGA
LLAFIPYS----KGTTLFVDLCGNLEHTHLPSPAIKS-----GKHISSR---DPELLIIT
FFPDINDLSKTETLAFVGSSMEI----------------TPLSDLIGKQTKEIQRRMNFT
P----------------------------------------------------V------
RPQHNDSKTEKVVQKKAKLQSVELRG--TSTIADENMIEQVRRYLPYQFRLA-NWNLLFQ
LSNDGASYLTFFEKCKDK------------------------------------------
-SPAVILIR-T---DSGD-KIGAYISAGF-----KLS----KRFYGNGETFVFT-FNP--
------------------------------------------------------KLHAY-
-RWQN---------SNQYFICSTK--------EEIAIGGG------GSTAIWIDGTFLN-
AV-SD-------------PCTTFG------------------------SP-SLTKT----
---------PYFKIHELEVWSISQ------------------------------------
------------------------------------------------------------
-------F
>gi|123418021|ref|XP_001305231.1|	   372 residues, 50 /line  TLD family protein [Trichomonas vaginalis G3]
--MSEQTDTEHYIVQENESLSSIATKLDITLLNI------------------KTLNPNVK
VAIPGMI------------------LNVKPIKELPHLHPIDSQIFSRAPPIDGDLYLDET
QIRFQPRG---KREKPILIDLIGYVDATITPHPCDFY-----DDVDEVLPDDFLALLHVN
YLSIPSDPTSMEIIEFAGLHEEL----------------RDFKTVLQQRSTAIQVKSHYT
RP------------------------------LMSTYIKPVEETKRRVS-----------
---------------DFCLEFEGLPD--PSKIMTPTEMGQLNNSLPKRLRKL-EWHLVYR
LSDDGSSYNEFMTKTRGL------------------------------------------
DQ-CVLVMKT----DGDS-IIGCYSSAGF-----DP----KKAYAANGETYVFS-FFP--
------------------------------------------------------SFVAY-
-RWSK---------TVNYFVNVDK--------TNLSIGGG------GSAAIWLDDRMLH-
GF-SE-------------KCDAFN------------------------NP-PLASD----
---------VDIKCMNLEVWHISY------------------------------------
------------------------------------------------------------
-------K
>gi|125847607|ref|XP_001331985.1|	   255 residues, 50 /line  PREDICTED: hypothetical protein [Danio rerio]
-------MGVAYSVGE--------------------------------------------
----------------------------------------------VDHLYTFF------
------------VEWSPENIYSHKHSRKQ-------------------------------
--------QEFLQVHPDALSVIGSLLK---DSPPENWQI---------------------
--------------------------VSVK------------QQKRRTSVCS-S------
ADSESDDLLPV------------LIN--HSQILKELHLEQLMSHIPARAQGN-QWKLVYS
TAVHGTSLRTLYRQMAEL------------------------------------------
DRPVLMVIR-D---TDGQ-VFGAFSSDPF-----RVS----SYCYGTGETFLYS-FSP--
------------------------------------------------------EFQVF-
-RWTG---------ENSYFVRGFL--------DSLQMGGG-----GGPFGLWLDADLYR-
GS-SY-------------SCNTFC------------------------NR-PLSLH----
---------HDFTVQELEVWSFV-------------------------------------
------------------------------------------------------------
--------
>gi|145252032|ref|XP_001397529.1|	   302 residues, 50 /line  hypothetical protein An16g02160 [Aspergillus niger]
------MSSSS-------------------------------SSRSGSRPPPTT------
---------------STSTTAT---TPSSLQQSAASYFSYPVTHV---------------
------------------------------------------------------------
-------------------------------VSGLYRRLTDPSTNTTNNMRRKTTTTDTT
T---------------------------------------------NNNPVFTP------
IRTASPFQPPPLTPL-------TLSD--PSTLLTRSLAEEIRLLVPPRLQLCNTWHLAYS
LDRDGASLSTLYDNCRDIAS------------------------------------TRSP
RAGYILVIR-DASPSSNA-VFGAYMTDPP-----HPD----SHYYGTGECFLWR-ASVLP
P----ATA-MLS--NFSNAN------------GDNGG---------EEGVEADIRFKAF-
-PYSG---------VNDYMMFCET--------GFLSLGGG-----DGHYGLWVDSSLEK-
GV-SA-------------SCQTFG------------------------NE-PLSDE----
-------G-VKFDIIGVEVCY---------------------------------------
------------------------------------------------------------
--------
>gi|149245492|ref|XP_001527223.1|	   380 residues, 50 /line  oxidation resistance protein 1 [Lodderomyces elongisporus NRRL YB-4239]
-----------------MSFLFR--------RSL----ELNRPRKARTEEQLL-------
-------------------------------------------------------HQKKV
ADTGDEGNSNNVPELEPDPEQKPEL-DLDQEHKHE-------HE---SSASPIDDTGSGS
EKTSLKKRPTFLQSLMRVSSGNGSSSS---LKSSTSSSS---------------------
--------------------------SQLS------------GIP---------------
----------PLPPLVLA--DHKGNI--KNRLLDIELATNIQSLLPARLQLFDTWDLVYS
LSQHGMSLNTLYRNSKPEHQLQELKKR-KKAEKGYADAVVKKMMVADFPKQGGFTIEQRR
PQGYILVIK-D---EHNA-KFGAYLNEYL-----KPM--EHKRYYGNGECFLWK-VENYD
P----STLISHNEKPN------------------------KDSS-ESSSKNNATRFKAF-
-MYTG---------INDNIIYSNR--------DFIAIGSS-----HGENGLYLDQSLSS-
GV-SY-------------PCETFG------------------------NE-ILCLNT---
--KKNPKA-GSFKIMGLEIWRVGTL-----------------------------------
------------------------------------------------------------
-------E
>gi|30692556|ref|NP_195697.3|	   394 residues, 50 /line  unknown protein [Arabidopsis thaliana]
-------MGK-------HKSFRS--KAVHFVTDL----TAGLLNPISDKPSSA--HPPP-
PLPDEEDESKRNQLESTTAEQP---KDLVDEPDTSSFSAFLGSLLSSDPKDKRKDQDPED
EEDEEEDEEEDSEAETSDTSSSSANPTRTMKETTS-------GGAAKKSFLSKYKQHF-R
NFYQAVKFPGVKERKGNSDVIPDDEETEYYDGL---------------------------
-------------------------------------------------EMKPM------
QNNNVK----EEVTVVVQAIIPEISE--PSLLLSEQSRRSLYTSLPALVQGR-KWILLYS
TWRHGISLSTLYRKSLL------------------------------------------W
PGLSLLVVG-D---RKGS-VFGGLVEAPL-----IPT--D-KKYQGTNSTFVFT-N----
---------------------------------------------------KSGQPTIY-
-RPTG---------ANRFYTLCSK--------EFLALGGG------GRFALYLDSELLS-
GS-SA-------------YSETYG------------------------NS-CLADS----
---------QDFDVKEVELWGFVYGSKYDE-----------ILAHSKTME----------
---------------------------------------------------PGLCR----
------WS
>gi|47221901|emb|CAF98913.1|	   355 residues, 50 /line  unnamed protein product [Tetraodon nigroviridis]
----------------------------QFLEDL----ISSVVQILVLRERLRGWKPEKM
GEISPGVKL------------------------LAEQMCSELKTT---------------
----------------------------------------------GGLLITRAVSPSET
GESDISCLEDWIF---RI------------SQVSLYLEI---------------------
--------------------------LVTE------------GLNVSLSGR---------
----------PAPDLLPPCRETPWDG--LRCLLDIPTVMFLAPQLPDGL-A-APWRLVFS
TRLHGESFTRMVAGLSR-------------------------------------------
HGPTLLLIK-D---TKGH-VFGGFASHAW-----EL----KPQFQGDSRCFLFT------
---------------------------------------------------VSPKLRVF-
-STTG---------YNDHFMYLNQ--HQQTMPNGLGMGGQ-----HDYFGLWLDSDFGR-
GH-SR----------ARPTCTTYG------------------------SP-QLSAE----
---------EDFSLDSMEVWAVGKPPEPED-----------VRGRGSWQKERPGHGSGSS
GHYGD--------------------------DGEVSAQPGTPRTGGGPGRVRKPWKIRKL
VCRHRFVS
>gi|47230057|emb|CAG10471.1|	   152 residues, 50 /line  unnamed protein product [Tetraodon nigroviridis]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------------------------KLSKELPPRTIGH-SWTLAYS
TSRHGASLKTLYRKLSA------------------------------------------S
DSPVLIVIK-D---ALDE-IFGAFLSHPL-----RPS----ETFYGTGETFLFM------
---------------------------------------------------LHPRYKCF-
-RWTG---------ENSFFIKGDL--------DSFAIGGG-----SGHFGLWVDENLYL-
GR-SS-------------PCFTFN------------------------NC-CLSET----
---------DDFRIMDLEAWTF--------------------------------------
------------------------------------------------------------
--------
>gi|50554321|ref|XP_504569.1|	   229 residues, 50 /line  hypothetical protein [Yarrowia lipolytica]
------------------------------------------------------------
-----------MDSSDRPSLRQ---RLSNWGRTDTKPAAT--------------------
------------------------------------------------------------
------------------------------DLTAPPNDP---------------------
--------------------------SENM------------ELP---------------
----------PLPPVELL--GYSHST--RTKIMTTELADEIRNLVPERIKLYRSWQLQYS
LEQHGTSLTTLYHRNIPPH-------------------------------------GDTA
RNGFVLAVK-N---SRGQ-VFGAYTDQHY-----HV---GGKKFYGNGDCFLWK-VKNA-
-----------------------------------------------------DSFQAF-
-PYTG---------ENNFVVYCNP--------HFLSLGGG-----DGKYGLWLDDALKT-
GV-TY-------------PCATFG------------------------NE-PLGD-----
---------EKFDVVAVEVWRVGE------------------------------------
------------------------------------------------------------
--------
>gi|125554587|gb|EAZ00193.1|	   368 residues, 50 /line  hypothetical protein OsI_021425 [Oryza sativa (indica cultivar-group)]
-------MGY-------LPSLGG--KAAHLVSDL----ATVILNPVSERESQR--HPSHL
PEATEVQENIYEDDDDDDSVKN---SEIPNGPDTSSFRAFLMSFMSSSNSSSDS------
------------IEIIPEHNMNMEYPTLTPVGKGS---------NGRKGLFSRGKHSIGK
IINKAGRIGGFRQ---KPSYSIDGET----------------------------------
--------------------------------------------V-QTEYDAPG------
LELKG------SKESASHDKLPAMSE--PSMLLSETMRTVLYTSLPVLVQGR-NWMLVYS
TWRHGISLSTLYRRSML------------------------------------------C
AGYSLLIVG-D---RKGA-VFGGLVEAPL-----QPL--IKKKYQGTNNCFVFT-N----
---------------------------------------------------IAGRPVIY-
-RPTG---------ANNYFTFCST--------DYLAMGGG------GHFALYLDGDLLN-
GS-SS-------------TSETFN------------------------NP-CLSRS----
---------REFEVKDVELWGFVNASKYDE-----------MLTICRTEK----------
---------------------------------------------------QGIWNL---
--------
>gi|149391277|gb|ABR25656.1|	   261 residues, 50 /line  unknown [Oryza sativa (indica cultivar-group)]
------------------------------------------------------------
-----------------DSEQN---SDTPDGPDTSSFRAFLISFLSSSGSSNGS------
------------MEIIPDQNGELGYPTLTPMGKSK---------KGKSGLLSRGKHSIGK
IISKAARIGGFKQ---NVEPKIDREV----------------------------------
--------------------------------------------VDHVESVSPV------
LELEE------SKEVASFINLPAMSE--PSVLLSEVMRFNIYASFPVLAKGM-NWVLLYS
TWRHGISLSTLYRRSML------------------------------------------C
PGYSLLVVG-D---KEGA-VFGGLVEAPL-----QPT--SAKKYQGSNSCFVFT-N----
---------------------------------------------------LHSNPSIY-
-RPTG---------ANNYFTVCST--------DYLALGGG------GHFALYLDADLLS-
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------
>gi|47224060|emb|CAG12889.1|	   268 residues, 50 /line  unnamed protein product [Tetraodon nigroviridis]
-----------------FSSCSD-------------------------------------
---------------------------------------------RVDHLYTFF------
------------VQWS---------PEILKKNQKP-------H-YHCRETQPKCHRVAEK
KKT----------------TVVNKHLTNRVNGAAKNWEI---------------------
--------------------------ITVK------------DAKRRLSLSSED------
SELED-----SEYQKEVDDGFPVLEV--QSQLLHDHHTKTLAAHMPARTQGY-PWQLVYS
TGVHGSSLKTLYRKMAG------------------------------------------L
DSPVLLVIK-D---MHKK-VFGAFSSDPF-----RVS----KSCYGTGETFLFN------
---------------------------------------------------FNPDFKVY-
-RWSG---------QNTYFVSGDL--------ESLQIGGG-----GGGFGLWLDADLYR-
GS-SF-------------SCPTFS------------------------SP-SLSTH----
---------IDFVVQDVEVWT---------------------------------------
------------------------------------------------------------
--------
>gi|66911471|gb|AAH97465.1|	   331 residues, 50 /line  Oxr1 protein [Rattus norvegicus]
-------ME--------KAYTLIVFFLLLR--------LSFILCGFPEATC---------
---------FWRINHNEHLESN---MRKDCGFIL-----FTIPVHLVEDHFRVL------
------------LDFPFPLRCAVCLAILVSRNRIL-------KEKQTAVLIVSDVLPMRF
PTPQVVSVAEYHR---RI-DALNTEEL---RTLCRRLQI---------------------
--------------------------TTRE------------DINSKQAAP---------
----------AKADLEPESFRPNLSD--PSELLLPDQIEKLTKHLPPRTIGY-PWTLVYG
TGKHGTSLKTLYRTMTG------------------------------------------L
DTPVLMVIK-D---SDGQ-VFGALASEPF-----KVS----DGFYGTGETFVFT------
---------------------------------------------------FCPEFEVF-
-KWTG---------DNMFFIKGDM--------DSLAFGGG-----GGEFALWLDGDLYH-
GR-SH-------------SCKTFG------------------------NH-TLSKK----
---------EDFFIQDIEIWAFE-------------------------------------
------------------------------------------------------------
--------
>gi|7021988|dbj|BAA91456.1|	   269 residues, 50 /line  unnamed protein product [Homo sapiens]
--------------------------------------MQQYAQRDKKHE----------
--------------------------------YW-----FAVPQERTDHLYAFF------
------------IQWS---------PEIYAEDTGE-------YTREPGFIVVKKI-----
------------E---ES-ETIEDSSN---QAAAREWEI---------------------
--------------------------TTRE------------DINSKQVAT---------
----------VKADLESESFRPNLSD--PSELLLPDQIEKLTKHLPPRTIGY-PWTLVYG
TGKHGTSLKTLYRTMTG------------------------------------------L
DTPVLMVIK-D---SDGQ-VFGALASEPL-----KVS----DGFYGTGETFVFT------
---------------------------------------------------FCPEFEVF-
-KWTG---------DDMFFIKGDM--------DSLAFGGG-----GGEFALWLDGDLYH-
GR-SH-------------SCKTFG------------------------NR-TLSKK----
---------EDFFIQDIEIWAFE-------------------------------------
------------------------------------------------------------
--------
>gi|94733752|emb|CAK11465.1|	   213 residues, 50 /line  novel protein similar to vertebrate oxidation resistance 1 (OXR1) [Danio rerio]
---------------------------------------MFFSRRI--KE----------
--------------------------------RW-----QLTPKYSFDL-----------
------------------------------------------------------------
--------------------------------------I---------------------
--------------------------TTKE------------EVNSKLM-----------
----------VKSDPEPETFRPNLTE--PSVLLQPEHIEKLAKHLPPRTIGY-PWSLAFS
TSKHGMSMKSLYRAMQS------------------------------------------Q
DSPVLMVIK-D---SDGQ-MFGALASQPF-----KVS----DGFYGTGETFVFT------
---------------------------------------------------FYPEFEVF-
-KWTG---------DNMFFIKGDM--------DSLAVGGG-----GGEFGLWLDGDLYH-
GR-TH-------------SCKTFG------------------------NP-MLSKT----
---------EDFFVQDIEIWAFE-------------------------------------
------------------------------------------------------------
--------
>gi|45198441|ref|NP_985470.1|	   237 residues, 50 /line  AFL078Wp [Ashbya gossypii ATCC 10895]
-----------------MDGWRS--RFKR-------------------------------
---------LHRTLSVGEEQC---------------------------------------
------------------------------------------------------------
-------------------TPAIKLNS---PDATLQTEA---------------------
--------------------------CAPE------------DEG----G----------
-----------LPPVQLC--GYLSST--RDRLLTAELCAELRPLMPSRIQLYTKWCLLYS
LEQHGASLHSLYEHVRPEE-------------------------------------PAKA
RVGYLLIMR-D---RRGG-LFGAYANEPF-----RPT--ESRRYSGNGECLLWY-ADLHP
M----------------------------------------------------LRLRAY-
-PYTG---------LNEFCIYCTS--------GFLSMGAG-----SGHYGLWCDEGLVH-
GV-SE-------------RSPTFG------------------------ND-ALSRE----
-------G-PRFHIVALEVWRVG-------------------------------------
------------------------------------------------------------
--------
>gi|74612445|sp|Q6ZZF5|OXR1_PICJA	   176 residues, 50 /line  Oxidation resistance protein 1
-----------------MSFFKR-------------------------------------
-------------KSKSPSPSA--------------------------------------
------------------------------------------------------------
-------------------------------------QP---------------------
--------------------------SNID------------TYV----PP---------
----------PPIPIELD--GYSQTT--KNRLMSTELAEDIRNILPMRYQVRTNWHLVYS
LEQHGASLHTLYRMMKPLT--------------------------------------RYD
KNGYILVIR-D---LKNS-QFGCFVNEYL-----HPT--DLRRFYGNGECFLWK-SKRQG
D-----DV--------------------------------AE---EMGGEANHIQFKAF-
-PYTG---------LNDFIIYCTS--------EF--------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------
>gi|147801307|emb|CAN74846.1|	   317 residues, 50 /line  hypothetical protein [Vitis vinifera]
------------------MYFKD--KLSR-------------------------------
---------FWDDSSSSPSQAR---PSSKGGRSLSSLLSFVLPSARFDGF--RS------
------------NKHQPDIRPIRSLPVRWSGKNVR-------HD---PLASPADYSPVCE
KKENGESMYKNKG---TLDAPEEDEDH---GSGRSTSSS---------------------
--------------------------DVFE------------EAT----E----------
-----------LHSSENP--APNLTD--NSSFISSDLYEFLLSSLPNIVRGC-QWVLLYS
TLKHGISLRTLIRKSAD------------------------------------------L
SGPCLLIVG-D---MQGA-VFGGLLECPL-----KPT--AKRKYQGTNQAFVFT-T----
---------------------------------------------------IYGEPRLF-
-RPTG---------ANRYFYLCLN--------DLLALGGG------GNFALCLDEDLLS-
GT-SG-------------PCETFG------------------------NL-CLAHN----
---------PEFELKNVEICREAEASASGT-----------NVS----------------
------------------------------------------------------------
--------
>gi|92885947|gb|ABE87991.1|	   295 residues, 50 /line  TLDc [Medicago truncatula]
------------------MYNLKVLKFSR-------------------------------
---------VFSNSFNGPLQVG---SYSKEGKSLFSYLSYFITLVSIAGS--KT------
------------RNLQSVIARLKHKKNRW-----D-------HS---LLKEHVGSSLL--
--------GNTMN---LVKDEIIDNEN---HVHRSDNNS---------------------
--------------------------EDF---------------E----E----------
-----------VNDGQYS--SLKLID--DSCFISLELNDFFESNLPKLVKGC-KRVLLYS
TLKHGISLRTLIRNSSQ------------------------------------------L
TTPGLLIVG-D---MKGA-VFGALLDCPL-----IPT--TRPKYQGTHQTFVFT-N----
---------------------------------------------------LDSHPRIF-
-RPTG---------VNRYYYLCSN--------DSFAFGGG------GGFALYLDGDLLT-
GT-SG-------------PCDTFE------------------------NH-CLAHT----
---------PEFEIKNVELWGFTHTS-----------------S----------------
------------------------------------------------------------
--------
>gi|50309639|ref|XP_454831.1|	   250 residues, 50 /line  unnamed protein product [Kluyveromyces lactis]
-----------------MSGFRN--RIQ--------------------------------
----------------------------SWGKGLGTVLS---------------------
------------------------------------------------------------
-------------------DSIGDESS---EKTSRSIQH---------------------
--------------------------NHYE------------EDD----A----------
-----------LPPVHLI--GYSEKT--KNRLLSKEMCEELRQLMPTRIQLYTEWTLLYS
LEQHGASLHSLYDKLKYDT-------------------------------------NNNA
RVGYVIVIR-D---RKGG-IFGGYANETF-----HPT--DSRRYYGNGECFLWK-MEKVP
D----LQL--------------------------------HDKH-DCKQDSHNWQLRGF-
-PYTG---------ENEFSIYCTS--------TFLSMGAG-----DGHYGLWIDDGLFR-
GV-TF-------------PSMTFG------------------------ND-ILSRE----
-------G-SKFHIVGVEVWRVG-------------------------------------
------------------------------------------------------------
--------
>gi|123411191|ref|XP_001303843.1|	   363 residues, 50 /line  TLD family protein [Trichomonas vaginalis G3]
------MENRVYKVGQGDTLVGVAVKFDTTVSELMRI-NRLCNEIICPGDIIVLKKPEIK
KEYLINTES---------------------------------ELLKYETSIFGQLCADYE
NLAFYPDA----SDNLINIKFSSIISTSMIPHPSAVFV----GPNYEETTPDSPFIICI-
------NYNEVNDQVILMFKAPK-------------DKLQEVTALITKYQQAANDFGRRS
ISM---------------------------------------------------------
------PNLTTLAAHEKPLLPINITA--QNPILTENLINLIRRELPKRYR-NNDWKALYQ
MTVDGCSYNTFFEKTER------------------------------------------Y
E-PVLLALK-T---NTNE-IVGAFASRGL-----KKS----KNYYGSGESFVFK-FVE--
-----------------------------------------------------GDLIAF-
-HWSK---------KNEYFITSTK--------NEIVIGGG------GSSAIWIDGELDH-
AM-SE-------------PCETFM------------------------SP-QLTSV----
---------HSFRLYNLEAWSFSEHKF---------------------------------
------------------------------------------------------------
-------D
>gi|19074516|ref|NP_586022.1|	   207 residues, 50 /line  hypothetical protein ECU07_0940 [Encephalitozoon cuniculi GB-M1]
------------------------------------------------------------
--------------------------------------------------MGIGNCKDYL
---------------------------------------------FDSSLPDLPELQFD-
------------------------------------------------------------
------------------------------------------------------------
------------------LMHDGKKY--KASILPEKIVTRLRESLQDRYKYSTSWRLLFS
TFENGFSYRTFLESFGE------------------------------------------N
EWPFVLACR-T---KDGD-LFGAFFEDRI-----RIA----RNPYGRDSMFLFT-AARRG
A----DRL-------------------------------------------ADSEVAVF-
-RISK---------GKGTGIYCCP--------DFFAFGCS-----GERFGLLINKSLLD-
GE-TH-------------PVETFG------------------------NC-LLASK----
---------RHFRISYLELWLVQI------------------------------------
------------------------------------------------------------
--------
>gi|19115198|ref|NP_594286.1|	   188 residues, 50 /line  hypothetical protein SPAC8C9.16c [Schizosaccharomyces pombe 972h-]
------------------------------------------------------------
------------------------------------------------------------
---------------------------------------------------------MF-
------------------------------------------------------------
------------------------------------------------------------
------------------NFTRQYSV--KDGLITDELASHIVENLPARYASAETWKRIYS
LQHDGASLQTMYLACEKEKA-----------------------------------RSGHP
KGACILAVR-D---TDGD-VFGVFIPDYL-----IPA----PHYFGSEETFLWK-YFPP-
-----------------------------------------------------KKYVHY-
-PFVG---------NSNFVAYCTK--------SFLAFGGG-----NGRYSLWLDGSLEY-
AY-SS-------------RTPAFE------------------------NN-PLSYR----
----GCPD-QRIQIVDIELWVL-E------------------------------------
------------------------------------------------------------
--------


Ad blocker interference detected!


Wikia is a free-to-use site that makes money from advertising. We have a modified experience for viewers using ad blockers

Wikia is not accessible if you’ve made further modifications. Remove the custom ad blocker rule(s) and the page will load as expected.