Fandom

Proteins Wiki

At2g05590.1/MSA

< At2g05590.1

47,922pages on
this wiki
Add New Page
Talk0 Share
>gi|18396126|ref|NP_565326.1|	   263 residues, 50 /line  unknown protein [Arabidopsis thaliana]
-------------MHALKDKVS--------------------------------------
----------QKLSNLFADSPSQSASPRYSNSDSPKARLNSSVGKSLSSYFSFVVPQSGN
E-----------------------------------------------------------
------------------------------------------EDSELCPPLPIRTESYEC
I------ENCKSANGQAKAGTFISIGE--------------------DKDCELRVSAKVE
ESG-------NDYFDGVKKMREL------TESSVFITANLFEFLHASLPNIVR-GCKWIL
LYSTLKHGISLRTLLRRSGE----------------------------------------
--LPGPCLLVAG-D---KQGA-VFGALLECPL-----QPT--PKRKYQGTSQTFLFTTIY
------------------------------------------------------GEPRIF
--RPTG---------ANRYYLMCMN--------EFLAFGGG-G-----NFALCLDEDL--
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------
>gi|108873533|gb|EAT37758.1|	   381 residues, 50 /line  conserved hypothetical protein [Aedes aegypti]
---EECY-HCMASLVAPKDKVF-------ITQTKLLYEVTW----------------KTV
M--QIAK-------------------------------KHA---KSAVLYLSRLC-----
PGQKSERIFMDWC-----WWI---LGGLPFPHLVRVMDCFFHEGIKVFYRVALAILILFH
--------KHSTAT----------NSEWDADTIKNDIDNALPKFCKNIPVSPA-KLLRTA
FSIRALSSTY---ISRIFLKTEMVLKS-KSVLSGSKQ--MV-------------------
-----RSRS-SDNLPTSQSQVNV------QMMSHTLTIRELFTLWSWLPVRIT-MYQPVL
LYTTEEHGCSLTTFYVRVEQH---------------------------------------
----EPTLLMIK-T---CNNE-VFGAYCSSRWFERNLKDDRGQRQAYFGTGETFLFS-LY
P------------------------------------------------------ERAKY
--PWVGIEGDKGLGHASELFMAADS--------KMITIGGGEG-----Q-AIWMDENIRF
-GK-TD-------------RCQTFN------------------------NP-PLCAS---
---------GDFEIRVLEVYGFVGA-----------------------------------
------------------------------------------------------------
------------
>gi|109092158|ref|XP_001097769.1|	   341 residues, 50 /line  PREDICTED: similar to oxidation resistance 1 [Macaca mulatta]
-MSRASGDPGP----LHQVQQNRVSSSCG-----------KMAQAICEMAFPVGTRV---
-------GTGPRLAALWADIRAREESPEPEPGQRASHLPGD-------------------
-----QGSELNRPHTDHQVGRVSA-------------------------------MCGPL
SGDQGDTLKAGAEDSLTAH----------------------------------GRPGRDR
RMRGLRWRYT---RLPTQVEDTLSGEEG---NEEEEE-----------------------
---EEAAPD-PAAAPEDPMVPQL------TEASQVLSASDIRQLSFHFPPRVT-GHPWSL
VFCTSRDGFSLQSLYRRMEGC---------------------------------------
---SGPVLLVLR-D---QDGQ-IFGAFSSSAI-----QLS----KGFYGTGETFLFSF-S
P------------------------------------------------------QLKVF
--KWTG---------SNSFFVKGDL--------DSLMMGSGSG-----RFGLWLDGDLFH
-GG-SS-------------PCATFN------------------------NE-VLARR---
---------EQFCVQELEAWLLS-------------------------------------
------------------------------------------------------------
------------
>gi|126291249|ref|XP_001371863.1|	   213 residues, 50 /line  PREDICTED: similar to chromosome 20 open reading frame 118 [Monodelphis domestica]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-MRGLRWRYT---QLPTQPDDPLPGE-----NEAEVM-----------------------
---AQAMPTAQGPGIEEAWVPTL-------GESKVLHVEEFRQLVPHFPPRFI-GHSWTL
VYCTARDGFSLKNLYRRMEGQ---------------------------------------
---SSPVLLVLR-D---RDGQ-IFGAFSSTAI-----RVS----SCFYGTGETFLFSF-S
P------------------------------------------------------QLKVF
--KWTG---------RNSFFIKGDQ--------DLLVMGSGSG-----HFGLWLDGDLNH
-GG-SR-------------PCATFN------------------------NE-VLARQ---
---------EEFFLQELEAWTLS-------------------------------------
------------------------------------------------------------
------------
>gi|118794171|ref|XP_321332.2|	   265 residues, 50 /line  ENSANGP00000024072 [Anopheles gambiae str. PEST]
-MWYLV-----------LVALSATLYFASKRWG---------------------------
--------------------------------------------RQLYYRWGRLIPFRRA
IGNKSRPP----------------------------------------------------
----------------------------------------------TPPLIDT-------
---------------------SVPAHLPAEEFDDGRLH-TVLSMSTDDYRKATLF-----
---------ASGSFDQDFQIPDL------VGQTEILSEEHREKLCAHLPARAE-GYSWSL
VFSTSQHGFSLNSLYRKMHKL---------------------------------------
---ESPILIVIE-D---TDHN-VFGALTSCSL-----HVS----DHFYGTGESLLYKF-N
P------------------------------------------------------HFKVF
--HWSG---------ENLYFIKGNP--------ESLAIGAGDG-----KFGLWLDGDLNQ
-GR-SQ-------------HCSTYS------------------------NE-PLAPQ---
---------EDFVIKTLECWAFV-------------------------------------
------------------------------------------------------------
------------
>gi|24644183|ref|NP_730914.1|	   267 residues, 50 /line  l(3)82Fd CG32464-PC, isoform C [Drosophila melanogaster]
-MWFAIS----------LFAILAVCGLAGRRWG---------------------------
--------------------------------------------RYLYLHYGRHLLPRSL
LSAKNRAP----------------------------------------------------
----------------------------------------------TPPLSPT-------
---------------------KDDQSLEALLDESGEMHETVLSMSTDEYRKTSLF-----
---------ATGSFDLDFPIPDL------IGKTEILTEEHREKLCSHLPARAE-GYSWSL
IFSTSQHGFALNSLYRKMARL---------------------------------------
---ESPVLIVIE-D---TEHN-VFGALTSCSL-----HVS----DHFYGTGESLLYKF-N
P------------------------------------------------------SFKVF
--HWTG---------ENMYFIKGNM--------ESLSIGAGDG-----RFGLWLDGDLNQ
-GR-SQ-------------QCSTYG------------------------NE-PLAPQ---
---------EDFVIKTLECWAFV-------------------------------------
------------------------------------------------------------
------------
>gi|119112668|ref|XP_317751.2|	   407 residues, 50 /line  ENSANGP00000010196 [Anopheles gambiae str. PEST]
---WGSQMDPRLA------QYITNFLFGP---LGARSPVVEFQRFAELYVYCVRGTI---
---------DERINVLLCSLGQ---QPESESTEIAYPLIKE-----------YVEAVVSS
YMRAIR-LEGGPQYKS---WESRGFR-----------------------------IVKDC
IQKLAESLAYDVVQQGTQKVTRADAE-----RWLHKNPTFLKMLEHV-------------
---------------------------------------FSHLYHYRNTDGNARKSIIPQ
EALQSMLP-------YCEGLQYV------PDYPAFTDLSQMLFINSNLPGTQ--QNKWRF
LFSSQIHGESFSTLLGRIMD----------------------------------------
---QGPTVVIVE-D---ANGY-IFGGYATDSW-----ALS----PNYVGNENSFLFTL-R
P------------------------------------------------------KMRCF
--SSTG---------YNDHYQYLNL--HQQTMPNGMGMGGQHN-----YWGMWLDSEYGL
-GECSE-------------SCTTYK------------------------GYFQLSAT---
---------KKFNIRNVEVWGVGDKPVK-------------------------EDEGDEK
SGARSVLDGNADSK-------------------AILKMSGREQYSD--------------
----GYREEPKD
>gi|123411191|ref|XP_001303843.1|	   363 residues, 50 /line  TLD family protein [Trichomonas vaginalis G3]
MENR-----------VYKVGQGDTLVGVAVKFDTTVSELMRINRLCNEIICPGDIIVLKK
PEIKK-------EYLINTESELLKYETSIFGQLCADYENLA-FYPDASDNL---------
--------------------INIKFSSIISTSMIPHPSAVFVGPN--YEETTPDSPFIIC
I-------NYNEVNDQVI------------------------------------------
-------LMFKAPKDKLQEVTALITKYQQAAN---------------DFGRRSISMPNLT
T---------LAAHEKPLLPINI------TAQNPILTENLINLIRRELPKRYR-NNDWKA
LYQMTVDGCSYNTFFEKTERYE--------------------------------------
-----PVLLALK-T---NTNE-IVGAFASRGL-----KK----SKNYYGSGESFVFKFVE
G------------------------------------------------------DLIAF
--HWSK---------KNEYFITSTK--------NEIVIGGG-G-----SSAIWIDGELDH
-AM-SE-------------PCETFM------------------------SP-QLTSV---
---------HSFRLYNLEAWSFSEHKF---------------------------------
------------------------------------------------------------
-----------D
>gi|145509883|ref|XP_001440880.1|	   152 residues, 50 /line  hypothetical protein [Paramecium tetraurelia]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------MSNMYKLSDPFL
IFASKTDGHSLKYLYTKCQDLND-------------------------------------
----YPVLLVIQ-T---NQNI-IFGAFCDKML-----AV----KNKYVGSGETFLFTLS-
------------------------------------------------------PEERKY
--NPTS---------GNKDFMMCAP--------DYLAFGSGKN-----GPAFQIDSELNR
-GF-TY-------------QSDTFD------------------------NP-LFTDQK--
-------TQNRFKCLCIEVYYLK-------------------------------------
------------------------------------------------------------
------------
>gi|146413449|ref|XP_001482695.1|	   309 residues, 50 /line  hypothetical protein PGUG_04650 [Pichia guilliermondii ATCC 6260]
-MSEEKLTSNP-------------------------------------------------
-----------------EDQRVYNEKEEVVDIETSSSL----------------------
----------------------------------------------------PRKQIEKR
PSLLDRLMRRGSES------------KEQENSNPQAPEREDE----LPPLSDL-KL----
----------------------------VGYKETTR------------------------
--------------------------------RRLLGGELAHNIRNLVPRRLQLASEWNL
VYSMEQDGISLRSLYRNNDRDQQVAQVKRQRKTVDAGYASLVVNSMVGS-----HEYHNE
IRRPVGYVLVIQ-D---STGA-IFGSYLNENL-----RLM--EHKRYYGNGECFLWKCER
TGD-------------------------------------------------GSMRFKAF
--VYTG---------INDNIIYSNS--------QFIAIGSSDG-----HNGIWIDKLLCS
-GV-SA-------------YCETFG------------------------NE-VLCGSSHA
SGSRPNAKESRFEIIGLEVWRIGDP-----------------------------------
------------------------------------------------------------
------------
>gi|66803773|ref|XP_635716.1|	   308 residues, 50 /line  hypothetical protein DDBDRAFT_0188865 [Dictyostelium discoideum AX4]
-MGSSSSKHHHHHH----------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------------------HHNNNNNNQTNIEQ
QEKNEINNN-NNKNQFYVKVPEL------TEKSKLLNDEHIRWISRYLPDDSY-RETWKL
LFSSSRDGHSFNRFQHHSTEK---------------------------------------
----GSIIVIVKEE--GEEGH-IFGGFCDENL-----KIK---YPKFYGNKNNFVFTL-K
P------------------------------------------------------EIEIF
--RSTG---------LDQCFQYFNA--------DSKTLFNGFAMGGELLYAFSIDHLMEN
-GE-SKGSDEILSNGDGKPRASTYG------------------------NT-MLSSQ---
---------AEYKIEYVEVYGCKDLELT------EEQIL-NIQYQNR-NKKGGITGAGQK
SVLRDEDNADK----------------------VIKGMMGDHEFTNY----HEDINEANK
DKKITTPLH--K
>gi|123487300|ref|XP_001324912.1|	   354 residues, 50 /line  TLD family protein [Trichomonas vaginalis G3]
-MSIVSKIS-----------------------------------------------VQQP
SSLKNLMPVREE----------VHRIYGVADFN-------G-FNIEIPSSMYQHGIELYI
ELDSTDFQIPKMT--------VIRLIGIIKLSISEYPMPHGNV-----DPNDPNLPAVLS
ITYLYDVFNHSSVNVINFI-----AIRRLLENFKDEVESIIRVLKSGLNMSPSLDNLNKK
LRMRA-------------------------------------------------QSFDLE
YLA-------NQQQLLRQNKFKI------TGESTILTSAEIEHIRLFMPKRYR-LLSWEL
LYSADNDGVSFSTFYSKAMK----------------------------------------
---KMPAILIVL-G---RDGS-RVGAFLSSGI-----EE----KHGFYGTGETFVFHF-D
P------------------------------------------------------YFAGF
--RWSQ---------NNDLFISTTR--------KDLMIGGGSRDSVNNGSAIYIDDNFMN
-CY-SQ-------------DCETFN------------------------SP-KLGKS---
---------ESFPIVAVELWHAHP------------------------------------
------------------------------------------------------------
------------
>gi|47224060|emb|CAG12889.1|	   268 residues, 50 /line  unnamed protein product [Tetraodon nigroviridis]
---FSSC-----------SDRVDHLYTFFV------------------------------
------------------------------------------------------------
------------------QWSPEILKKNQKPHYHCRETQPKCHRVAEKKKTTV-------
------------------------------------------------------------
----VNKHLTNRVNGAAKNWEIITVKD--------------------AKRRLSLSSEDSE
LEDS------EYQKEVDDGFPVL------EVQSQLLHDHHTKTLAAHMPARTQ-GYPWQL
VYSTGVHGSSLKTLYRKMAGL---------------------------------------
---DSPVLLVIK-D---MHKK-VFGAFSSDPF-----RVS----KSCYGTGETFLFNF-N
P------------------------------------------------------DFKVY
--RWSG---------QNTYFVSGDL--------ESLQIGGGGG-----GFGLWLDADLYR
-GS-SF-------------SCPTFS------------------------SP-SLSTH---
---------IDFVVQDVEVWT---------------------------------------
------------------------------------------------------------
------------
>gi|50288659|ref|XP_446759.1|	   271 residues, 50 /line  unnamed protein product [Candida glabrata]
-------------MFNVKGALNR-------------------------------------
------------------------------------LRTTW-SNSEESD-----------
------------------------------------------------------------
-----RDPRHLKSS----------DDLSNY--TGSRMSYEET-------LPPV-TL----
----------------------------LGYSPKTK------------------------
--------------------------------NRLLHPEMCDELRPLMPTRIQLYTEWTL
LYSLEQHGASLHSLYDKLREDA-------------------------------------S
TPRRVGYVLVIK-D---RKDG-IFGAYSNEPF-----HPH--EHMRYSGNGECFLWKMES
VPNKILRAKIR-------------EDKDEDLIDVN---DDEDKINN-SGTVNESWKLCAY
--PYTG---------ANDFMIYCTS--------KFLSLGAGEG-----HYGLWCDDGLMK
-GV-TN-------------PTQTYG------------------------ND-VLSRE---
-----G---RKFTIMGLEVWRVG-------------------------------------
------------------------------------------------------------
------------
>gi|6325060|ref|NP_015128.1|	   273 residues, 50 /line  Oxr1p [Saccharomyces cerevisiae]
-------------MFGVKDAIFK-------------------------------------
------------------------------------IKRSI-AGTDSSDSTAYTTASE--
------------------------------------------------------------
-----SSPQLKDSH----------NPFRNKTTSERTIVEEGS-------LPPV-RL----
----------------------------NGYLPSTK------------------------
--------------------------------NKLLTPEMCDEIRTLMPTRIQLYTEWNL
LYSLEQHGSSLHSLYSNVAPDS-------------------------------------K
EFRRVGYVLVIK-D---RKNG-IFGAYSNEAF-----HPN--EHRQYTGNGECFLWKLDK
VPDVNISEK---------------EESEQEGKEGK----------E-EGDKEERWRFSGY
--PYTG---------VNEFAIYCTS--------EFLSMGAGDG-----HYGLLCDDGLLH
-GV-SN-------------PCQTYG------------------------NE-VLSKE---
-----G---KKFSIVALEVWRVG-------------------------------------
------------------------------------------------------------
------------
>gi|123412450|ref|XP_001304065.1|	   387 residues, 50 /line  TLD family protein [Trichomonas vaginalis G3]
-MSDQDL--------TYEVQPNDSLSSISLKFRVTVAWIKLLNPNLDSNIHPGQSIIIMK
PEILD-------ECITIKNIKVFPAEANDKGILRCDKVSLR-YLPDSSYGKPLV------
----------------------INLLGHLESAIMPHPTFMLTPGF--TDPFADNALSLFV
ISYITD-FNTNKFETISF------------------------------------------
-------EGL---RGDLLKLHHNLLLKAEAAQSAKQFV--VPDINSAAAQRRNRTISDLT
VEMNAHRNA-TNKKRNKLRQINV------VGSNKILTLQEMEEIRLCLPYQYI-NAGWKL
LFQLSNDGSSYLSFFEKTRNIQ--------------------------------------
-----PVVLLILTD---KKEK--IGAYISKGL-----KV----QRNFYGNGETFVFKY-H
P------------------------------------------------------TFSYY
--RWTN---------ANQYFVSSSK--------DEIAIGGG-G-----ASALWVDSCFIS
-AI-SE-------------PCPTFN------------------------SP-ALTSV---
---------PHFKIVDCEVWQLSEH-----------------------------------
------------------------------------------------------------
-----------I
>gi|123415681|ref|XP_001304737.1|	   377 residues, 50 /line  TLD family protein [Trichomonas vaginalis G3]
-MQQPAEEKEE----IYAVQPHDTLVTIAVKFGLTVQWLRDLNNISSDFIYNDMKLIIKP
PNILDTILVAENVSILSEDLQILPENEQVLGKLTCKGALLA-FIPYSKGTT---------
--------------------LFVDLCGNLEHTHLPSPAIKSG------KHISSRDPELLI
ITFFPDINDLSKTETLAF------------------------------------------
-------VGS---SMEITPLSDLIGKQTKEIQRRMNFTPVRPQHNDS-------------
-----KTEK-VVQKKAKLQSVEL------RGTSTIADENMIEQVRRYLPYQFR-LANWNL
LFQLSNDGASYLTFFEKCKDK---------------------------------------
----SPAVILIR-T---DSGD-KIGAYISAGF-----KL----SKRFYGNGETFVFTF-N
P------------------------------------------------------KLHAY
--RWQN---------SNQYFICSTK--------EEIAIGGG-G-----STAIWIDGTFLN
-AV-SD-------------PCTTFG------------------------SP-SLTKT---
---------PYFKIHELEVWSISQF-----------------------------------
------------------------------------------------------------
------------
>gi|123418021|ref|XP_001305231.1|	   372 residues, 50 /line  TLD family protein [Trichomonas vaginalis G3]
-MSEQTDTE------HYIVQENESLSSIATKLDITLLNIKTLNPNV---------KVAIP
GMILNVKPIKELPHLHPIDSQIFSRAPPIDGDLYLDETQIR-FQPRGKREKPIL------
----------------------IDLIGYVDATITPHPCDFYDDVD---EVLPDDFLALLH
VNYLSIPSD-------------------------------------PTSMEII-EF----
-------AGL---HEELRDFKTVLQQRSTAIQVKSHY--TRPLMSTYI------------
--KPVEETK-RRVSDFCLEFEGL------PDPSKIMTPTEMGQLNNSLPKRLR-KLEWHL
VYRLSDDGSSYNEFMTKTRGLD--------------------------------------
-----QCVLVMK-T---DGDS-IIGCYSSAGF-----DP----KKAYAANGETYVFSF-F
P------------------------------------------------------SFVAY
--RWSK---------TVNYFVNVDK--------TNLSIGGG-G-----SAAIWLDDRMLH
-GF-SE-------------KCDAFN------------------------NP-PLASD---
---------VDIKCMNLEVWHISYK-----------------------------------
------------------------------------------------------------
------------
>gi|125847607|ref|XP_001331985.1|	   255 residues, 50 /line  PREDICTED: hypothetical protein [Danio rerio]
-MGVAYS-----------VGEVDHLYTFFV------------------------------
------------------------------------------------------------
------------------EWSPENIYS-HKHSRKQQEFLQVHPDALSV------------
------------------------------------------------------------
----IGSLLK---DSPPENWQIVSVKQ-------QKR--RT-------------------
-----SVCS-SADSESDDLLPVL------INHSQILKELHLEQLMSHIPARAQ-GNQWKL
VYSTAVHGTSLRTLYRQMAEL---------------------------------------
---DRPVLMVIR-D---TDGQ-VFGAFSSDPF-----RVS----SYCYGTGETFLYSF-S
P------------------------------------------------------EFQVF
--RWTG---------ENSYFVRGFL--------DSLQMGGGGG-----PFGLWLDADLYR
-GS-SY-------------SCNTFC------------------------NR-PLSLH---
---------HDFTVQELEVWSFV-------------------------------------
------------------------------------------------------------
------------
>gi|145252032|ref|XP_001397529.1|	   302 residues, 50 /line  hypothetical protein An16g02160 [Aspergillus niger]
-MSSSSS--------------------------SRSGSRPP----------------PTT
STST------------------------------TATTPSS-LQQSAASYFSYPV-----
-----------------------THVVSGLYRRLTDPS----------------------
TNTTNNMRRKTTT--TDTTTNNNPVFTP------IRTASPFQ----PPPLTPL-TL----
------------------------------------------------------------
-----------------------------SDPSTLLTRSLAEEIRLLVPPRLQLCNTWHL
AYSLDRDGASLSTLYDNCRDIAS------------------------------------T
RSPRAGYILVIR-DASPSSNA-VFGAYMTDPP-----HP----DSHYYGTGECFLWRASV
LPPATA---MLSNFSNAN-----------------------GDNGG-EEGVEADIRFKAF
--PYSG---------VNDYMMFCET--------GFLSLGGGDG-----HYGLWVDSSLEK
-GV-SA-------------SCQTFG------------------------NE-PLSDE---
-----G---VKFDIIGVEVCY---------------------------------------
------------------------------------------------------------
------------
>gi|149245492|ref|XP_001527223.1|	   380 residues, 50 /line  oxidation resistance protein 1 [Lodderomyces elongisporus NRRL YB-4239]
-MSFLFRRSLELNR-----------------------PRKA----------------RTE
EQLLHQKKVADT------GDEG----------------------------NSNNVPELEP
DPEQKPELDLDQEHKHEH----------------ESSASPIDDTGSGS----EKTSLKKR
PTFLQSLMRVSSGN------GSSSSLKSSTSS---SSSQLSG----IPPLPPL-VL----
----------------------------ADHKGNIK------------------------
--------------------------------NRLLDIELATNIQSLLPARLQLFDTWDL
VYSLSQHGMSLNTLYRNSKPEHQLQELKKR-KKAEKGYADAVVKKMMVADFPKQGGFTIE
QRRPQGYILVIK-D---EHNA-KFGAYLNEYL-----KPM--EHKRYYGNGECFLWKVEN
YDPSTL----ISHNEKPN-----------------------KDSS-ESSSKNNATRFKAF
--MYTG---------INDNIIYSNR--------DFIAIGSSHG-----ENGLYLDQSLSS
-GV-SY-------------PCETFG------------------------NE-ILCLN---
--TKKNPKAGSFKIMGLEIWRVGTL-----------------------------------
------------------------------------------------------------
-----------E
>gi|30692556|ref|NP_195697.3|	   394 residues, 50 /line  unknown protein [Arabidopsis thaliana]
-MGKHKSFRSKAV------HFVTDLTAGL-------LNPIS----------------DKP
SSAHPPPPLPDE------EDESKRNQLESTTAEQPKDLVDE---PDTSSFSAFLGSLLSS
DPKD---------------------------KRKDQDPEDEEDEE---EDEEEDSEAETS
DTSSSSANPTRTMKETTSGGAAKKSFLSKYKQHFRNFYQAVK------------------
------FPGV---KERKGNSDVIPDDEETEYYDGLEM---KPMQNN--------------
-----NVKE-EVTVVVQAIIPEI------SEPSLLLSEQSRRSLYTSLPALVQ-GRKWIL
LYSTWRHGISLSTLYRKSLLW---------------------------------------
---PGLSLLVVG-D---RKGS-VFGGLVEAPL-----IPT---DKKYQGTNSTFVFTNKS
G------------------------------------------------------QPTIY
--RPTG---------ANRFYTLCSK--------EFLALGGG-G-----RFALYLDSELLS
-GS-SA-------------YSETYG------------------------NS-CLADS---
---------QDFDVKEVELWGFVYGSKY------DE-----------ILAH---------
----------------------------------------------------SKTMEPGL
CRWS--------
>gi|47221901|emb|CAF98913.1|	   355 residues, 50 /line  unnamed protein product [Tetraodon nigroviridis]
-------------------QFLEDLISSVVQILVLRERLRG----------------WKP
EKMGEISPGVKL----------LAEQM---------------------------------
-------------------CSELKTTGGLLITRAVSPSETGESDISC-------------
-------LEDWIFRISQVSLYLEILVTEGLNVSLSGRPAPDL------------------
----------------------------LPPCRETPW-----------------------
-----------------------------DGLRCLLDIPTVMFLAPQLPDG--LAAPWRL
VFSTRLHGESFTRMVAGLSR----------------------------------------
---HGPTLLLIK-D---TKGH-VFGGFASHAW-----EL----KPQFQGDSRCFLFTV-S
P------------------------------------------------------KLRVF
--STTG---------YNDHFMYLNQ--HQQTMPNGLGMGGQHD-----YFGLWLDSDFGR
-GH-SR----------ARPTCTTYG------------------------SP-QLSAE---
---------EDFSLDSMEVWAVGKPPEP------EDVRG-RGSWQKE-RPGHGSGSSGHY
GDDGEVSAQPG---------------------------------TPRTGGGPGRVRKPWK
IRKLVCRHRFVS
>gi|47230057|emb|CAG10471.1|	   152 residues, 50 /line  unnamed protein product [Tetraodon nigroviridis]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------KLSKELPPRTI-GHSWTL
AYSTSRHGASLKTLYRKLSAS---------------------------------------
---DSPVLIVIK-D---ALDE-IFGAFLSHPL-----RPS----ETFYGTGETFLFML-H
P------------------------------------------------------RYKCF
--RWTG---------ENSFFIKGDL--------DSFAIGGGSG-----HFGLWVDENLYL
-GR-SS-------------PCFTFN------------------------NC-CLSET---
---------DDFRIMDLEAWTF--------------------------------------
------------------------------------------------------------
------------
>gi|50554321|ref|XP_504569.1|	   229 residues, 50 /line  hypothetical protein [Yarrowia lipolytica]
-------------------------------------MDSS----------------DRP
SLRQRLS-------------------------------NWG---RT--------------
------------------------------------------------------------
----------------DTKPAATD-----LTAPPNDPSENME----LPPLPPV-EL----
----------------------------LGYSHSTR------------------------
--------------------------------TKIMTTELADEIRNLVPERIKLYRSWQL
QYSLEQHGTSLTTLYHRNIPPH-------------------------------------G
DTARNGFVLAVK-N---SRGQ-VFGAYTDQHY-----HV---GGKKFYGNGDCFLWKVKN
AD-----------------------------------------------------SFQAF
--PYTG---------ENNFVVYCNP--------HFLSLGGGDG-----KYGLWLDDALKT
-GV-TY-------------PCATFG------------------------NE-PLGD----
---------EKFDVVAVEVWRVGE------------------------------------
------------------------------------------------------------
------------
>gi|116179622|ref|XP_001219660.1|	   361 residues, 50 /line  hypothetical protein CHGG_00439 [Chaetomium globosum CBS 148.51]
-MAFDAPNHNQPPR-------------------TRHTPDLN----------------LSP
ASSR-------------------------------SVTPPG---TASPSSSTFLTSSV--
----------------------SS-LWGGFMRRFSSEPSPS------TP---HPPGLPHA
RTFQPDGGDKRQHHEDSHGNGLDGVYTPPHTLYPHRTASPMG----LPPLEPL-QL----
----------------------------LGFSEETP------------------------
------------------------------QDARLLTAPVAEEIRIMVPARLGIVDEWRL
VYSLEQDGASLATLYEKCAQYQ--------------------------------------
-GVRVGFVLCVK-D---CDGG-LFGAYLSDYP-----HP----APKYFGTGECFLWRASV
LSPLPPPPSLIDNDDTNANLRTTTISAAPHNINTNGNGNNNNVKPPSRTPTPQPIRFKAF
--PYSG---------INEYYMLCEA--------HFLSLGAGDG-----KYGLWLDDSLER
-GV-SS-------------TSQTFG------------------------NE-PLSDE---
-----G---EKFGVLGIEVWVIGA------------------------------------
------------------------------------------------------------
------------
>gi|46124017|ref|XP_386562.1|	   326 residues, 50 /line  hypothetical protein FG06386.1 [Gibberella zeae PH-1]
-MSFS---------------------------------DRN----------------DSP
ETPESSG----------------------------TGTPVN---SNRASA-----SYI--
----------------------TN-MWTGLIRRFSSEGSFP------SQ----------A
DTAYDDNFNYHDGNGHNTKDGINGVFSPVR-----RTASPMR----PPPLDPL-IL----
----------------------------HGYRQGTP------------------------
------------------------------SSAKLLSAAVAEEIRTMVPERLRIVDDWNL
IYSLEQDGASLATLYQRCRQFE--------------------------------------
-GKRAGFVLVVK-D---LEGG-VFGAYLSEYP-----HP----AHTYFGNGECFLWRASN
ITPLPPPPSA---DTTNLNSRNTTLAPPPPSSEAN---TPTHSRP-ASPTPSEAVRFKAF
--PYSG---------LNDFCINCET--------GFLSVGSGGG-----HYGLWLDNGLEV
-GH-SS-------------RCETYG------------------------NE-PLSDE---
-----G---TKFGVIGVELWVMGV------------------------------------
------------------------------------------------------------
------------
>gi|74620175|sp|Q874Z5|OXR1_PODAN	   346 residues, 50 /line  Oxidation resistance protein 1
-MSFYTSSSSQKTH----------------NLNTRQSPDPD----------------SSP
ASSP--G----------------------------AITPTT---SHTE---TAGSSYF--
----------------------SNLLWGGLFRRFTSEPSPS------LSTENSPPTLRHA
HTYQPDGEDDGR----NLGKSVDGIYTPPH--FHHRVPSPMG----LPQLEPL-QL----
----------------------------LGFSARTR------------------------
------------------------------TESRLLTPAIAEEVRNLVPTRLSIVDEWNL
VYSLDQDGSSLATLYDKCDRYR--------------------------------------
-GKRVGFVLAVR-D---TEGG-IFGAYLSDVP-----HI----APNYFGTGECFLWRASV
QAPLPPPPSLIDSEDTPDVGRSTTIRAEQNVAS--------------GQVNAHSIRFKAF
--PYSG---------VNEYYMLCGQ--------QFLSVGAGDG-----RFGLWLDSGLEK
-GV-SS-------------TCQTFG------------------------NE-PLSDE---
-----G---EKFGVLGVELWVIGA------------------------------------
------------------------------------------------------------
------------
>gi|125554587|gb|EAZ00193.1|	   368 residues, 50 /line  hypothetical protein OsI_021425 [Oryza sativa (indica cultivar-group)]
-MGYLPSLGGKAA------HLVSDLATVI--LNPVSERESQ----------------RHP
SHLPEATEVQEN----------IYEDDDDDDSVKNSEIPNG---PDTSSFRAFLMSFMSS
SNSSSDSIEIIPEHNMNMEYPTLTPVGKGSNGRKGLFSRGKHSIGKIINKAGRIGGFRQK
PSYSID---------------------------GETVQTEYD-------APGL-EL----
----------------------------KGSKESAS------------------------
----------------HDKLPAM------SEPSMLLSETMRTVLYTSLPVLVQ-GRNWML
VYSTWRHGISLSTLYRRSMLC---------------------------------------
---AGYSLLIVG-D---RKGA-VFGGLVEAPL-----QPL--IKKKYQGTNNCFVFTNIA
G------------------------------------------------------RPVIY
--RPTG---------ANNYFTFCST--------DYLAMGGG-G-----HFALYLDGDLLN
-GS-SS-------------TSETFN------------------------NP-CLSRS---
---------REFEVKDVELWGFVNASKY------DE-----------MLTI-CRT-----
---------------------------------------------------------EKQ
GIWN-------L
>gi|125578565|gb|EAZ19711.1|	   408 residues, 50 /line  hypothetical protein OsJ_033920 [Oryza sativa (japonica cultivar-group)]
----------MAS-RAFSRQELDDLRALFV------------------------------
SLAAQSQTGGRA----------IS---RPVFLE-----YFG---IRGALGDRLFQLVARE
SGGGEGVTFEDLI-----VSKATYE-------------------------RGTRDEVDEF
IYQLCDVTGDEVLERSDLE------------TILASIRETIFSENKEAGEGSNK-RTFEA
FINSAVFSKD---AEGVARKSMSLSDF-RSWCILIPS--LRKFLGS--------------
-----LLMP-PDSGRPGFQVPALHYLENISPDLLLLNKEYAWHIGGGF-SQQ-EVQEWRL
LYHSSLHGQSFNTFLGNVTNG---------------------------------------
---DAQTVIIVK-D---TEGF-VFGGYASHPW-----ER----HSDFYGDMKTFLFKL-Y
P------------------------------------------------------EASIF
--RPTG---------GNRNLQWCAVNFSSDSIPNGIGFGGQPH-----HFGFFLSANFDQ
-GH-SF-------------TCTTFT------------------------SP-ALSKT---
---------NRFRPEVIECWGIQTKGAL-------------------------DEKAELV
KGTVLERFKEDRNML------------------KLVGLANAS------------------
-----------D
>gi|55730305|emb|CAH91875.1|	   349 residues, 50 /line  hypothetical protein [Pongo pygmaeus]
-MGAAHS-----------VWEVDHLYAF--------------------------------
------------------------------------------------------------
-----------FV-----QWSPDVYGKDAKEQ---------GFVVVEKEELNM-------
------------------------------------------------------------
----IDNFFS---EPTTKSWEIITVEE-A------KR--RK-------------------
-----STCS-YYEDEDEEVLPVL------RPHSALLENMHIEQLARRLPARVQ-GYPWRL
AYSTLEHGTSLKTLYRKSASL---------------------------------------
---DSPVLLVIK-D---MDNQ-IFGAYATHPF-----KFS----DHYYGTGETFLYTF-S
P------------------------------------------------------HFKVF
--KWSG---------ENSYFINGDI--------SSLELGGGGG-----RFGLWLDADLYH
-GR-SN-------------SCSTFN------------------------ND-ILSKK---
---------EDFIVQDLEVWAFEMPCVFISIIFITKMYSYYLPWKRL-VSFRKIESAQHL
KGIYEVFFKKKKTFIY-----------YLMCWCEISGMSHDITFTIYTVCNHMLLIKWKK
TKWSFCIYFTLT
>gi|71665299|ref|XP_819621.1|	   323 residues, 50 /line  hypothetical protein Tc00.1047053510303.299 [Trypanosoma cruzi strain CL Brener]
------------------MTLCVHLWGSVEGEGP------------------------RK
NNRKQNEKGGAH----------PPRWWGVG----------------------AVFPGEEF
------------------------YQMGGLFTRFIP------------------------
--------------FMCFD-----RNDDA-------------EGMQATPPPPF-------
-DVGVALEEV---PPDVY------------------------------------------
-----------------LKRETA------IKPSIPITGKQFLTLQEHIPPRFQ-GRRWRL
LFCSGLHGFSRLALQQNCAEEI-----------------------------------RSA
RGNERPAVLIVSAG---SEGKILLGAYISCIP-----QT---SNKKYVGTEESFLFCVPS
P--SSSSSAL-----------------------------------------SSSDDLHIF
TAPADA---------ANRYFMRCDN--------GAIAFGGGGK-----GPALFLHSDFAS
VSC-ST-------------FCPTFGIRESLLLLNARPGGDGDAAVFDLPND-VHLE----
------GGEPTTSVRAVQLWTIGDEYF------SL-------------------------
------------------------------------------------------------
-----------L
>gi|116056824|emb|CAL53113.1|	   240 residues, 50 /line  Oxidation resistance protein (ISS) [Ostreococcus tauri]
------------------------------------------------------------
--MEEGTTGGTE----------VDVLYRRRDGT---------------AASARVRAEDGH
DGFLGKVLKSWTA-----A-------------------------------MADETPEERR
GASAL-------------------------------------------------------
------------------------------------------------------------
--------A-ATSERVTKSELKR------SASSDIMSAEQMETLREALPAMCR-MREWTL
TYSTKRDGISLKSLYRRSSGK---------------------------------------
----ENTVLVVS-D---SGGA-IFGAFCTEAW-----KL----HSRYVGTGESFVFSL-A
P------------------------------------------------------EGMKY
--AWSG---------ENDYFMLGAA--------DSLSVGGGSA------HAIRLEEDLLQ
-GS-SG-------------ECETFD------------------------SP-PLASS---
---------DMFRVSRIELWSLD-------------------------------------
------------------------------------------------------------
------------
>gi|123500110|ref|XP_001327772.1|	   385 residues, 50 /line  TLD family protein [Trichomonas vaginalis G3]
-MKKWINYIRFCKFFTILNQIFRHFFDFKKQKMSILSPVSV----------------CRP
SSLKEFMPLREE----------VHKIYGVADFN-----NLG---VQIPSSLYYHGIELYF
EHDSIEYNMPRST-----V---ISIIGIIKITISDYFSPHGDM-----DPSDPDKPALLV
ITHLADVFNQNTVNVITFT-----AIRSDLEKFKREVEAIIQKLKSGINISISTDNLHKK
LRTRA-QSFQ---IEALMN-----------------------------------------
-----------EQAMLRENKFIM------SQESSIVSLPEIENIRLFLPKRFR-LLPWKL
LFSAAEHGVSFSTLYEKTDK----------------------------------------
---KTALVLILL-G---KDGS-RVGAFLPEGI-----QIR----DGFYGNGETCVFHF-N
P------------------------------------------------------YFAGF
--RWTQ---------NNDLFLSCSK--------KDIIIGGGSQRSLDHGSAIYIDDNFMN
-CF-TS-------------QCKTFD------------------------SP-PLANN---
---------ESFKIIAVEVWHVHH------------------------------------
------------------------------------------------------------
------------
>gi|50511015|dbj|BAD32493.1|	   274 residues, 50 /line  mKIAA1609 protein [Mus musculus]
------------------TKAE-------SSREQARWGMPR----------------ACR
ARR---------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------------------WPQG------SCPRSILDVLSVIYLSSHLAPE--HRQRWRL
LFSTQLHGQSFSQLCSHITS----------------------------------------
---QGPSLLVLE-D---RDGY-VFGGFASCSW-----EV----KPQFQGDNRCFLFSI-A
P------------------------------------------------------RMATH
--LHTG---------YNNHFMYLNY--GQQTMPNGLGMGGQHH-----YFGLWVAADFGK
-GH-SK----------AKPACTTYN------------------------SP-QLSAQ---
---------EDFLFDKMEVWGLGNLLE------NMRARTRRASWTQIPKPVACWRSADGL
GTARDCGKSPGMRTEIRQPLRALLDGEHPGAGAG-----------LPQGCRAES------
-----------V
>gi|7021988|dbj|BAA91456.1|	   269 residues, 50 /line  unnamed protein product [Homo sapiens]
-------------MQQYAQ--R-------DKKHEYW------------------------
----------------------------------------------------FAVPQERT
D-----HLYAFFI-----QWSPEIYAEDTGEYTREPGFI---------------------
------VVKKIEES----------ETIEDSSNQAAAREWEI-------------------
-----------------------------TTREDINS--KQ-------------------
-----VATV-KADLESESFRPNL------SDPSELLLPDQIEKLTKHLPPRTI-GYPWTL
VYGTGKHGTSLKTLYRTMTGL---------------------------------------
---DTPVLMVIK-D---SDGQ-VFGALASEPL-----KVS----DGFYGTGETFVFT-FC
P------------------------------------------------------EFEVF
--KWTG---------DDMFFIKGDM--------DSLAFGGGGG-----EFALWLDGDLYH
-GR-SH-------------SCKTFG------------------------NR-TLSKK---
---------EDFFIQDIEIWAFE-------------------------------------
------------------------------------------------------------
------------
>gi|45198441|ref|NP_985470.1|	   237 residues, 50 /line  AFL078Wp [Ashbya gossypii ATCC 10895]
-------------MDGWRSRFK-------R------------------------------
---------------------------------------LH---RTLSVGEEQCTPAIK-
------------------------------------------------------------
------------LN----------SPDATLQTEACAPEDEGG-------LPPV-QL----
----------------------------CGYLSSTR------------------------
--------------------------------DRLLTAELCAELRPLMPSRIQLYTKWCL
LYSLEQHGASLHSLYEHVRPEE-------------------------------------P
AKARVGYLLIMR-D---RRGG-LFGAYANEPF-----RPT--ESRRYSGNGECLLWYADL
HPM---------------------------------------------------LRLRAY
--PYTG---------LNEFCIYCTS--------GFLSMGAGSG-----HYGLWCDEGLVH
-GV-SE-------------RSPTFG------------------------ND-ALSRE---
-----G---PRFHIVALEVWRVG-------------------------------------
------------------------------------------------------------
------------
>gi|50309639|ref|XP_454831.1|	   250 residues, 50 /line  unnamed protein product [Kluyveromyces lactis]
--------------------------------MSGFRNR---------------------
-----IQ-------------------------------SWG---KGLGTVLSD-------
------------------------------------------------------------
--------SIGDES----------SEKTSRSIQHNHYEEDDA-------LPPV-HL----
----------------------------IGYSEKTK------------------------
--------------------------------NRLLSKEMCEELRQLMPTRIQLYTEWTL
LYSLEQHGASLHSLYDKLKYDT-------------------------------------N
NNARVGYVIVIR-D---RKGG-IFGGYANETF-----HPT--DSRRYYGNGECFLWKMEK
VPDLQLHDKH------------------------------------DCKQDSHNWQLRGF
--PYTG---------ENEFSIYCTS--------TFLSMGAGDG-----HYGLWIDDGLFR
-GV-TF-------------PSMTFG------------------------ND-ILSRE---
-----G---SKFHIVGVEVWRVG-------------------------------------
------------------------------------------------------------
------------
>gi|115471831|ref|NP_001059514.1|	   256 residues, 50 /line  Os07g0438700 [Oryza sativa (japonica cultivar-group)]
-------------MLAWKEKVA-------DRL-ARLLADSP----------------ASP
SSA--------------------------------------------AAAAAAVEPQLRV
D-----------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------A------LARRDYSSVFRIKRLC--FGNKPE-------
-CRTWKHGTSLRTLFRRSENL---------------------------------------
---QGPCLLIVG-D---MRGA-VFGGLLNGPL-----RPT--EKRKYQGTNQTFVFTTIY
G------------------------------------------------------EPRLF
--RPTG---------ANRYYYLCLN--------DALAFGGG-G-----SFALCLDEDLLH
-GT-SG-------------SCQTFG------------------------NS-CLAHS---
---------PDFELKNVEFRSLKSVPR------VSK-----------IQSNFCWRKEQGQ
V------------------VGGSVGFYSFMGSFNIVGLGYIINEAIPNPNCPL-------
-----------V
>gi|147801307|emb|CAN74846.1|	   317 residues, 50 /line  hypothetical protein [Vitis vinifera]
-------------MYFKD------------KL-SRFWDDSS----------------SSP
SQARPSS-------------------------------KGG---RSLSSLLSFVLPSARF
DGFRSNKHQPDIR-----PIRSLPVRWSGKNVRHDPLASPADYSPVCEKKENGESMYKNK
GTLDAPEE----------------------------------------------------
-----------------------DEDH-GSGRSTSSS--DV-------------------
-----FEEA-TELHSSENPAPNL------TDNSSFISSDLYEFLLSSLPNIVR-GCQWVL
LYSTLKHGISLRTLIRKSADL---------------------------------------
---SGPCLLIVG-D---MQGA-VFGGLLECPL-----KPT--AKRKYQGTNQAFVFTTIY
G------------------------------------------------------EPRLF
--RPTG---------ANRYFYLCLN--------DLLALGGG-G-----NFALCLDEDLLS
-GT-SG-------------PCETFG------------------------NL-CLAHN---
---------PEFELKNVEICREAEASA------SGT-----------NVS----------
------------------------------------------------------------
------------
>gi|68471798|ref|XP_719942.1|	   345 residues, 50 /line  hypothetical protein CaO19_243 [Candida albicans SC5314]
-------------------------------M-SFLFRRST----------------EQP
RVNEEEP---------------------------------N---KEIKDEPQHHQQEKED
DNSKQEKLLSDSV-----TEKPK----------------------------EQPKPVKRR
GTFFGNLLGNGSKN----------SSSASLNSSHSSVSSSSK----FPPLGPL-TL----
----------------------------TGYKESTH------------------------
--------------------------------HRLLDSELANNIRNLIPARFQLFDNWEL
VYSLEQHGISLNTLYRNSNPEHQLRLLKKQ-KAAEKGFADSIVKNMVVGDTSRP-RYSFE
PKRSQSYVLVIK-D---NHNN-KFGAYLSENL-----KPM--EHRRYYGNGECFLWKCEK
YDPSKLDHAV------------------------------------D-KRATQEIRFKAF
--MYTG---------INDNIIYSNH--------DFIAIGSSNG-----QNGLFIDKSLLS
-GV-SY-------------SCDTFG------------------------NE-ILNSS---
---PQNAKFGSFKIKGLEVWRIGTL------------------------E----------
------------------------------------------------------------
------------
>gi|74612445|sp|Q6ZZF5|OXR1_PICJA	   176 residues, 50 /line  Oxidation resistance protein 1
------------------------------------------------------------
--------------------------------------------------MSFF------
--------------------KRK-------------------------------------
------------------------SKSPSPSAQPSNIDTYVP-----PPPIPI-EL----
----------------------------DGYSQTTK------------------------
--------------------------------NRLMSTELAEDIRNILPMRYQVRTNWHL
VYSLEQHGASLHTLYRMMKPLTR-------------------------------------
-YDKNGYILVIR-D---LKNS-QFGCFVNEYL-----HPT--DLRRFYGNGECFLWKSKR
QGDD--VAEE------------------------------------M-GGEANHIQFKAF
--PYTG---------LNDFIIYCTS--------EF-------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------
>gi|92885947|gb|ABE87991.1|	   295 residues, 50 /line  TLDc [Medicago truncatula]
-------------MYNLKVL----------KF-SRVFSNSF----------------NGP
LQVGSYS-------------------------------KEG---KSLFSYLSYFITLVSI
AGSKTRNLQSVIA-----RLKHK-------------------------------------
------------------------KNRWDHSLLKEHVGSSLL-----GNTMNL-VK----
-------------------DEIIDNEN-HVHRSDNNS--ED-------------------
-----FE----EVNDGQYSSLKL------ID-DSCFISLELNDFFESNLPKLVKGCKRVL
LYSTLKHGISLRTLIRNSSQL---------------------------------------
---TTPGLLIVG-D---MKGA-VFGALLDCPL-----IPT--TRPKYQGTHQTFVFTNLD
S------------------------------------------------------HPRIF
--RPTG---------VNRYYYLCSN--------DSFAFGGGGG------FALYLDGDLLT
-GT-SG-------------PCDTFE------------------------NH-CLAHT---
---------PEFEIKNVELWGFTHTS-----------------------S----------
------------------------------------------------------------
------------
>gi|19074516|ref|NP_586022.1|	   207 residues, 50 /line  hypothetical protein ECU07_0940 [Encephalitozoon cuniculi GB-M1]
--------------MGIGNCKD--------------------------------------
----------YLFDSSLPDLP---------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------ELQFDLMHDGK------KYKASILPEKIVTRLRESLQDRYKYSTSWRL
LFSTFENGFSYRTFLESFGE----------------------------------------
--NEWPFVLACR-T---KDGD-LFGAFFEDRI-----RIA----RNPYGRDSMFLFTAAR
RGADRL----------------------------------------------ADSEVAVF
--RISK---------GKGTGIYCCP--------DFFAFGCSGE-----RFGLLINKSLLD
-GE-TH-------------PVETFG------------------------NC-LLASK---
---------RHFRISYLELWLVQI------------------------------------
------------------------------------------------------------
------------
>gi|19115198|ref|NP_594286.1|	   188 residues, 50 /line  hypothetical protein SPAC8C9.16c [Schizosaccharomyces pombe 972h-]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------MFNFTRQY------SVKDGLITDELASHIVENLPARYASAETWKR
IYSLQHDGASLQTMYLACEKEK-----------------------------------ARS
GHPKGACILAVR-D---TDGD-VFGVFIPDYL-----IPA----PHYFGSEETFLWKYFP
PK-----------------------------------------------------KYVHY
--PFVG---------NSNFVAYCTK--------SFLAFGGGNG-----RYSLWLDGSLEY
-AY-SS-------------RTPAFE------------------------NN-PLSYR---
-----GCPDQRIQIVDIELWVL-E------------------------------------
------------------------------------------------------------
------------


Ad blocker interference detected!


Wikia is a free-to-use site that makes money from advertising. We have a modified experience for viewers using ad blockers

Wikia is not accessible if you’ve made further modifications. Remove the custom ad blocker rule(s) and the page will load as expected.