FANDOM


&&&&&&&&&&&&&&&&&&&& BEGIN  /usr/local/www/html/proteins/Compiled_Programs/WYRM/PyMOL_highlight_conserved_residues &&&&&&&&&&&&&&&&&&&&

Successfully read 2 file paths from WYRM_file_paths.txt

generic_input                                         /usr/local/www/html/proteins/workspace/
generic_output                                        /usr/local/www/html/proteins/htdocs/results/

======================================================

Sequence file type = 3

Sequence type = 3

Got here 1
Got here 2
Got here 3
Sequence 1
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Sequence 2
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Read 2 amino_acid sequences from PIR Sequence file /usr/local/www/html/proteins/workspace/At2g05310-2gt1A0.pir.txt

======================================================

Assigned types to 125 residues in Sequence 2-05310, 124 remain unknown
Assigned types to 323 residues in Sequence 2gt1A0, 10 remain unknown

======================================================

Successfully read 576 entries for residue match scoring matrix /usr/local/www/html/proteins/workspace/BLOSUM62.dat

Read the residue match scoring matrix /usr/local/www/html/proteins/workspace/BLOSUM62.dat

======================================================

Translated sequence file At2g05310-2gt1A0.pir.txt into sequence alignment.

======================================================

>2GT1.pdb  Made from 4930 ATOM records in 2GT1.pdb
MRVLIVKTSSMGDVLHTLPALTDAQQAIPGIKFDWVVEEGFAQIPSWHAA
VERVIPVAIRRWRKAWFSAPIKAERKAFREALQAKNYDAVIDAQGLVKSA
ALVTRLAHGVKHGMDWQTAREPLASLFYNRKHHIAKQQHAVERTRELFAK
SLGYSKPQTQGDYAIAQHFLTNLPTDAGEYAVFLHATTRDDKHWPEEHWR
ELIGLLADSGIRIKLPWGAPHEEERAKRLAEGFAYVEVLPKMSLEGVARV
LAGAKFVVSVDTGLSHLTAALDRPNITVYGPTDPGLIGGYGKNQMVCRAP
GNELSQLTANAVKQFIEENAEKAMRVLIVKTSSMGDVLHTLPALTDAQQA
IPGIKFDWVVEEGFAQIPSWHAAVERVIPVAIRRWRKRKAFREALQAKNY
DAVIDAQGLVKSAALVTRLAHGVKHGMDWQTAREPLASLFYNRKHHIAKQ
QHAVERTRELFAKSLGYSKPQTQGDYAIAQHFLTNGEYAVFLHATTRDDK
HWPEEHWRELIGLLADSGIRIKLPWGAPHEEERAKRLAEGFAYVEVLPKM
SLEGVARVLAGAKFVVSVDTGLSHLTAALDRPNITVYGPTDPNQMVCRAP
GNELSQLTANAVKQFIEENAEKAAMI

======================================================

Best alignment:
2GT1.pdb   195  PEEHWRELIGLLADSGIRIKLPW   217
                PE++W+ +     ++ ++  LP+
2-05310     76  PEQYWQSVGEREGENPMKTPLPY    98

======================================================

Highlighted IDENTICAL residue PRO  195  index1  195  path  200  %Seq 100.00
Highlighted IDENTICAL residue GLU  196  index1  196  path  201  %Seq 100.00
Highlighted IDENTICAL residue TRP  199  index1  199  path  204  %Seq 100.00
Highlighted IDENTICAL residue LEU  206  index1  206  path  211  %Seq  50.00
Highlighted IDENTICAL residue ALA  207  index1  207  path  212  %Seq  50.00
Highlighted IDENTICAL residue ASP  208  index1  208  path  213  %Seq  50.00
Highlighted IDENTICAL residue SER  209  index1  209  path  214  %Seq  50.00
Highlighted IDENTICAL residue GLY  210  index1  210  path  215  %Seq  50.00
Highlighted 8 residues for visualization

Wrote PyMOL macro into file /usr/local/www/html/proteins/htdocs/results/At2g05310-2gt1A0.pir.txt.2GT1.pdb.conservation.pml

===============================================================================

The program

/usr/local/www/html/proteins/Compiled_Programs/WYRM/PyMOL_highlight_conserved_residues At2g05310-2gt1A0.pir.txt PIR amino_acid 2GT1.pdb _ 100.0 BLOSUM62.dat 

completed successfully.

@@@@@@@@@@@@@@@@@@@@ END  /usr/local/www/html/proteins/Compiled_Programs/WYRM/PyMOL_highlight_conserved_residues @@@@@@@@@@@@@@@@@@@@


Ad blocker interference detected!


Wikia is a free-to-use site that makes money from advertising. We have a modified experience for viewers using ad blockers

Wikia is not accessible if you’ve made further modifications. Remove the custom ad blocker rule(s) and the page will load as expected.