Fandom

Proteins Wiki

At2g05310.1/MSA

< At2g05310.1

47,923pages on
this wiki
Add New Page
Talk0 Share
>gi|18396025|ref|NP_565324.1|	   125 residues, 50 /line  unknown protein [Arabidopsis thaliana]
---MAAKLCIPSSSFSHRTNDSITSSSSSYSSLLALPQFFCPPSPLG--FPQFKLHAKLG
GGDG-----EVKPK-DKKKFITKDEEPEQYWQSVGEREGENPMKTPLPYIIIFGMSTPFV
ILAIAFANGWIKVPIR-
>gi|102140020|gb|ABF70151.1|	   113 residues, 50 /line  hypothetical protein MA4_112I10.24 [Musa acuminata]
MA-TPALFIPTVGNGFVRS---------------SFPRFSFPSLSAARIIKPARIYANLG
GADG-----EAKPA--KKKFITREEEPDQYWQTAGERKGENPMKTPLPYIIIFGMSTPFV
ILAIAFANGWIKMPMK-
>gi|115453991|ref|NP_001050596.1|	   118 residues, 50 /line  Os03g0595300 [Oryza sativa (japonica cultivar-group)]
----MAKVALSSLLAVGGAAAFAVQPSKKTGSGLFRNRVITVRRP--------RISANL-
GGDG-----EVKPAGNKKKFITREEEPEQYWQAAGERKGENPMKTPLPYIIIFGMSTPFV
ILAIAFANGWIKVPVR-
>gi|15236299|ref|NP_193086.1|	   125 residues, 50 /line  unknown protein [Arabidopsis thaliana]
---MAAKFRISSSSFSHRASDSSTSSSSSYSSLLALPQFFCPPSPLG--FPEFKLHAKLG
GGDG-----EVKPK-DKKKFITKEEEPEQYWQSVGEREGENPMKTPLPYIIIFGMSTPFV
ILAIAFANGWIKVPIR-
>gi|21593859|gb|AAM65826.1|	   125 residues, 50 /line  unknown [Arabidopsis thaliana]
---MAAKLRISSSSFSHRTNDSKTSSSSSYSSLLALPQFLCPPSPLG--FPQFKLHAKLG
GRDG-----EVKPK-DKKKFITKEEEPEQYWQSVGEREGENPMKTPLPYIIIFGMSTPFV
ILAIAFANGWIKVPIR-
>gi|21618132|gb|AAM67182.1|	   125 residues, 50 /line  unknown [Arabidopsis thaliana]
---MAAKFRISSSSFSHRASDSSTSSSSSYSSLLALPQFFCPPSPLG--FPKFKLHAKLG
GGDG-----EVKPK-DKKKFITKEEEPEQYWQSVGEREGENPMKTPLPYIIIFGISTPFV
ILAIAFANGWIKVPIR-
>gi|116057133|emb|CAL51560.1|	   98 residues, 50 /line  unnamed protein product [Ostreococcus tauri]
-MSTSAEDDRKGRSKGTIERDDRKGRSKGTIEKD--------------------------
D------RSTPVAA-DKQPKITRENEKEA-WLSEMEREGANPMKDPMAMIGIGGLMVPFV
ILAIASAAGFIGQ----
>gi|145345393|ref|XP_001417197.1|	   105 residues, 50 /line  predicted protein [Ostreococcus lucimarinus CCE9901]
MLTVTMKTATMQTTRAVVKRDTTRARGVARVTKR--------------------------
GRDGVRARATQDGK-NGPKKLTRENEKEA-WLSEMEREGANPLKDPMALIGIGGIMVPFI
ILAIASAAGFIGQ----
>gi|74272653|gb|ABA01122.1|	   108 residues, 50 /line  unknown [Chlamydomonas incerta]
--MIALKPASSSVARRLQTSQVAVAPRVARRSLRAL---------------------ALL
GPDG-----KPGTT-SGKKFISREQEPEQYWSSKGEAEGANPMKDPLAIIGVVAILFPFI
FLGIAIAAGFIDVSVYR


Ad blocker interference detected!


Wikia is a free-to-use site that makes money from advertising. We have a modified experience for viewers using ad blockers

Wikia is not accessible if you’ve made further modifications. Remove the custom ad blocker rule(s) and the page will load as expected.