Fandom

Proteins Wiki

At2g05120.1/MSA

< At2g05120.1

47,922pages on
this wiki
Add New Page
Talk0 Share
>gi|15224474|ref|NP_178586.1|	   1234 residues, 50 /line  transporter [Arabidopsis thaliana]
---------------------------MFSPLT---KRAK--QSSRNEKTPRNRVPPPDS
PVTPAT------------------------------------------------QNRNNF
ISDRPATGTPAPWAPRLSVLARVSPGNN------------GD-KGVDSDQLKPV-----F
V-GEF--PQLLR--------------------------DEQ------SYPGDACVSGGMD
KETC-----LSWFITGSKVFVW--SHLTTLP---------------------SRKCVVLE
LPVVV--LVNEESGSGLQDGKSWLVNVVSWDTSAGAA---TRASRSRS-PVGVVMCNRKT
R--AVVYWSDIFSGQEAAPA-------EKARHLI---KRQSNGIR--SSRAENSDLNSLI
-------------------------------------TTAVAAAERLCIAIACSSNGELW
QFTCSPTGVKSNQVQ-------------------L---NI--------------------
SSSSVSEGYPRSLIWRFSQGLARESC----WEFLMLTDCDIHCFTIEPYPDLTVSEVWQH
EIVGTDGDSGIKKDI----------------------------------ASQKQIWPLDL
QVDDQG----------------------KVI--TVLVATICM-DRASSSSYTQYSLLTLQ
HK-SEMRFADG----REEKVLE-KQGPIQVIIPK---ARVEDKD--FLFSM---------
--------------------RLRVGGRPPGSAIILSGDGTATVCYCHGSSTRLYKFDLPY
DAGKVLDASVLS---STDEH----------------------------------------
------------------------------EYGAWTVLTEKAGVWAIPEKAVVLGGVEPP
ERSLSRKNS--------SNERST----------------RDETRVTPYGVDRTAGRENSD
IQNIEDKGNPKM-GFTRQTARDEES-----------------------------------
--EALLGQLFEGFLLSGKVDGSLEKLSQSGAFDRD--G-------------EANVFARKS
KSIVDTLA-----------------------KHWTTTRGAEIV-----------------
---------------------AM----TVISSQLVEKQQKHENF--LHFLALSKC-----
--HEELCSKQR-------HSLQ--------IILENGEKLAAMIQLRELQNMINQNRSARF
GSPQAGSEDQVSCALWD------------------LIQFVGERARRNT------------
----VLLMDRDNAEVFYSKVSELEEVFYCLNRQLEYIIRADQPL-G--------------
-----------------TQLQRACELSNACVTILQTALDYK----NEHQMWYP-----PL
-EG--L----------------------------IP--WHSQT-VVCNGLWCIASFMLHL
LTEAS-----------------------RIDI----------SAKSD-IYTHLEVLTEVL
LEACAG------------------------------------------------------
------------------------------------------------STFAK--LEREE
ENKGLL-----NEYWTRRDTIFDS----------LYRQAKEFMEAEI-------------
------------------------------------------------------------
-------------------------------------------------------QHEGV
GPQGGFSYFVFQQLYDMKQFSKLLRL-----GEE----FQDELLIFLKRH-S---DLVWL
HQVF-LHQFSSASDTLHTLALSQDEESMTTVEERTGPEPEDVQPTFADRK-RFLNLSKIA
YVADK-DA--------------------DSESKVKRIEADLNLLKLQEEITKALPNG---
----------------------------------------E----ARNRLF---------
----------------------------------------RPEELIETCL-----NIQG-
---RWTA--------IKAF----EVFAWTSS-SFRE-NHRSLLEECWRNAAD-QD---DW
DRH-----------------------------------------------HQA--STNEG
WSEEE--------------TLQNLRNTALFQASKRCYG-PTRV-----------------
------------------------------NTFDGDFAQVLPLRR----ENPE-------
----------------DSTSSVEDVLM--SHKDFAEAGKL--------------------
-------------MLTAIMLGCVEEEGIVAEEFSSPM---E
>gi|108871112|gb|EAT35337.1|	   1188 residues, 50 /line  conserved hypothetical protein [Aedes aegypti]
---------------------------MDKSFGSLFGPSRNNSISRSRQSLGGS--LFSA
GGPGRKGSILPS------------------------------------------------
----------GPIGRKG---------SGRYSLS-----TRSNISTLQVVAKSEYNILECY
G-LPL--PVQVS--------------------------EILTFAE-RNA-----PVSINY
SQNG-----WAWLVHGRRLLIW--QYRESHSKAMAASAGIAGGDNFPT-PRRALASQCRQ
LTLPH-------CDIGHKAALITVFI------------------AEGHQMASCLAVSP-A
G--DVRYWPSIAH-----------DGSSIDECN-ILEG--------------------QE
-------------------------------------FEELVGLSSGNYL-LVTTTCSLV
QLQIQLQGGRQTIAARQIKPPS-----GFFGGIGK---KFASIIIGMHS-IPERENKL--
-------------IRINSEKVSSH-----EWHITVLADKWIQRWAFSPSGSNERF-LCED
AEIIRKIREFF----LGKLWSTS------------------------RDPNEIELWTLDM
QPTDRG------------------------V--LILAAACNM-QR--TGPQVHYALLTFV
YE-GDG--MVL-------KESV-MM-KYKGFYSR------EREG--ECTSF---------
--------------------KLIA--NRA--------------VAYVYNDKVIYPVILDR
N----SGSSANSESSSPSEDVEKIEFNV-QDDG-ILAGNSFQNTALFFSKI---------
------------------------------HGLVVVTPSDFE----------------PS
SEVFNS---SVSSDVFNP------------------NISVNDSGFI--------------
---------------AQSIFAPATTNAGNLVLYDL---------DPEEISSA------EK
DNVSQLKAAF--IYYIKRNTPASNEIINELLQTLE--QKS-------LDSELDQTVLTIA
QDLAEDIPA--------------------ADPRW-EVTTKHALG----------------
-----------------------SSTSMQIVQQLREKNIALTQF--LEFLHGSSL-----
--WDKLTATTS-------GDTIRPTGH---LLADIAEKIVAAIALKCLHNSHSR------
-----------------------------------IIDEAIDLVLKESNRSPP-------
------SPNLTNQDLFYVQVNQIHEIFKVFGELVENYVK-QELT-TT-------------
-----------------QIQTALVEINTITVTVLQEVTKFR----ELKSDLFA-----VR
-DE--L-R---------RYEY-------------VP--WTASS-GRY-GLKDVLLHMISN
TLNY--------------GIKG------SGEP----------EFKIK-HYQHMTDLVDFV
LD---GR-KRL-LESV--------------------------------------------
--------------------------------------------------------QDED
KRAVLL-----QQFESQRSDLIFP----------LVDA----------------------
-----EQYELAAKLAEKYLDFQI-------------------------------------
-LVVICDKTNN---------------------------------QARLD----EYIERYK
--EYDFSQFAISWHMRQNKQGDIFHR-----FKG----NQAELARFLSDH-P---SLAWI
QLVF-NGELAQAADVLLALAQNE-------------------KELLNRKR-VMLSLSKLC
ALAAEG----------------------DFSAQITEINSEVRLLDLQEQIPVDILNIY--
-----------------------------------------GYDTKNAKVL---------
----------------------------------------SPEEIVDLYI-----ADEY-
---SKSS--------ETEFRKALELLDFVEDP-------IEVRHKIWCAAIL-RD---NW
EDY-----------------------------------------------NRS-A-----
-------------------PLDTMQGMMFFRLIDLCYI-LDGE-----------------
------------------LEN-FLPPV---------------------------------
-----E-SFLSAPELGDLVES--------KSFQYLIKLGYEHI-----------YDSYKK
----------------------------------------K
>gi|118779714|ref|XP_309655.3|	   1147 residues, 50 /line  ENSANGP00000019714 [Anopheles gambiae str. PEST]
------------------------------------------------------------
------------------------------------------------------------
----------------S---------SSRYSLS-----SRSNVSTLRVVAKSEYNILESY
G-FSL--PVQVT--------------------------EVLTFNE-RSI-----NVSVNY
GQNG-----WAWLVQGRRLFVW--QYRDNVGQKSAGSG--FGGEPFAT-PRRPYAGQCRQ
LTLPH-------CDIGHKATLVAVFV------------------NEGQQMASCLAVSP-A
G--DVRYWQSIAH-----------DGSSIDECN-ILEG--------------------QE
-------------------------------------FEQLVGLGGQEFV-LATTTCSLM
RLNVHLQNGRYVIVPRLIKPPS-----GFFGGIGK---RFASIIIGMNS-GQDRENKL--
-------------VKMSCEKISHNPT---EWHVTVLADRWIQRWAVQPQNGIERF-LSED
ADIMKKMRDFF----HQKLWST-------------------------RDASEIELWALDM
QPTDRG------------------------V--IILAAAVNQ-QR--S-QQVYYALMTVI
YE-ADST-FTL-------KDTT-IM-RYKGFYSA------ERLA--ELIDF---------
--------------------RFIA--NRS--------------IAYVYNDRCIFPVALN-
-------DAGAGSIASTAEDVEKIEFHA-REDM-ILMGNCFQNMPLFFSRL---------
------------------------------NGMVIVTPSDFD----------------PS
-DMFNS---SVSSDVFNP------------------NGS---SIAD--------------
---------------ATSIFAPATTNAGNLILYEL---------DPEEIANTATDGPDEL
DPVHQLKAAF--IYHIKRNTVAADGLIASMLELPG--QRE------LVDGELDRTVLKIA
IDLAQDTPA--------------------ADPRW-EVTDKHALG----------------
-----------------------SSTSMQIIQQLREKNVAYTQF--IEFLHSRKL-----
--WDRLNAVTSGAGAGTEAGNARPTSL---CLADIGEKIVATIGIKCLHNSHSR------
-----------------------------------IIDEAINLVLRQSNRTVP-------
------FPNLTPQDLFYAQTNRVEELFKVLSELVDGYVQ-QELT-AL-------------
-----------------QIQSALVEVNTIVLTVLQEVVKYR----ESKAGTFT-----VR
-EE--LQK---------RYEQ-------------IP--WTAMP-GKH-GLRDVLLQLISC
TLRH--------------GVKG------TAEP----------EFRMK-HFKHLTELIDYV
LD---GR-KTY-LESV--------------------------------------------
--------------------------------------------------------HDEE
KYAVLL-----QQYESQRSDLIYP----------LVEA----------------------
-----EQYEMAAKLAEKYLDFQT-------------------------------------
-LVEICDKTNN---------------------------------QERLD----EYIERYK
--EHDFSQFAISWHMNQNRQGDILLR-----FKN----NQSALARFLVDH-P---SMAWI
QLLF-NGEIAQAADVLLSLAQRE-------------------KELLARKR-AMLCLGKLC
LLAAEGD---------------------TFQGQIDAINAELELIDIQENIPSEILEMF--
-----------------------------------------GYDTKHAKVL---------
----------------------------------------TPEEIVDLYI-----ADEY-
---SKSS--------EKEFRYALSLLPYVEDP-------IEVRHRIWCAAVL-RD---SW
EEY-----------------------------------------------NKN-A-----
-------------------PLDSMQNMLFFRLIDLCYISDAGE-----------------
------------------LEN-FLPPL---------------------------------
-----E-SFLNAPELGDLTQS--------KSFQYLMKLGYEHI-----------NESYRK
----------------------------------------K
>gi|111058746|gb|EAT79866.1|	   1383 residues, 50 /line  hypothetical protein SNOG_12568 [Phaeosphaeria nodorum SN15]
---------------------------MAYNMPPATPQRPGPGAFINTPAPNRP--NLQR
QSSMSQSQSQPPQQQQQQQQQQQA--------LPAPPVESPIERA-AR-TINIMLDRDN-
----------RYPSLEG---------YIGPGVEVLMKATEGISGEYELSSSTAWAPFQKL
RSYRL--PDAVF--------------------------EQVDHTQ-MSM-----SMGL-F
AEIN-----HAWVVVDNQVYLW--DYTHPNPELVGFEEQPSNITCVKLVKPRAGVFVATI
EYLLV-------VATVTDVFLIAVECQRG---------------PEGVHSVTLYRTGL-S
T--SVRRINVTTI-----------EGSARTGRI-FFGD--------------------GG
TEDVYELNYQQEDRWFSSKCSKTNHVSPTVGLPALPFYGKSTQVGTQSMV-IDDTRSLLY
TLSTTGTI---KVYHMRAPSS---------------------------------------
-----------------------------LECVITRTLVSIQTMCM--------------
----------------HLVRQPN------------------------VLANMVIVSLSPI
TSPEAD------------------------F--MSLMAT-----T--STGCRLYFSTTSG
TW-NSDS-SSA---------PS-NM-QLKHIRFP------PNDA--QSSQQVNGAPAQPY
QGGAPVGFDSKFLELTTLGNRYAP--GSF--------------FAFVAKSGSV-------
--------------------NQSLFMSA-PHSG-LLGQRESSEPPRYTETA---------
------------------------------IALELVGKVQDI----------------GQ
VTPPFS---ARSEPLGFG-----------NELSTQFDQPSSEYAII--------------
---------------TSSGIETVRRKRLVDIFAAI---------IKQGGGQEGTEG----
---------D--IRKLAKQYGLAETAATALAVACG--QGSDVGPDSRIAKVTEPEVLDMA
RRVFIEFGG--------------------KAHLT-ESATVEGLSVENVRASPRHDGIAMY
VARLIRSIWTSPIITQVVTPTGPVLASAQAVPKLQDIQRSLAQL--QEFLDSNKS-----
--SIEGLAGPE----ALGRATSRQEEV---ELQGENRALTSLLAMVNN------------
-----------------------------------IVEGISFVLVLFEERLED-------
------ILALLPDPQMQEKVRRL-------TFQGLFSAH-EGKEIAR-------------
-----------------ELVKAIVNRNITKGSNVETVAEAL----RRKCGSFC-----SS
-DDVVIFK---------AQEN-------------LK--KAADM-GAN-AERGRILLNDSL
RLFE--------------QVAK------SLSY----------ENLNS-TVDKYIE-----
------------------------------------------------------------
------------------------------------------------------------
-----L-----EFYAGAIRLALRV----------AADL----------------------
-----DRGNKALSWVREKNDPTTDPNDVRRDFYDRRASCYTLVCRVIESVDQAYNSQGPT
PDGVVSQITRR---------------------------------KHEAY----EQINNSD
--DEVFQNYLYDWYMSKGWAERLLEI-----NSPFVVDYLRQSAEKDLAH-A---DLLWR
YFAH-YNDFLSAAETQYQLAKSN-------------------LPLTLEKRIEYLSRAKAN
ASTRMTG-----------FTETGVRNRQSRQELLRNISDHLDIANIQDDVLQKIKADN--
-----------------------------------------RLDGERRSQVVSLLDGSIQ
PLDELYHNYADQAAYYDICLLIYHVADHRNIPDIRHTWSNLIEQVHKYAV-----HDQQ-
---AAPW--------EAVAMKVEEIGLRTNQN------ENVFPVNIVLQLVL-QY---DL
EFYTHDTNPRNGGASQDLAPNANLTWPIDVFLRLKSPFEYLVATLEALWYAQE-H-----
-------------------PFTGRNRKLLVKWIIYLIEQWAITSRRAGALFGGPEN----
------------------AIG-LADLL---------------------------------
-----R-VVLGSDVLGREVDD--------QVWVQRARDVAAAV-----------DEAA--
----------------------------------------R
>gi|111066286|gb|EAT87406.1|	   1269 residues, 50 /line  hypothetical protein SNOG_05015 [Phaeosphaeria nodorum SN15]
---------------------------MFSPEASIVSQRSSLRA---------T--SKRR
QRTSEGLQQQP---RRKRSKLGDE--------TFVAKDDAHINGN-GSLLMNGHAAHDS-
-----------------------------PESSLVLVDMPVRE--KKAAPKRAVKEDNAL
Y-LKL--PGFPK--------------------------ALL-----RAP-----YYASAL
PSAG-----LALALTHERALVW--DYNAETASKI------------------------VS
LLLPF-------GLRASDPLPLGAIV--R---------------NGPTNDFGVVAVAPST
G--KIAFWENIDGAEARNLYPQRHQGAEGA-VK-LYSG--------------------EV
-------------------------------------VNDIVDIEHAGFV-LITSSGRLA
HLTLRDSQGRPNIAATILNAPN-----SSNGSFFS----FRGLIAGA------VRKTI--
-------------ASVKARPSDSKGQ---MEIITVTSAGLFQQWDLNWSGQHN---FVRE
VDAQAELAAKV----QSGASPES---------------------RNLQDVQVLDFAIIEQ
QHSNAS------------------------VGLLVLVASTGP-------ESIDYSLLEVD
LS-STG--ATI-------TRRIPLS-SFHQP-QI------PQEP--TATLL---------
---------------------LPH--PGH--------------TAYVQFPGAICVASLAR
PEETPDNQLLLDSGNPPLPFQDTIYLRE-EPSV-VIAGHSLGDKN---------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---TKEKRAI--AYLFVQ----------------------------------EYGVLQIT
LGILSSSYE--------------------YID----------------------------
------------------------KVTSSMDDQFQKRAAALRTL--INRLLSDYP-----
-------------------PLSFVTKW---RLLWQAEKLAAAHKLWLWYQEKQQDQLKHP
E---------LYPDNIIVGDIIRALNERYKTPIRPELGENDFIRQFFLKDVDS-------
------INILIPWGWFFLRTF--------------YIKD-GSKE-HP-------------
-----------------PIMQRLSEGGDVMLVALEGAFEFR----QANIESYG-----LD
-PS--ALE-DGILKPGHGYDI-------------LPAVWTSSH-NIV-SSLRSLVDVGRN
LAVS--------------NFEE------GHQE----------ALAQK-IGKDNPRLVKVC
CQTHIER-FQW-ALE---------------------------------------------
--------------------------------------------------------QSEE
KQREMGRSLKNEWNNIVRPAHIIG----------LMEI----------------------
-----GLATDGMKLAEQYHDMPT-------------------------------------
-LVDLVWDETNWLE-TEKANTRSKMEQAESTVKLNR-------IKERIS----RYFEIYG
--D-DWAEAFYSKYIKENQAAQLFTK-----EYL----NQPALTKFLRAE-PSRARLRWI
NEVCGEKNYEAAAAALHEAGSKQ-------------------ETNAWCQR-VELSIAKLA
MLCKKELKEDAAPPPAPTESTQRTKAERIRDNRFVSTACHLEYAKIREEIYEQMLPHIRN
ALDD---DSAVELLMNDF---GQG--RLAQRPALQAVLREGFENLIHHRVI---------
----------------------------------------DPALMIDILT-----LMDSG
ENESLLQ--------SNEFIYAIRVLMINWHDIHKT-TRDGLLKLVWKRLCI-KD---DW
AKI-----------------------------------------------NKT-K-----
-------------------EVSDAQLEDFLLDTNLAWVFREIMHLNTANPTSRIGWPKRL
QDIIGSGGTHGELCVRFSSED-IRDPI---------------------------------
---IKD-NLLDDDVLKEHIEQ--------NRLDEWFVAACEAG-----------KKAYRA
EWRGAHQQQVPSIQVQEY---AEQAQTAGEVADVDMQ--DS
>gi|115451665|ref|NP_001049433.1|	   1290 residues, 50 /line  Os03g0225500 [Oryza sativa (japonica cultivar-group)]
--MFSPAIKKPHLLHRRDKEEASPSPPP------------------------------AP
AHTPAP--------------------------------------------------RGFA
VHDRPATGTPAPWTSS-SLLARISTSTR------------TD-RTGDSGQIQPV-----H
V-SEF--PQIVR--------------------------NAQANLLQKSFSGKNMLAGGID
KETS-----LAWMLCGNELFIW--SYLASVA----------------------KD--CLV
LEVPSSLMGNKEEKS--LCGNQWAVCIVRWGSSGASTRSSGDILHRRS-STGFILCNKRT
Q--AIAYWSDIYAESSKSSVLDLIGYGDTSS---------------GDGTSGNCRINSLI
-------------------------------------AVAVPGGINECIVIASQPTGTLW
MFWCSPAAVRRREI----------------------HKGTLGVYN---------------
ADHSQKNSGGRSLAWLP-SKASSKAA---ERTFFLLTSHELQCWSISFGHDINCKKIGSQ
EIVGSDGDMGIK----------------------------------KDIAGQKNIWLLDM
QIDDHG----------------------KEI--IILVATFCK-DRVSGSNYTQYSLLTML
YRP-NQKFSSEDNVIKTERFLE-KKAPSQVIIPK---ARVEDEE--FLFSM---------
--------------------RLKTGGKPSGSVIILSGDGTATIAIYWRGSTRLYQFDLPW
DAGKVLDASVIP---SSEDR----------------------------------------
------------------------------DEGAWVVLTEKAGVWAIPEKAVLVGGVEPP
ERSLSRKGS------------------------CNEAVAEEKRRNQAFNASVVPRRASSE
AWSAGERQRPALTGIAQQAVV-------------------------------------DE
ESEMLLNRLFHDFVLSGTVHEALQKLRAAGAFDKE---------------GEMNIFVRIS
KSIVNTL-----------------------SKHWTTTREAE-------------------
---------------------FLAST---IVSSLTEKQQKHKKF--LQFLVLSKC-----
--HEELSSKQR------------TAML---TVMEHGEKLSGMIQLRELQNALSHQRSSIH
LSPQSK--NQTTGALWN------------------LIQLVGEQSRRNT------------
----VLLMDRDNAEVFYSRVSDIEDLFNCISHQLQYIITGEENP-S--------------
-----------------VQMQRALELSNACMTLVQAALRYR----EEHKDWYP-----SP
-EG--L----------------------------IT--WNSQP-VVRSGIWRVASFAMEL
LREPG-----------------------AADM----------SMKSN-LWSQLERLTDIL
LDAY----IGL-LTAK--------------------------------------------
---------------------------------------------------FERG----D
EHGVLI-----QEYCDRRDELLGS----------LYDLAKQIVDAKYQETTEVTDNLELK
ESIFREVTSPILATAKRHEGYQT-------------------------------------
-LWQICYD--------------------------LS-------DTGLLRS----LMHDSV
GPHGGFSFFVFKQLVNRRQHAKLLRL-----GEE----FPEELANFLKER----DDLLWL
HEIC-LNRFSSASKTLHTLVSPEEDANLTSNRK---------SLSFVERR-RFLYLSKIA
AAAGKD---------------------VDYEVKVAHIDADIRILNLQEEIVQHDPE----
----------------------------------------YAPDKYTTKPF---------
----------------------------------------RPLELIEMCL-----KGDR-
---ELS-------------LKAFEVFAWTRA-SFRS-SNKGLLEACWMNAAD-QD---DW
VSL-----------------------------------------------QEE--SSG-G
WSDEV--------------IQESLQGTVLFNASRLCYS-PDAV-----------------
-------------------------------VYDGSFEDVLPVKK---------------
-------EDVHLRGLEGRCLSVEEVLMQH--KDFPDAGKL--------------------
-------------MMTAVIMGKELPYTVSTAEPVDMD---S
>gi|115921013|ref|XP_781849.2|	   1215 residues, 50 /line  PREDICTED: similar to nucleoporin 133kDa [Strongylocentrotus purpuratus]
------------------------------------------------------------
------------------------------------------------------------
----------------------------------------MQ-SFQVIEETPQY-CVETF
G-PSL--PVLIT--------------------------EVLLQA-----DRSANISVKL-
DNSG-----WACLVCDRRLFIW--RYKQTQA---------------------ARIGLCYQ
LALPA-------TELCHRADLICLIP------------TGGGSSGADSQ-MVSVLAVSPE
G--VVRYWPTAHREIA-----------YSERSLEL-GGQ--------------------E
-------------------------------------CFTLTAFGKHQCI-LATTTNQLM
MISVSPSTMQSQVEVHTLKSSQ-----GMIA-------RVSSFLFGAQKDE---------
--------------TSGLRRVLAGSAESAGYPLYILQDSILQKWFISGPGQEQVV-----
YEKQ--LDGLFKQQFQREMGA--------------------------SSMENIKVWLLDI
QLISNI------------------------A--VILAGAVNT-SS--PNQRIKIAIATLK
VQVDTDT-----------PTKL-ES-FVVASTPP------QDSDDEGALDK---------
--------------------HLLLANPGGP-------------HCYIYSQHSIVCCSGLF
---------------DQMPSFQEVGFSK-AGDS-IRGAGCFDGQAIFFSSN---------
-----------------------------------------HGVITVNTSQSE-------
-MPSFIMDDSRTGQTSRLEQSMQQQSMQQQSMQQQSMQQSSFTTPS--------------
---------------------------ARSRPFQVMSASRSRPDTSILETTG----DLEE
DKTNGLKMAF--LHSCKHDMNKAENLVQDLFLQDTFERGKTN-------SSLDQAVAKLS
RELIDDFPA--------------------SDPRWAESLPQDSV-----------------
----------------------ASTGSLILLHQLEDKMKAHEHL--VKFIKDVGI-----
--WDMLHSVIVRDL-------PQTTHN---LLSEHAEKLSAARALCNKHVKFQG------
----------------L------------------IDTAVCRALRKRKQDAVP-------
-------SGLTPRDIFYREVSKMEDIVEALMEEEQDLLSS-GLT-PQ-------------
-----------------DTVSLISSINTIIQSVLQEAWHLH----QSRSLVYQ-----SH
NEA--SGT---------SLPF-------------IP--WIASS-GPR-GIRMQLVQQHNL
TVGR--------------AVAN------AEDA----------QSRSG-LFQQLQSITDLL
LEGY----IAQ-LESSMQADGEDSVQYAELEQRYTQERTTLISPFSSSGPRGIRMQLVQQ
HNLTVGRAVANAEDAQSRSGLFQQLQSITDLLLEGYIAQLES--------SMQADGEDSV
QYAELE-----QRYTQERTTLISP----------FLEH----------------------
-----RQFERAAVLAEKYCDFGI-------------------------------------
-LVELCESG-------------------------TG-------RKDRLQ----YYMDQFS
--NKGFSDFVFKYYIDRGQRGKLLTHF------A----HRPELSEFLQPH----DHLGWL
QDIH-TNNYSQAQDTLRKLATRE-------------------SFSVSKKK-TLLSLGKLA
ALASDNDH----------------------QREIGEINAELDVITHHEQLPRELIQK---
----------------------------------------LNLNGDDLPCM---------
----------------------------------------TPQQLIELYI-----SERN-
---TNSN--------EYDFKKALDLLQYLHK-EGS-L-YTDLMVRIWCRAIL-RD---EW
NEM-----------------------------------------------QGVD------
-------------------PWDYIKDSIFFKTAAKALQ-EGLD-----------------
------------------LTE-CLPDPD--------------------------------
-------TLMQHYELQGMRDN--------TRFEYLLRTGFEQIG----------------
----------------------------------RSLAAAE
>gi|116505590|gb|EAU88485.1|	   1117 residues, 50 /line  predicted protein [Coprinopsis cinerea okayama7#130]
MDIDEDS-----------------------------------------------------
------------------------------------------------------------
------------------------------GNG-----TELS-GPAETTYAKTEELSVSF
Y-ANL--PIEVK--------------------------QVLRNAD----FYKTAYMGGID
TTTG-----FAVVASAKTCFVW--QHAQAIKG--------------------TPTCYIFL
CPP---------ESDALHPPFHALVP-----------------QGASQ-EPGLILI-SHS
G--QIRFWESIGIG----LAGGDN-FATF--DLNLRED--------------------EH
-------------------------------------VTNLTRVDSQLFV-ASTSQGALY
RLVLTSTGGKYHLSSRIFSRPP--VARGLSSFLPSFLGSSSSVL-----NDDANSTYI--
-------------RSIAVTPPSDTGE---RSVWVL-GEENIQQWIMRPDGWEE---KA--
IDEN--VSESIKIVLE-------DLPSAP--------------------DGNLDLELLDL
AIDDTG------------------------K--FILLVSYSGVEEDTGGIKRLYALTQLV
LT-SSET-KEF-------FSVD-TI-KQVPYQNT-------SAPS-APVVP---------
--------------------RIQLLFSGS--------------IVSVEFGDTVAF-----
----------------------------------CAQESNFQDRIQLKSI-----ADRTL
GVGVSQ-------------------------ATSTLLVLTATTMMQVELSLDKIR-----
-----------------------------------------------------------A
FNPETGHTNLIKSILMQAILYGASPEN-PLHFSF--------------------------
------PPQI----DEESLMRGAEQLSQAVLRSDP--E----VVR--RNHDLTAQLNGRR
DRLNW-------------------------------------------------------
------------------------------------LIGFINENLVLGKMSQRSR-----
--------------------------Q---RLAIDAEKLFAALQLWIQYNELLATNP---
--------------TFT------------------VLNDAVHSYMA----------DAGE
MQHE-----DVMRAFFRYKVADLGNLIRKIFSIITLSAS---QT-NR-------------
-----------------DVALLLPEGNRIVITALRSAFEYR----AHNFQVYG-----IE
-LP--MI---------------------------SS--WTSRP-KTADVVLDLFNATHDA
LEKV---------------LVE------NPAS----------KPREIEPGCQLPQLAALF
FECVSER-LEW-LSSP--------------------------------------------
------------------------------------------------KAADE--AGSSQ
DRDKLE-----QYFNSLRPGMLET----------LRST----------------------
-----GFQEEAFSLAERYQDFAS-------------------------------------
-LVALCHRETV------------------YPPENNP-------NLE----RIKMYIQKYG
---DKFTDELYQWYIQHGELRAMFSQ-----EHE----QSAFIDKFFLKN--PNPGISWL
HDIG-KENYGDASAALLEESTRAN--------------------SLEVKH-LMLSLAFHD
---------------------------------------QLDFISVHDGLATEFKSALQG
VRGRHSLESQVDIIMNA------KAPGLKEYKAFAKCFKDLLKHLLQGRAL---------
----------------------------------------SIEDAVDLLTMK-DN-----
----REN--------LSDYSTALHLLASASN-LPE-ARRLSAFRTVWRRVYL-HD---DW
KAI-----------------------------------------------GKT--A---G
VADAT--------------ITDRYKGTALYATLCATLA-RARS-----------------
------------------ERVPNGYETSPDVALMVPSASEIAARW----SGLSQEQ---I
EAIVEDY-NLERDKLGE------------LELEDIYHRIREL------------------
-----------------------------AVQDSSS----W
>gi|118088233|ref|XP_419576.2|	   1181 residues, 50 /line  PREDICTED: similar to nucleoporin 133kDa [Gallus gallus]
MSFTGAALRRHSAAPGRSFCSASLSPAMFPSAP--ASPR-TPSGSARRA-L---------
---GSAAPSPLSRPGSRKNLAVVA------------------------------------
-AAAGSPGLFSPVARRSGSLSARATPTRV------------I-QHPSASETVNY-DVKAF
G-SAL--PVQVM--------------------------EALKKA-----DADDHLSVQV-
DESG-----WAWLVHKERLIIW--KIGQSPL---------------------AKLSLCKE
LQLPP-------SDYQWSSSLAAISC------------LGSSGDAPSLQ-SLAIMVATSE
G--SVRYWPNLAHEGS-----------YTETFTDF-GGS--------------------L
-------------------------------------CSFLTAVKGGSFI-LSSSRGQLV
RL-IPDSSGK--IHQHALPQGQ-----GMFSGIGR---KVSSLLGILSPGS---------
--------------DAVISSVLWDKE---RSSFYMLTSSNLNKWEIDSSSERYIL-----
-SWD--VNRILKEHIADAIWGSE--------------------SNYEDIKGGVNIQYMDL
QQNRDG------------------------L--VILAAAWHP-GD--HPCLVYYTLITVE
DK-GFQ----M-------SDDV-VV-EVTQYNPS------FQSEE--EVMC---------
--------------------CLVVPDYFSH-------------AAYIYKEDEVFACSTGT
G--------------RISLPQEKILFGF-QGDS-ILGAGSYTSLPIFFVKR---------
-----------------------------------------SGLITILSRE---------
-NISVLPED--------LEDSLS----------------SSVAGPI--------------
---------------------------SESPAFDP---------ASRLEVVA------QE
DKTKLLKAAF--LQYCRKDIVNAQSMVVELFPSNA--DVDSD-------AELDRAVTQIS
VDLIDDYPA--------------------SDPRWAESVPEEAS-----------------
---------------------GFSNTSLILLHQLEDKTKAHSFF--IEFLHQVGI-----
--FERLGSFPVRGM-------PMATRL---LLCEHAEKLAAAIVLKNHHSRLPD------
----------------L------------------VNAAILIALNKRDCD-IP-------
-------PSLTPADIFFREVSQIDSIFGCLLEEEEQILREMHIE-SI-------------
-----------------EWAQVVVNVNNIIKDMLQAACQYR----QSRASLYK-----TG
-EL--PER---------EPEY-------------IP--WTASS-----SLRAAITRQHGI
ILKV---------------VYP------QVDS----------NLRSI-VAEQVVALLDCF
LDGY----VSQ-LKSV--------------------------------------------
---------------------------------------------------DR--PADQE
RYSNLE-----MEYVQKRSELLSP----------LLSL----------------------
-----GQYQMAAALAEKYCDFDI-------------------------------------
-LVQMCEQ--------------------------TD-------NQARLQ----RYMTQFA
--DQNFSDFLFRWYLEKGKRGKLLSQ-----PIA----QHGQLASFLQAH----EHLSWL
HEIN-SQDLQKAHRTLQTLANME-------------------TKYFAKKK-TLLGLSKLA
ALASDFSED-------------------ILQEKIEEISEQERFLLHQETLPEQLLVD---
----------------------------------------KQLNLNDMPVL---------
----------------------------------------SATQLIDMYI-----CDEN-
---RRAN--------EYDFKKALDLLEYIDE-EEE-VDVNDLKLKILCMALR-RD---GW
SSS-----------------------------------------------EGKDD-----
-------------------PIEATKDSIFVKILQKLLK-EGVQ-----------------
------------------LSE-YLPDVK--------------------------------
-------DFLQANELGSLRYN--------AYFEFVLKANYELYV----------------
----------------------------------HGQ---T
>gi|126307020|ref|XP_001369272.1|	   1154 residues, 50 /line  PREDICTED: similar to nucleoporin 133kDa [Monodelphis domestica]
---------------------------MFPSVS--ASPR-TP---VRRGPL---------
---GGVTSGSTPRPGGRKGLT-LG------------------------------------
-PALSSPGLFSPVSRRS-SLSARGTPTRM------------V-QHQSVSETINY-DVKTF
G-SSL--PVKVM--------------------------EALALA-----EADDQLSVHI-
DESG-----WAWLVFKERLVIW--RIGQSPV---------------------SKLSVCKE
LQLPP-------SDFQWNADLVALSL------------PA-TYKVHSVQ-SVAVMVATRE
G--SVRYWPSLAHEDS-----------YIETSVDF-GSTD------------------KL
-------------------------------------WSFLTAIQGGSFI-LASSRAQLI
RL-IPENLGK--IHQRILPQGQ-----GMLSGIGR---RVSSLLGILSPSN---------
--------------DLTLSSVFWDKE---KSTYYTLTSSTLSKWEIDSTSERQCQ-----
-NWD--INKALKENITDAIWGSE--------------------SNYEDIKGGVNVAYLGL
KQNCDG------------------------L--VILASAWHP-GD--NPCLTYYTLITVE
DN-GYQ----L-------SGEV-TV-EVTQYNPP------FQSEE--LMTC---------
--------------------RLLVPNYSNQ-------------AAYLYGENSVFACSTGT
G--------------RCSLPQEKIIFSA-HGDS-ILGAGSCASVPVFFSRN---------
-----------------------------------------SGLVAIVSRE---------
-NVSVLPED--------LEDSLA----------------SSVSGPN--------------
---------------------------NESPVFEN---------TSKMDTIA------QE
DKTRLLKAAF--LQYCRKDLVNAQILVDELFSSHP--DSDSD-------IQLDRAVTQIS
VDLVDDYPA--------------------SDPRWAESVPEEAP-----------------
---------------------GFSNTSLIILHQLEDKMKAHCFL--MDFIHQVGL-----
--FERLGTFPVRGV-------PMTTRL---LLCEHAEKLSAAIVLKNHHSRLSD------
----------------L------------------VNTAILNALNKRECD-VP-------
-------PSLTPADVFFREVSQIDTIFECLLEQEEQVLKDTPME-SV-------------
-----------------EWAQVVLNVNSILKDMLQAANQYR----QSRNSLYR-----TE
-EL--VEK---------EPEY-------------IP--WTATN-GPA-GIRTAILRQHGI
VLKV---------------VYP------QVDT----------NLRNI-LTEQLVTLIDSY
LDSY----VSQ-LKSV--------------------------------------------
---------------------------------------------------DK--PSDQE
RYNNLE-----MEYIQKRADILSP----------LLSL----------------------
-----GQHQWAASLAEKYCDFDI-------------------------------------
-LVQMCEQ--------------------------TD-------NQTRLQ----RYMTQFA
--DQNFSDFLFRWYLEKGKRGKLLSQ-----PIS----QHGQLTNFLQAH----EHLSWL
HEIN-SQDFEKAHTTLLGLANME-------------------TRYFAKKK-TLLGLSKLA
ALASDFSED-------------------LLQRKVEEMTDQEHFLLHQETLPEQLLAE---
----------------------------------------KQFNLSTMPVL---------
----------------------------------------TAPQLINLYI-----SEEN-
---RRAN--------EYDFKKALDLLEYINE-EED-ANINDLKLEILCKALQ-RD---NW
SSS-----------------------------------------------DGKDD-----
-------------------PIEVSKDSIFVKILEKLLK-EGIQ-----------------
------------------LSE-YLPEVK--------------------------------
-------DLLQAEELGSLKNN--------PYFEFVLKANYEHYV----------------
----------------------------------QGQ---V
>gi|149607980|ref|XP_001521408.1|	   1141 residues, 50 /line  PREDICTED: similar to Nucleoporin 133kDa [Ornithorhynchus anatinus]
---------------------------MFASPA---SRR-T-------------------
------GPGPAPRSAARKSLA-LP------------------------------------
-AAIGAPGLLSPMGRRG-SLGARGTPTRT------------G-QHQSASETTNY-DIKTF
G-SSL--PVKVM--------------------------EALALA-----EVDDQLTACV-
DESG-----WAWLVCRERLIVW--KIGQSSV---------------------AKLSVCKE
LQLPP-------TDLDWNADLVALSC------------PAQPGEAPSAQ-SVAVMAATRE
G--AVRYWPSLVHEGS-----------FTETVIDL-GGAD------------------RT
-------------------------------------CSFLTAVKGGSFV-LATSGSQLF
RL-LPEGSGK--IPHHALPQGQ-----GVLSGIGR---RVSSLLGILSPSS---------
--------------EIMLSSVLWDRE---HEVLYTLTSSNINKWEMDDSSERQAL-----
-SWD--INRALKENIADAIWGSE--------------------SNYEGIKGGINVEYLDL
QQTCDG------------------------L--VILAVAWHP-GD--SPCLMYYTLVTVE
DA-GYQ----M-------ADEV-TV-EVTQFNPP------FQGEE--SAVC---------
--------------------RLVVPDASAQ-------------GAFLYTENAVFACSTGT
G--------------RSSLPQEKILFEA-QGDG-ILGAGSCAGLPVFFSRN---------
-----------------------------------------NGLVSILSRE---------
-SMSVLPED--------VEDSIA----------------SSVAGPH--------------
---------------------------PEPSLLDS---------TAKIDAVS------QE
DKTKLLKAAF--LQYCRKDLGQAQSMVDELFSP----EADSE-------TEVDRAVTQIS
VDLVDDYPA--------------------SDPRWAESVPEEAA-----------------
---------------------GFSNTSLILLHQLEDKMKAHSFL--VDFIHQVGL-----
--FERLGTFPVRGA-------PMATRL---LLCEHAEKLAAAIVLKNHHSRLPD------
----------------L------------------VNTALLIALNKRECD-VP-------
-------PSLTPADVFFREVSQVDTIFECLLEEEERVLKETPME-CA-------------
-----------------EWAQLVVSVNSILKDMLHAASQYR----HSRNSLYT-----GD
-EL--ADK---------EPEY-------------VP--WTASS-GPA-GVRTAIIRQHEI
VLKG---------------VYP------QVDS----------SLRGV-LTEQLVALIDSV
LDGY----VTQ-LKSV--------------------------------------------
---------------------------------------------------DG--PGNRE
RYSTLE-----MEYTQRRSDLLSP----------LLHL----------------------
-----GQHQWAASLAEKYCDFDI-------------------------------------
-LVQLCEQ--------------------------TD-------NQTRLQ----RYMTQFA
--DQNFSDFLFRWYLEKGKRGKLLSQ-----PVA----QHGQLASFLQAH----DHLSWL
HEIH-SQDLEKAHATLQGIANAE-------------------TRYFAKKK-TPLGVGSLG
VVSSESRRE-------------------SRSVDPSDHSQDPRHFLPTSSLESKTITR---
--------------------------------------PARHLLLPSPPLI---------
----------------------------------------L---LPQLYI-----CDEN-
---TRAN--------EYDFKKALDLLEYINE-EED-VDISDLKLKILCRALQ-RD---TW
SSA-----------------------------------------------EGKDD-----
-------------------PIEASKDSIFVKILQKLVK-EGIR-----------------
------------------LSD-YLPEVK--------------------------------
-------DLLQADELGNLKSN--------PYFEFALKANYELYV----------------
----------------------------------QGQ---M
>gi|149758061|ref|XP_001497726.1|	   1156 residues, 50 /line  PREDICTED: similar to nucleoporin 133kDa isoform 1 [Equus caballus]
---------------------------MFPAVS---SPR-TPGPGARRGPL---------
---GGVGPSSTPRATSRKGLA-MG------------------------------------
-SAVSSPVLFSPVGRRS-SLSSRGTPTRI------------F-PHHSVTECVNY-DVKTF
G-SSL--PVKIM--------------------------EALTLA-----DVDDQLTVHI-
DEGG-----WACLVCKEKLIIW--KIALSPI---------------------TKLSVCKE
LQLPP-------SDFHWSADLVALSY------------SAASGEAPSTQ-AVAVMVATRE
G--SIRYWPSLAGEDS-----------YTETTVDL-GG-D------------------KT
-------------------------------------YSFLTAVQGGSFI-LSSSGNQLI
RL-IPESLGK--IHQHIVPQGQ-----GMLSGIGR---KVSSLLGILSPSS---------
--------------DLILSGVLWDRE---RSSFYSLTSSNISKWELDDSSEKQAH-----
-SWD--INRALKENITDAIWGSE--------------------SNYEAIKEGVNIRYLDL
KQNCDG------------------------L--LILAAAWHP-AD--NPCLIYYSLVTVE
DN-GNQ----M-------SDAV-TV-EVTQYNPP------FQSED--LIMC---------
--------------------RLMVPNFSNQ-------------TAYLYTESAVYVCSTGT
G--------------KFSLPREKIVFNI-QGDS-ILGAGSCGGIPILFSRN---------
-----------------------------------------SGLVSITSRE---------
-NVSLLAED--------LEDSLA----------------SSVAGPS--------------
---------------------------NESMVFET---------STKNETIA------QE
DKTRLLKAAF--LKYCRKDVGHAQMVVDELFSSPS--DLDSD-------HELDRAVTQIS
VDLVDDYPA--------------------SDPRWAESVPEEAP-----------------
---------------------GFSNTSLIILHQLEDKMKAHSFL--MDFIHQVGL-----
--FGRLGTFPVRGM-------PMATRL---LLCEHAEKLSAAIVLKNHHSRLSE------
----------------L------------------VNTAILIALNKRDCE-IP-------
-------SNLTPADVFFREVSQVDTICECLLEHEEQVLKDASLE-SV-------------
-----------------DWAEVVINVNNILKDMLQAATHYR----LNRNSLYR-----RE
-EP--LEK---------EPEY-------------IP--WTATS-GPA-GIRTAIARQHGI
VLKM---------------VYP------QADS----------KLRST-LTEQLVALIDCF
LDGY----VSQ-LKSL--------------------------------------------
---------------------------------------------------DK--SSDQE
RYNNLE-----MEYLQKRSDLLSP----------LLTL----------------------
-----GQYLWAASLAEKYCDFDI-------------------------------------
-LVQMCEQ--------------------------TD-------NQTRLQ----RYMTQFA
--DQNFSDFLFRWYLEKGKRGKLLSQ-----PIS----QHGQLANFLQAH----EHLSWL
HEIN-SQELEKAHATLLGLANVE-------------------TRYFAKKK-TLLGLSKLA
ALASDFSED-------------------ILQEKIEEMAEQERFLLHQETLPEQLLAE---
----------------------------------------KQLSLSAMPVL---------
----------------------------------------TAPQLIGLYI-----CEEN-
---RRAN--------EYDFKKALDLLEYIDE-EED-VNINDLKLEILCKALQ-RD---NW
SSS-----------------------------------------------DGKDD-----
-------------------PIEVSKDSIFVKILQKLLK-DGIQ-----------------
------------------LSE-YLPEVK--------------------------------
-------DLLQADQLGSLKSN--------PYFEFVLKANYEYYV----------------
----------------------------------QGQ---M
>gi|26325276|dbj|BAC26392.1|	   1155 residues, 50 /line  unnamed protein product [Mus musculus]
---------------------------MFPSVS---SPR-TPGPGTRRGPL---------
---VGIGPTSTPR-ASRRGLS-LG------------------------------------
-SAVNSPVLFSPAGRRS-SVSSRGTPTRI------------F-PHHSISESVNY-DVRVF
G-SSL--PVKIM--------------------------EALTMA-----EADEQLSVHV-
DEGG-----WACLVCTEKLLIW--KIAVSPV---------------------TKLSVCKE
LQLPP-------SDFHGSADLVALSY------------AATSGEVHSVQ-AVSVMVATKE
G--SIRYWPSLAREDT-----------YSDTCVDL-GG-E------------------KM
-------------------------------------CRFLTAVQGGSFI-LSSVGSQLV
RL-IPESSGK--IHQHVLPQGQ-----GMLSGIGR---RVSSLFGILSPTS---------
--------------DLMLASVLWDRG---GSSFYTLTSSNISKWELDDSSEKQVH-----
-SWD--VHRTLKESITDAVWGSE--------------------SNYEAIKEGVNIQYLDL
KQNCDG------------------------L--LILAAAWHL-GD--SPCLVYYSVITVE
DN-GNQ----M-------SDAV-TV-EVTQYNPP------FQSED--LIAC---------
--------------------RLMVPNFSSQ-------------MTYLYMENAVFVCSTGT
G--------------KFSLPQEKIVFDT-QGDG-ILGAGSCAGVPILFSRN---------
-----------------------------------------SGLVSVTPRE---------
-NVSLLAED--------LEESLT----------------SSVGGRG--------------
---------------------------SESMVFET---------TTKNETVA------HE
DKTKLLKAAF--LQYCRKDLGRAQIMADELFSSHT--DLDSD-------PELDKAVTQIS
VDLIDDYPA--------------------SDPRWAESVPQEAP-----------------
---------------------GLSNTSLIILHQLEDKMKAHCLL--VDFLHQVGL-----
--FRRLSSYPIRGT-------PMSTRL---LLCEHAEKLSAAITLKNHHSRLPD------
----------------L------------------VNSAILLALNKRECE-VP-------
-------NSLTPADVFFREVSQVDTICECLLEHEEQVLREVALV-SQ-------------
-----------------EWAEVAIDVNTVLKDMLQAATHYR----LNKSSMYS-----QE
-EV--LGK---------EPEY-------------VP--WTATS-GPS-GIRTAVMRQHGI
ILKM---------------VYP------QADS----------KLRNV-VMEQLVALIDCF
LDSY----VSQ-LKSL--------------------------------------------
---------------------------------------------------EK--SSDQE
RYSSLE-----VEYLQKRSELLSP----------LLTL----------------------
-----GQYPWAASLAEKYCDFDI-------------------------------------
-LVQMCEQ--------------------------TD-------NQARLQ----RYMTQFA
--DQNFSDFLFRWYLEKGKRGKLLSQ-----PIS----QHGQLANFLQAH----EHLSWL
HEIN-SQELEKAHTTLLGLANME-------------------TRYFAKKK-TLLGLSKLA
ALASDISED-------------------RLQEKIEAMAEQERFLLHQETLPEQLLTE---
----------------------------------------RQLSLSAMPVL---------
----------------------------------------TAPQLISLYI-----CDEN-
---RRAN--------EYDFKKALDLLEYIDE-EED-VSIDDLKLEILCRALQ-RD---DW
SGS-----------------------------------------------DGKDD-----
-------------------PIEVSKDSVFVKILQKLIK-DGIQ-----------------
------------------LSE-YLPEVT--------------------------------
-------DLLRAEQLGSLKSN--------SYFEFVLNANYEYYV----------------
----------------------------------QGQ---M
>gi|47087231|ref|NP_998696.1|	   1136 residues, 50 /line  hypothetical protein LOC406852 [Danio rerio]
---------------------------MF-------SPRGTPGSGRR-------------
---------QAPRTGGRRSVS---------------------------------------
--AVQPGLLFSP--RRS-AVTARSTPTRV--------------QSHAVVESYNF-NVQTF
G-SSL--PVKVM--------------------------EALTMA-----DVDDQISVKV-
EASG-----WAWMVCGERLIVW--KVSQTSV---------------------AKLSVCKD
LQLPS-------SEFAFSADLVSISS------------SGPLDLAP-IQ-SISVLAVSPD
G--LVRFWPSLAHEGS-----------YTEISLDL-SGH--------------------L
-------------------------------------SNYVAAVKGGSFI-VSSYRGHLL
RV-SADSSGK--LHHRPVQQGQ-----GMLSGIGR---RVSSLFGIRGQPA---------
--------------DLSVFSVLWVKA---SSCLYSLSSCGLSKWEVDENSETQVL-----
-SWS--TNQIITDSITDAIWDSE--------------------SNYSEIKKGVNVLYLDM
QPSNSG------------------------L--VVLAAAWYP-GD--TPCVAYFCLVTLA
ES-IVP----S-------PDLL-TV-EVTKYNPP------FQSEE-ELLKT---------
--------------------RLVLPDPSSP-------------AAYLYNEELVFACSTGA
G--------------RGGLAEEKILFSS-PGDR-VRGGGVCADLPVFFSQN---------
-----------------------------------------SGLVAVLARE---------
-TASLLPET--------MEDSLC----------------TSVAGPG--------------
---------------------------PEGTPLET---------PPKIDMVA------QE
DKTKLLKQAF--LQFCRHDLVGAQSMVDELFPS----DGEGS-------ADLDTVVTQID
LDLVDDYPA--------------------CDPRWAESVPDEGA-----------------
---------------------GFTLTSLILLHQLEDKMKAHRCL--MDFLLQTGL-----
--LDRLTSTKVRSC-------PMATRL---LLCEHAEKLSAAIVLKNHHAKHPE------
----------------L------------------VNTAIQTALKKNSTD-TP-------
-------TNLTPADVFFREVSQISSIFECLLDEEEKALKEHP-D-AA-------------
-----------------RWGEVVLSVNDIIKDMLQAAAQYR----ETKASLYR-----AP
-EN--CSP---------EPEY-------------IP--WTASG-GVG-GVRSVISRQHEL
ILRA---------------AYP------HADA----------ELRSV-LCEQLVALLDSL
LSGY----VAQ-LTSL--------------------------------------------
---------------------------------------------------RR--GGQQE
RYDTLE-----NEYTQKRSELLKP----------LLEL----------------------
-----GQHQWVAALAEKYCDFDI-------------------------------------
-LVQLCER--------------------------TD-------NQSRLQ----QYMVKFA
--DQNFADFLFRWYMEKGKRGKLLSQ-----PMA----THQQLASFLQAH----DHLSWL
HDIH-VQDYQRAHRTLYNQANME-------------------TRYFSKKK-TLLALSKLT
ALASDMPEP-------------------VHRRQLNDIVEQERFLLHQETLPKQLLEE---
----------------------------------------KQLNPDSMPLL---------
----------------------------------------SPQNLISLYI-----CDEN-
---RGAN--------EYDFKKALDLLEYFEE-ENG-IDVDALKREIFSKALK-KDWKESW
SSS-----------------------------------------------DDNDD-----
-------------------PLEAARDSTFVKILQKLIQ-ERVS-----------------
------------------LQT-YLPDIK--------------------------------
-------DLLQEDELESLKSK--------PYFEFLLRANYEHYL----------------
----------------------------------KVQ---I
>gi|119184964|ref|XP_001243326.1|	   1305 residues, 50 /line  hypothetical protein CIMG_07222 [Coccidioides immitis RS]
---------------------------MFSTNS---ATQV--PLAYRNSRRRQRTS----
-----DDVSDSPKAKKQKSLLRD---TSFDNYDTEEESEIHLGFN-QSENETARRES---
-----------TPPNNTGLADTSSPAPEKLDNC-----DRLK-MSNILVNNDYYL--ATH
L-PSV--PDRVKEI------------------------------------LREPFRCVIS
PDAG-----YCVALTRRNAILW--PYSAASTSLATNDVR------------------VLS
LLELS-------GKPSDALPLATLISP-----------------STHS-EPGLVIVLPST
G--DVLFWETVSNPTILGLIKQQRSGLQDAIP-GLLSG--------------------EY
-------------------------------------ATEIVNVEPAGFI-VILSTGRVC
HVCVRDSQGKPALNFQFLNASSRLTGGGLLGGI-------RNVL-----SSASWRKNV--
-------------VAAKAGKSYRRGH---RNLLVATNSGLIEVWDTHWSNGSI---FK--
TRIE--VVKAVSHAL----E---SCVIST-------------------DYHPDSYQLVDF
TFREDSS----SVDLEGNEDRYS----------LWVLLSATR------QRSNCYWVVEVD
IH-GSQ----V-------TVGR-IS-SVTPRPTV------TRRD--NLWTP---------
--------------------RIHVPKPGH--------------TGFIIFECGIVLL----
---------------SLVPLRESPSSQLLL--DGGPIPTPFQDYIKFRDEN----DHAIL
GCGVER-------------------SQFDQKSPSCLIMVQNLGLIRISVRARPIS-----
------------------------------------------------------------
RTGVDEGRITVKSRLEQVVFYDI-KGN-PLDLTC--------------------------
------YEEL--CMSPSALEDAALQISSDILRSNS--K----FVP-ATVASLDEQMKLRS
TALCA-------------------------------------------------------
------------------------------------LATYLSKQH--FQLSYPAR-----
--------------------------W---TLLSHAEKVAAHRAVWKAQENICRNSEI--
-------------GGTH------------------LEYILGQMGERFRTK------FPSS
NREE-----DLVRHWFIHDTWRMDYIVPWILHGIRDMSNNGTRL-DR-------------
-----------------QLVWQILQASELSLAALGATFQLR----EEHAKLYG-----LG
-DC--YPGINGLPMPKYSLIS-------------AL--WTADK-VNYVESERLLDAELNV
CLQWLKQKDPGSSDQ------------------------TVSSMIQR-IKKNIPKAFRVL
WKLYMER-VNW-CISQAS------------------------------------------
-------------------------------------------------------VEEQD
AGKELQ-----KCYIVHRKTHLYK----------MAAM----------------------
-----GLLEESIELAENFEDMDA-------------------------------------
-LVELIVEMENRIGDRH--PAGAGD--PAYDGEMEA-------CQL----RIDKYFERFG
---EAWANPFYTRQILAGYP-EMLVL-----MSP----YQEHITRFLHQR-PGYAKLSWM
NDVLGEKDYGSASKSLCNFATSY-------------------ESNLWSKQ-VELAIGKLC
RLATLESSEKQ------DLTS--------LQEDIKRFDDLSELSRIQEMLYGHIAPAIHG
AIDQ---SAEVQLANEQF---GKV--IVHSKPALREALHRNLAKLVAKCPM---------
----------------------------------------EPDELVDTLTLI-DP-----
---APSMKDGDEDIIGHEFSLALKALSLSDLSRQDPEYCNVLEKLLWRRCMI-RD---DW
DII-----------------------------------------------NRT--KQK--
-GDKE--------------VEDVIRSTVLFRTLSDIKD-FENE-----------------
------------------SEL--FCKLHTPVDIANSNILP-----QGLASRLLPEE---Q
ARLLEDF-DEEAKLLRSYIER--------GRLDDWFTWIVGAVRS---------------
--------------------------------NPEE----T
>gi|119638231|gb|ABL84941.1|	   1200 residues, 50 /line  Nup133 [Drosophila melanogaster]
---------------------------MERNLQ---------------------------
-----------KQLYGISRESSPGARRYSMPAA------------------------SAD
STRKSIFGGSASCAQMSGSLKRTALTNSRLSLS-----VRST-QSIAGI-RSDYNSVESF
G-CPL--PVVVN--------------------------EALTFAG----PGAG-TVTAKV
TQNG-----WAWVVQGRRLLIW--QYKDTAKSGSPPRVGK-------LARRGGGLAQCRE
LTLPY-------SDLGHKSDLISVF------------------QTEGQQ-MASCIAVSAT
G--EVRYWSSIAHDG-----------NSVDLSI-LTGQ--------------------EF
-------------------------------------VQLLSLPTQQGYL-AVTTTCNLV
FLRVGLTNGRYTLHHKTIKPAT-----SFLGGFGK---KFASILIGM--NTGADKDQTL-
-------------VGMCCESNLESGE----TIVAVLSDRAIQRWSLSNNGNTENL-LYED
AEMLRRIREEFITNF----WKFR----------------------LPADSLEIDLHLLDF
HVVKNK------------------------A--YILAGAVNA-AH---APQMCYALVTGT
AQ-AERMLL---------ESFT-PL-NMNKFFSA------KTEE--DCLSV---------
--------------------RFVVGSS----------------HIYLYTSKVVYPLHLTN
SVP------------TAELEAEKIEFHQ-HDDR-ILSAVICSQLPLFFSRT---------
------------------------------HGLVSITPGDFD----------------GT
EMMNMSSCN--------TPDLYA----------------PNSCNASFAVADHSALTNST-
---------------------------NNLHLFEL---------DPDEMYNE------LS
DEVGQLKAAF--LYHMKRNSNMVKTIVDELLRNVT--AADPSGAP-MDAYKLDRIVITIA
EDLAEDIPI--------------------ADPRWEEALADQEM-----------------
-----------------NRHAIGSSRSMQIINQLRDKIIAFQHF--ITFLHSSLV-----
--WDKLNVIPCGSH------SLKPTGC---ILADISEKIVAAMALRSIQTK---------
--------------LPK------------------LIEEAIDATVALWHE----------
----EPQGSLTYQDIFYVKLSRFQNVFEALADIADDRIAAQNQT-TI-------------
-----------------SVAHFVNEINSIVLDVLGQVFKYR----KQHASSFR-----LN
-HE--KLP---------SYEN-------------LP--WTAMA-GSA-GVRDTLTRLIDI
SVRY--------------GSHC------VSET----------ELKQQ-LYQQIFELIDLV
---LDGR-KTY-LKSV--------------------------------------------
--------------------------------------------------------RDTE
KFNVLQ-----QQFEAQRRELISV----------LIKD----------------------
-----RQYEYAAKIAEKYLDFQS-------------------------------------
-LVLICDE--------------------------TQ-------DKERLE----DYTRKYE
--EYDFSQFAINWHLRQNRHGEVFER-----FKG----NQTALAQFMRDH-P---SLGWI
QLIF-NGDFERAAKVLYELAQCET-------------------EFVARKK-SMLSLAKLA
AFAAAES---------------------DLTAQVEKINADLTLVEYQSQLGHDVLES---
----------------------------------------FGFDPAEQKVL---------
----------------------------------------KAEEIISLYI-----AEEN-
---ETAS--------ETEFRKALELLSYVEQ-------PYDMRHKIWCAAIK-RD---NW
TDY-----------------------------------------------DPN-N-----
-------------------AVHYMQKLLFYKIIEISQL-MGND-----------------
------------------SEN-VLPPME--------------------------------
-------DFLESVELGDLPQQ--------KPFQYLLKLTYEYV-----------------
----------------------ADMFKQPDDME-------L
>gi|123456555|ref|XP_001316012.1|	   1098 residues, 50 /line  conserved hypothetical protein [Trichomonas vaginalis G3]
------------------------------------MTLYSRDTVSIDEDHRFVTSQISN
CIAS---------------------------DQYIPEFFESSIAV-ELHYNK--------
----------------------------------------------IEKENSIAT--ISD
V-KKY--PTRVY--------------------------NAATAAKY-------RVFMSSF
PKLS-----TLYCVVDNTLYMW--PFNNGE----------------------NPEVITAD
GNIIT--TVTY---------------------------GIPEPKIFNK-NPTYVILIATD
R--------TIKIVPAKPFQIYKDEASQMKIS-TIFVS--------------------SY
-------------------------------------IS-----SKGEIF-LCSDTGEVY
LVKYKDTKSTQEAPGLKLKPLISP---------------LWFIPMANLLKNPRRTTSMA-
-----------------------VDD--THNYFAFLVGKTIRFYKYQ-------------
---------------------------------------NEHLYYLSKEKIDYSGNITNI
EAIPISDSL-------------------------------------------LSHFVAFS
TN-GDR-FFFG----TFPGLYR-NPDEI------HLRRTLPAPE--VFQGH---------
--------------------TLISGSFSHGMSS-------------FLFKDMFAIL----
---------------HPNSNP------------HHMQSHLVEDLVTIPLSPDCLS-----
---FFRSEHIYKGQNTSMFHNEYLWQHIVQPTPGFLQCADGYRIVNF-------------
--------K--------LPVDNL------------------NDLLQEYKGN---------
----------FTDPIREWMFSNAAGG----------------------------------
----------------------EACAASIILAGRS--PE--L-QR-WALHTMHQFTKLNN
QRYERFLGNLSHVTM-----GFIVRIERLLTPIWRSTLFTKFV-----------------
-----KKSDN-SKMKWIINPI---------------------------------------
----------------------------------------------------FNELPSNT
IENFRDIFKLGDDYM--------------------------------------RLRRSSI
EAND--PDMQKEVDEETTNIYRIYTYVSSIIETLKFMQIIKTLK-TSVIDGTIQIVSEAA
RMRLTILDFGDEN-----KYSIFDALREFAASLFSCKDGPSRGDRFSMKLARECPFFF--
------------------------SEAASLIKQAI-------------------------
------EDLKSARYKQTV------------------------------------------
-------------------ISQP-------------------------------------
---------------------------IIERCIDTFVKYADQIPQQNLQEITD--IFTSL
QDYKAI-----VDISLARAELIDPTHLALTWYKSDRSS----------------------
-----TQSRETAAFDKRYECYVP-------------------------------------
-LLKLSDV--------------------------PD--------------AFEKMLES--
-NDETFHVVLYSYILQEKDEDSKEKL-----LSV----STPYLVSFLEE---KYPDLLYL
YNAR-HHDYATAAARLMELAKSKS-------------------NDIDIEK-RIQYLRKVT
TYARASRMSTV----------------------YTEAIDLLHPAEIQRDLFQ--------
-------------------------------------------GKASNELL---------
----------------------------------------SNQQLFDSCL----------
--------------AENRFDLILRLLPFLTI-AGNA-NKMSVVSLMWSRFFE-QN---QG
LSL-----------------------------------------------LEL--KRKV-
-----LAIARSSESG----TKEILEPSILIPLLEDTKL-IHGG-----------------
------------------EM--------------------------LWAVKVLDEM---K
SPLSNAL-AFYNSAL----ANTEITQSQRTGFLAAIKYLLQKGATLRG------------
------------------------RDKNFQDRDLLN----L
>gi|123488164|ref|XP_001325104.1|	   1144 residues, 50 /line  conserved hypothetical protein [Trichomonas vaginalis G3]
------------------------------------------------------------
---------------MLRRDPSSSSEQDFA----------------------------SI
ITKLKDHYKAEDQQKQSSINAS-SLEFLDRRNY-----QSCQ-VSDLVSAAEFDQYYYHP
----------------------------------ANVLNAASICQ-------IRLYFGTF
PEIN-----LCYCVVDDKLFYW--KKGDTVAK----------------------------
-----------------------------------------MFRAKGRY-ISSVIINSPD
E--EVFYSKNVKCVLAISTDTTICVIPIKINSSLFNNEKNTIEDFLDLQSIISTDSHTFV
-------------------------------------CSALCPTGSGYIF-AGSDTGAVF
LLKYKVN--KANVNNRKIKAYILPNNPLKMKAFNY---FLHYLPTQFFERNC--------
-----------------IVQLCFEKT--RGYLAALDRTYRLRFFTV--------------
-----------------------------THDFVVNEI-----EGLIGEQFQPIVKLVDV
PASESG----------------------------------------------NIVFIGIT
KS-GDR-LSFA----QGINIID-NSFYIMLVSKR---QMVESQG--QSKMN---------
--------------------ECLDGVSTLNSTVVINKGKLCLVSSLSSIQDITQRPEELF
NISTAPETCLSV---SSASHILESLEINAFKDA---------------------------
-----------------------------------------FGWQHIEKAPKIELV--TT
KRVITIKFN--------RPVDIL------------------SNYIRESNGNYTPKIFN--
--------------------------WMKANKQEA---------GATALLLA------SE
DSSQKLQALF----------------------------------------VLSQFAKNEI
KMRDDFNQSLHVSSQ-----AFLLRVARILEPAWFSPLFEIKI-----------------
-----KKADGQTTTKYKISSLFDDYTTEFIVKQLTNVNELIT------------------
------------------------------------EYNRILVTL---------------
-----------------------------------------------------KNDIKKD
DKND-----NQNENAFLYELSSYVHILIEVFTFIEIVGKQNKTF-IT---NAINLLDESF
KNRLISKELGEESTDGSPQVSIVDALRELCLQMFASGGKAK----LGHELRRRCPTFF--
------------------------TLEDSQLLTALA--ELNRCLPNSPTLERIVETILKL
VNRAVN--------------------------------LDYVCQKLI-ELKHFKGVVDIC
LARA--------------------------------------------------------
------------------------------------------------------------
----AA-----IDPSQKALLWFKG----------QRLK----------------------
-----TDEAGTYAFDKRYQCYEH-------------------------------------
-IFQLI-------------------------------------NEQKAFD----IMITT-
-NDELFHLCLYQRIFQLHKQEQLLSRN------------TPFIEEYLQEFAP---TYMWS
YKAN-HREYSQAANELYKMAMSDKI-------------------EATLQK-RIDYLQDVA
KYAIADNM----------------------SSMLNEVQVRQQLALIQKSLSERT------
-------------------------------------------------GK---------
----------------------------------------TMDKLLDNQTLL-----NE-
---CT---------SSGQWDLVLKLIAA--CPVQTN-QREQLISQVWTNMLV-EQ---LW
NTS-----------------------------------------------LHQ-ASTII-
-----VETMNGRSNAGNDVLIPKIVVPVLEEYKMNRRG-ECLW-----------------
------------------AED----TIIKCGAKPNDVFQAYYSIL----ERSNLTNQVRA
DYTYAAIKLANLGAKVTEKQV--------LNLRKWISEVGKGLP----------------
---------------------FFNDALNLLASIPNI----I
>gi|134117536|ref|XP_772539.1|	   1262 residues, 50 /line  hypothetical protein CNBL0190 [Cryptococcus neoformans var. neoformans B-3501A]
---------------------------MFNSPS---TRR---------------------
-------------VQTPRRQQAQHPSSRLQALR---------------------------
--------------VTKSPAPSNAETIRTERPV-----DE-K-EKVFWSKDERHS--TTS
L-GKF--PGEVAAL------------------------------IKASDLVVDPVTGQVD
SRTG-----FALVSSPRACIAW--NYSKRTHS--------------------APTTYAFP
APLPT-------SSPS-RFPSPVLSALC----------------TSTS-EPGM-ILMSST
G--EIRYWESMSLALS-NVERYQQL------FLDLPQG--------------------DW
-------------------------------------IERLVKVDGNNFI-LTTTSSQAY
RLSITSSAGRLSPVVTPLMRPG-----GMFG-------RASPVIFG-------GKHDR--
-------------FGIRS--VASNGA---EV--YLMAQRSIQKWSFTSDGQK----LVQ-
-EYD--IYEAIGREL----F---KNWSSI----------------------DISIDLEDV
VALDSDSL--------------------------AVLITYSD-S---TSPPSH-ALVLLS
VH-RSN-----------PPIVN-RT-ISISFTSG------QDQR--LLDIP---------
--------------------RLVIPPGST--------------MAFVRFGSAVMMV----
---------------SLDF------------------DAPYEEALTLKDP-----NNAYI
GAGPVT---------------------SNSNSPTMVLIPAEGGLMNVEALEPRAS-----
---------------------------------------------------------PDS
LNQLSTATARLKSKLEQAIFFGQRSDN-PLSFEL--------------------------
------EEDV--R-GQGDVAEATELVSGEVVAARS--P----YTP-TI-YELRPHLLDRL
DRLKA-------------------------------------------------------
------------------------------------LVKYIRTNGLMNQLPQATR-----
--------------------------R---RLSGDGEKVRGALELWDYQNRLMDQSSGPG
PS----------QAKSL------------------LSISIQVYFSSRHRF-LAPSSSPTD
EREQ-----DLVRLFFRTEVSNLDKLLTVVFGEFRD-KQKGEVD-VS---E---------
-----------RAGWVGEVNQIFILTSYCEKAVERAAAQYR----EEESDLYA-----ID
-R--------------EKPAI-------------EM--WTASD-SLIDSLDHLYTLTEAL
IKERT-RELGSVIDEAHVAGGPT--------------------SRIE-AGREELRKEQVV
QATLKRQ-MGW-LAAALCTNMED-------------------------------------
---------------------------KCRVVVRPHVREKA--NRGYRRQMDD--GADEQ
EGIMLK-----AKWDAMKPRVIRP----------LVSV----------------------
-----DRISEAYELAEHHHDFPT-------------------------------------
-LVMLCNDPVA---------------------GQGK-------GDS----RIQVYIEKFG
---EDFAFELYRWYIDQGQLHALLTQ-----DEV----YGSLVTRFFETH--HYPELGWI
HHIA-CKRYGEAAGALTQVLDEGEGK--------------EESGELDFRK-VVGSIAKLA
SMTDISL----R-----GPSE-------ARDQIFQKIGQQLSLIDIQSSLRTYLLSLFPS
TARS---SRSIAKHFAPILTRLSHRPGSESGSAFLALFYNLAERVIGGEAV---------
----------------------------------------DLEGMLDLLTLK-DN-----
----VGR--------EDDGVDALRVLVLDRS-LPKA-RSEVALLAVWRRIYI-RD---DW
AEI-----------------------------------------------SNT--V---G
RSEQA--------------QRTKLKTTMIYRVLKALHS-MPEF-----------------
------------------PQAAVISPYD---TSIPPTTAELSARF----PSLSSED---I
AALKADY-DDEVAVLMEYVEK--------DALEERVKEVKGMIERE----WEEEQGREID
-------EAIGAQAESEVVVVEAEDVEADEDV----E---M
>gi|146412690|ref|XP_001482316.1|	   1122 residues, 50 /line  hypothetical protein PGUG_05336 [Pichia guilliermondii ATCC 6260]
------------------------------------------------------------
---------MVQSIFQVRSRPSSAVSTPK-------------------------------
------------------------KLRNDPPST-----LASH-KLTELTKNRQYC--VSK
L-PAL--PSHLNIT------------------------------------EGEQCNGYCD
HLSG-----YFVVAQKSSINVW--NYKSSDS---------------------APLTYQFP
VED-----------AGEFPPLASLTRPA---------------SATSQ-DPGIVIINCTT
G--NVKFYESVQHAPALGLIHSKS--LELVLPLQSTKG--------------------EY
-------------------------------------VTMAQNVEPAGVI-IATSWKRCI
LISLRDQKSKPQLTILELLPPY---NTGLIS-------RLNIFKGLA----KADMDEI--
-------------VSIRSGFVGDDDL--TQDIIIQDSIGGFYLFTYQVMSPNGVSLIISR
NSFKQNILRGIESSI----D---GYLPGS----------------------TPNLRIMDL
WPLK-----DIYICLCLIDDKTI------------------------TGDEKNLVLVSAK
ID-NT----GV-------LVYR-SH-RLTRCTYT------FSIE--SPQRP---------
--------------------RLFIPSPGK--------------TAFVSLGNSIIMT----
---------------DIDVPYSQQGQ-------VQYYKPRWEDIFRLKP------SIQVV
GYGYEN--------------------QSANANPSLIVLTANSGVLRLERFSDSDD-----
----------------------------------------------------------IT
MEDADGTTNTLKSHIEQAVYYSESAT---IDFDI--------------------------
----------VDEFPSDVIVGSVSEVSGEILNSTS--P----YLP-SFLPSIKDFLSLKV
TKYRN-------------------------------------------------------
------------------------------------LILFVHRNF--PQLKSTLV-----
--------------------------P---PLVENLEKVEVSMFLWDFLSQSHN------
-----------------------------------DETKIWLEDTIK---------STTE
NNTE-----DPVRSFFTTGNNNINQVLTDLLEKMIR------------------------
---------------------NNISLTRITNLITSTMYKGV----FLNEEKYI-------
------------TVDDTIEPK-------------RL--WIYDT-NLLLRLEEIYTKA---
------------------YCEGSKSE----------------HHSKE-YLEEMAQFCEVL
YYFVTTA-IGI-MQR---------------------------------------------
----------------------------------------------------D--GGNHE
QLVEYI-----RWYKQRKMAWIDS----------LLDS----------------------
-----NQVEEAFLLAQTYKDFLS-------------------------------------
-LARVLDFSKE-----RILNEHGTDSD-EYAA--------------IL-EKYNYYFLIFG
---EEFAFKLFDYYVKTDKVQALFSDF------A----DHPLLAQYFVINKERAADFSWI
KYLS-DLDFESGSEALLQSVERKV------------------NENQASRQ-IKFLLAKLA
AIASNKNSTVA------------------SSEALRAAENGLVVTRIQNRLYQDLVKAVSN
NMNV---LTFQFLSKNF-------VNSEVDTTEAQAILEESFERLLKNQPL---------
----------------------------------------AVADSVNYLTLI-----KP-
---SVSS--------QHNYHDALRVAQVSG----GE-NLSYLEHTIWLRVLTLTD---DW
SVL-----------------------------------------------SQI--KDK--
-SDEF--------------VKQRIKDTVLYKTVRQAQS-TS-------------------
-------------------------------SLTSLLHHVLNVRDTDAA-----------
----AALDNRLLGKLEDSIAK--------HNLTTWVESIIQEAKQ---------------
----------------------------------------L
>gi|149247390|ref|XP_001528107.1|	   1101 residues, 50 /line  hypothetical protein LELG_00627 [Lodderomyces elongisporus NRRL YB-4239]
------------------------------------------------------------
----------MTSIFKPRRNVELPQDVGTTP-----------------------------
--------------------TTTSSNVSPAVSA-----NTSA-SAVVATKNKFYC--VSK
L-PGI--PSSFEQ-------------------------------------SHSFINAYSD
SESN-----YSLVISNDSIYVW--PYRSADT---------------------TPFSIHFP
LDK-----------SRFQLPMAILTRPS---------------SGTGQ-DPGLVILDSVS
G--LVKFYESVQHAPTLGLINDKS--LELTV--NLYRG--------------------EY
-------------------------------------ITMAENVEPAGIV-VATSLQRCI
VISLRDFKSKPHLSTLEILNP----SSGILAKFFK-----------------HTESEI--
-------------VAIRSGEIKDHGT--VQQILILDSEGTFYSVCYNLLSANAAPYVDKK
N----SFKQNLYTDV----T-----LTGP----------------------STSAKYLDV
WPLKES---NYYLVLCRIDGK--------------------------------LLLATFG
AD-HS----GV-------LFYG-SH-HLKSAEEAEKSEALKNGK--NVSIP---------
--------------------KLFLPKPGK--------------TAFVISGTSIIMT----
---------------DINNMYVESRQS------FSYHRPRWEDIVQLQP------TTAII
GYGYED--------------------QSNITNPAIILITKEFGVLRCERFAKETT-----
------------------------------------------------------------
AEEISDPVVLVKSHIEQAVFYSESSE---IDFSL--------------------------
------SHYQ--TFDEETIKLAVNKIVDEVINSTS--P----YLP-ATLPSTTDLLELKV
KLLKV-------------------------------------------------------
------------------------------------LTLYCDKNF--PTLNLIP------
------------------------------HIEAKLEKASSLLNLSKYLNANP-------
-----------------------------------SYKEEFEKA-------------TKD
NRND-----GNTQLTLTQNIDDAGFIFAKFFKVLFKDNYSLA------------------
----------------------AVIVATLYNGVYSAHQSNE----GNNA---------IT
-SV--ST---------------------------SS--WLYEKSSLLQDTEQYFIH----
---------------------EFADGK------------------SQ-ERQNACYIVQML
YHFTTSR-VIY-LKD---------------------------------------------
-------------------------------------------------------TGDLE
KTETVQ-----NWFNLRKPHWMSV----------LLKL----------------------
-----DLNEEATQIAEQYHDFEA-------------------------------------
-LARILDS--------------------------AREFKLALVEQLP----YARYFNQYG
---YPFAASVYLHYIKEDKIQDLLLQ-----FTN----YKSFLYRFFDENPKQTASISWV
RYLL-DNEYARASNALDTAIDSPN------------------DQTIDNQL-TQLSVLKLL
TVSAIAAGSA-----------------ETVNSNLSTINKE--ILKLQTQVFLRDAIANNG
SIEA---ISETYFMNHYV---SA---SVDKEAARLAVGGTNFELFVKNKPL---------
----------------------------------------AIPTIIDLLTII-----LP-
---QLLN--------NLGYLYALKITKT---VNDEK-LNEYLVLVTLLRLLTIAV---DS
KKI-----------------------------------------------THQ-K-GKN-
-LEEA--------------FKRQVQESILYKTLESH-----PD-----------------
------------------TIP-YLDKLLNNLLLAKE---------------YNDQYSS--
----KTLNDELLEELKRLLKN--------KGFKQWVEVTKEQAKI---------------
-------------------------------TIMEFA---H
>gi|149388398|gb|EAZ63454.2|	   1150 residues, 50 /line  Nuclear pore complex protein involved in poly(A)+ RNA transport, nuclear pore distribution, and possibly in the biogenesis of functional tRNA [Pichia stipitis CBS 6054]
------------------------------------------------------------
-------MSLNGGIFRARKRPNTAVSVSE-------------------------------
---------------------VSTTTISTSSGF-----PSTK-SARELTKNTKYC--VSK
L-PAV--PSVLEPT---------------------------------SSSSSEVFNAYSD
HESN-----YSLVVNEKTINVW--SYKSTDP---------------------APLAIQFP
VESL--------ENELSLLPLAILTKPS---------------SGTSQ-DPGLAILYSST
G--RIKFYESVQHAPALGLINDKS--LELTIPINSKKG--------------------EY
-------------------------------------ITLAENVEPAGII-VATSWKRCV
LISLRDFKSKPHLSSVELLGPNSSPRL-FLSSV-------LFGN-----SSGASEDEI--
-------------VSIKSGKITNHGM--TQEIVIQDSAGNFDYFTYQMLSANGSPYIDKK
KSFRYNLVSAVENSV----D---GFLPGA----------------------SLNCKFLDL
WPLLSQE--NIYLCLCDVD------------------EFNS------NSGSKNLMLLTIK
ID-AT----GV-------LLYG-TH-KLMRYEPQ------QIAS--STNKP---------
--------------------KLFLPSPGN--------------TAFVTIDNSIILT----
---------------DIDTSYIQSPTT------FSYYKPRWEDVIRLKS------SVETI
GFGYEN------KSADN----------SNKSNPALIIITKNFGVLRIERFSEEDD-----
---------------------------------------------------------KSE
SKDPTDPLSIVKSHIEQAIFYAKSPE---IEFDI--------------------------
----------YREVPQSVVLLAIESVVTEIINSTS--P----YLP-AFLPSISEMLLQKS
KLYQE-------------------------------------------------------
------------------------------------LITFSNRNF--TGISSKII-----
--------------------------P---KIVEFLEKVEAALNLWLYIDEQQ-------
---------------DP------------------ELRKVLEAVVLESN-------TISL
SEND-----EVLRTFFSKGVQNINPVFTNLTERLVDNGNSTS------------------
-----------------NIVDLIVKV--LYNGVYQIEAKYL----LNHSE----------
-----------------YPVI-------------KS--WIYDT-DLVVRIEDIFTS----
--------------------EYCKDV----------------ILTQQ-RQANLIKFVEVL
YYFVTIA-IRY-MQR---------------------------------------------
------------------------------------------------YD------QHSE
SLSDYS-----KWYKSRRHAWINV----------LLKN----------------------
-----ALVDDALSVAESYRDFSS-------------------------------------
-VAFILDTEKE-------------------------KGD----NEEDINSKYGYYFDTYG
---YEFASSLYDYYLKNDKIQPLLLG-----FTN----YKNYLDQYLEKGTIKTSSVAWI
RYLL-DSEFSKASDSLTRAATHKV------------------DENIENRE-FKYSLAKLA
TIAASNGSGNS----------------RATQEKLQLAENNLIAIRSQRALFKALVGEEQF
KV------LTYDFAKRFY------TNASVENETKDRILEGSFTQLVENRPI---------
----------------------------------------SNSDLINWLTLL-----KP-
---SALD--------NNNFTLALKVASV---EVNES-RYQYLIKLIWLRLLVIGD---DW
SSL-----------------------------------------------HKD-LISS--
-SDSQ--------------SKQKIRKTVLFHTLVEIGL-DAK------------------
----------------------LVEQM-HTLLRKGQIDDEIEDDINV-------------
----REHTSLLLAKLTDYREE--------YNFQSWVESVQQEVK----------------
---------------------------NSSNHQ-------Y
>gi|83423282|emb|CAI64810.1|	   1309 residues, 50 /line  nucleoporin [Lotus japonicus]
---------------------------MFSCGT---KKNN--GASRDQARASSVL---DS
PVTPPL--------------------------------------------------RSSA
VPNRPPTGTPAPWTPRLSVLARVPQVNR------------TG-KEDNTDPIKPV-----F
V-AEF--PQVVR--------------------------DEQAALLHKRVPVEGCASGGID
KSTS-----LAWIISGNRVFIW--SYLSPAS---------------------SMKCVVLE
IPFND-------GDVGKHEAGSWLLCVVNYDGASSGA---NKVAKHCN-SAAVVLCNRKT
R--AVVYWPDIYSQSRNAPVTNLVSSDEFVTSLVSDGKTFSNWLRRPSSLNELHMFNSMI
-------------------------------------ASAVPGCDFVCVAFACSSSGKLW
QFKCSPSGIHRTEVCES---------SMHLPPEGG---DS--------------------
GQLEGNKGYPRSLTWCFPHHSTKESN----RQFLVLTDHEIKCFGVEFSSDIHVSMLWSQ
VIVGTDPELGIKKDL----------------------------------AGQKGIWPLDV
QVDDYG----------------------KVI--TILFATFCK-DRISSSSYMQYSLLTMQ
YK-SGLDVGT-----TNDKILE-KKAPIEVIIPK---ARVEAED--FLFSM---------
--------------------RLRIGGKPSGSTVIISGDGTATVSHYYRNATRLYQFDLPY
DAGKVLDASILP---SADDH----------------------------------------
------------------------------AEGAWVVLTEKAGMWAIPEKAVILGGVEPP
ERSLSRKGS--------SNERSA----------------QEEIRNLTFAGNFAPRRASSE
AWGTGDRQRAVLSGIARRTAQDEES-----------------------------------
--EALLNQLFNEFLSSGQVDRSLEKLETSGSFERD--G-------------EINVFVRMS
KSIIDTLA-----------------------KHWTTTRGAEIL-----------------
---------------------AM----AYVSTQLLEKQQKHQKF--LHFLALSKC-----
--HEELCSRQR-------HALQ--------LILEHGEKLSAMIQLRELQNLISQNRSTGV
GSSNSSLDIQLAGALWD------------------MIQLVGDRARRNT------------
----VLLMDRDNAEVFYSKVSDLENFFYCLDAELEYVIRPEHPS-G--------------
-----------------IQIQRTCELSNACVTIIRTCFDYK----NENQLWYP-----PP
-EG--L----------------------------TP--WYCQP-AVRKGIWSVASVLLQL
LNETS-----------------------GLDK----------TAKLN-LYNHLEAVAEVL
LEAYSG------------------------------------------------------
------------------------------------------------AVTAK--IEREE
EHKGLL-----DEYWKRRDALLET----------LHQQIKEF-EATHKDSIEGAE--EQN
DEAIMKLTSRLLSIAKQHGCYKV-------------------------------------
-MWTVCCD--------------------------VN-------DSELLRN----IMRESL
GPDGGFSYYVFEKLHENRQFSELLKL-----GEE----FPEELSIFLKEH-P---NLLWL
HDLF-LHQFSSASETLHALALTQNIQSTTAAEEEQAYMKSKL--KLSDRK-NLLYLSKIA
AFAAGRDA--------------------GTQVKVDRIEADLKILKLQEEVMKRLPSV---
----------------------------------------EDKQLIEDQLL---------
----------------------------------------HPEDLIKLCL-----EGED-
---GELS--------LWTF----DVFAWTSS-SFRK-THRKLLEDCWKKASS-QD---DW
SKF-----------------------------------------------HDS--CMVEG
WSDEE--------------TLQNLKNTVLFQASSRCYG-PRSE-----------------
-------------------------------SFEEGFDQVLPLRQ----ENME-------
-----------TSMLGDMSSSVETILM--QHKDFPVAGKL--------------------
-------------MLMAVMLGSDHDGDIGVEEGPSPM---E
>gi|19112173|ref|NP_595381.1|	   1142 residues, 50 /line  nucleoporin [Schizosaccharomyces pombe 972h-]
---------------------------MFIVHR---RFFQNEKAFTPAGKHEKVADGNKH
ETL---------------------------------------------------------
--------------------------------------ATSE-YPKVCASNDLYK--ILQ
I-SAP--KVG------------------------------------NFTIHDAPVVGLID
SILE-----YYLYISVKVRKAWIAGYGSQPQNLI-----C-------F----DWERFTGI
LDQ----------QSLNSPPLAGFVKP----------------DPTSA-EPGFLLLWPAS
G--DLFYWERTSLMNVEVSAPEFPGFLHYRI--QLKRY--------------------ES
-------------------------------------CKNLVSAEPAGFF-LTLSSGRLL
HLNLKDSDGNSSIQVRILFPGLH-----IPNCLLS---LYNSIF-------AFTSGRV--
-------------IPIRCGSIKGPGE---RLVYSMHSGSTLRIWEIFGTGDHH---LL--
RGFD--IYDIILDSI----Q---ESFSYV-----------------------NRFLILDF
SVSTSD----PYTL--------------------ACLVSWRD-----NASLFNYAAIIIS
FN-HQ----MI-------PHVS-QFCHVRSYLSA---------I--LPSVC---------
--------------------RIFLPSPGT--------------VVFCVFDVTFAMF----
---------------HKVRGKEGT-----------FYVEENLVVNNLTS------KSRVL
DFGMEDAIYEKST-------------HTLLKTPALILLTEGHGIIRIESSASYLK-----
------------------------------------------------------T-----
---SFSATTYLRSRLSQFASQSPLFRE-QFLLNF--------------------------
------DFTY--NLSESEVYNTVFNLCDELYTTPC--K----KNM-SVLETLHSQQRDLM
EIVLV-------------------------------------------------------
------------------------------------AFKYL-------HLSPSNR-----
-----------------------------LQLWLKVAYCSALADLYELLMCNE-------
-----------------------------------KMSNLLRRVLK-------------I
MSSN-----DNIDELFLKKCLNINLLLQHLSSEYSQISGQDASN-AQ-------------
-----------------KRIEVIVNVNNVYGTIFGNELAYR----QEKISKFT-----DP
-SS--VIR-S------------------------DL--WTVEV-DHLDLLRKQIED-SIS
LHRD---------------VRD------SKDAH-------ILKVSNK-LRKQILHLVEQN
CLLIFDLHN---------------------------------------------------
------------------------------------------------GTDDT--IVKSH
NFQKFE-----EEFGNSRKEWLQY----------LASV----------------------
-----GYLEKAIDLAEKVKDFQT-------------------------------------
-MVILLDC--------------------------LDPKD----PTIKL-QKQKACLNKYK
---EEFADVIFFYLVDTEQYASLLHD-----FLE----YQSLLISFFEAN--DLLNLLWI
FEAQ-NGNYGRASEILFRDCEPEE-------------------NRIIGKI-SQLALAKLY
SWTNRIEGEN-----------------IILSNETEVIENHLAILLIQEQYAEMLSSLVDI
TEDE---GEAVEAIVTS------NCVNLSENSIRAWLVSSAVERLIQNEYT---------
----------------------------------------TLCEMVDFFSSF-----SL-
---RECS--------FKEVDLALELLER--ATITKD-VYFYLKDLVYRRFLL-QV---NW
AEI-----------------------------------------------IDA--HED--
-LESS--------------FFPMVKEIMLESDFLIWLQ-HMEH-----------------
------------------NIHDESKHY-LKS---------EKNFLQSVYSSLS---ESQV
EDYQMEL-FREKQIFSVLCKD--------RELYILIPKLLD-------------------
--------------------------------VATK----Q
>gi|19114827|ref|NP_593915.1|	   1162 residues, 50 /line  hypothetical protein SPAC1805.04 [Schizosaccharomyces pombe 972h-]
------------------------------------------------------------
----------MSSILGKRKNEEVVSFSPLKR-----------------------------
-----------------------ISVEKSLLDS-----TAYN-NSLDWLRSKNFK--VSC
L-LKH--FNS-------------------------------------KIINDHPLSGSCY
TDIG-----YALINSRKACFIL--SYRQSLGTA-------------------EPPTITFP
L--PE-------EDSNGFSGQNALTA-------------FVPSDASDK-EPGLLIVMPIS
G--RIAYWTSIGNALAQSYICPQ--GMESLI--KLLPK--------------------EK
-------------------------------------CEHLCCSNPMKFI-ISTNFGRLF
SVQLRDPAGQPDVSVQLFASDIS-----TFSTILQ---KMK-IF-------NYPSIHI--
-------------IALKSPPLFSPYQ---HLLYVAEASGLLEIYDLKLENK-----LV--
SGMN--LSPIFKQVL----R---EGCPDA-----------------------SGLEVLDL
TICPTNGN----------------------L--VSFLVCWKN------SINYRYMIISLD
FS-DI---SSP-------SVMN-IH-PLYSFSSK------------SLESS---------
--------------------KLHYSSSGN--------------SLFVVLTDAVIIV----
---------------HVQEDDK-----------DIVSRTSWEEVIRMNT------NVSGG
IFMSTC-------------YKYVL-GKYSIPTESCFIATPYSGIAEIEVHSLEH------
------------------------------------------------------------
---PANNESLVKSKLEEAVFYSFLPGN-PIDFSC--------------------------
------NYLR--SIKKPELERIIVDLGMDILNSRS--T----HLP-PLFASLMQHLSCRL
NSLNN-------------------------------------------------------
------------------------------------LVRYIRSMS--LDVDRQVL-----
--------------------------Y---KLRVMGEKCNSVRYLWNTIDTEFS------
-----------TVSHSL------------------IFQRIIYR-------------LTQS
ASSD-----NALREWFLHNIESIDQLIAQAHEFCIDSGSRVQEL-PL-------------
-----------------EVLDVIMEANEVILAIQSSALAYR----RESQKIYK-----LS
-ID--T-----------FGEE-------------VP--WTSTP-ETLVLLCRQFELTRSA
LVQSHQG---------------TSDVENTFKI---KDKGVLRNVVSN-LEVQLVALTEVC
FDAYSER-IRW-IEQ---------------------------------------------
------------------------------------------------RC-----GKDAS
EIQDVK-----EAFAVNRRFWVQT----------LSDI----------------------
-----GKGSSAIRIAEKYSDYRS-------------------------------------
-LVELCYQ--------------------------LY-------EDNELTDALNNYLDLFG
---IKFAFILYDYFVENGMALELLNS-----DRF----NKSYLKQFFKSR--DYNQISWM
HDMR-LGDYDAASHRLLQLATKQE-------------------KLVDKKE-SELSLSKLF
LYAVPSNSGN--------------------IRDLVLVEQKLEQLHIQKMVSKSVMPVVER
LRSQ---GKKYQLVEAVV---DDLIGAKVAPVIARQVMQRVVKKFIAGQVV---------
----------------------------------------EATELLEYLSFSLYRREDL-
---VEGE--------VTDYYLALRLLLT--TRLTDD-AKRFYENTIWRRAVL-HD---NW
IQV-----------------------------------------------LDT--QGK--
-NDAI--------------IETQFRMSALYRTLEAVTI-NGLF-----------------
------------------HEG----LI-RPGSLSSCKFEGYDP--QNLISIYPPARFGDV
TEVTKVL-NRESVKLDHYLTK--------TNLNTCYISMCLSCDT---------------
----------------------------------------I
>gi|39589667|emb|CAE66902.1|	   1144 residues, 50 /line  Hypothetical protein CBG12284 [Caenorhabditis briggsae]
---------------------------MLDPTY---QHFKISPDKELELTLDGV-PIEYP
ALVK--------------------------------------------------------
------------------------------------------------------------
--------------------------------------EAFLNNWHASAHRTDVPSNCAS
LNER-----HCWVMSRNQMFIW--ERAKSS----------------------NRATIPQV
LPLPT-------SGLPRSSKCVVVYD------------GSRISSSTKLPIPGVVIVS-PE
G--VLRHWTSIESSNYIEKVLDINSEV-------ALKL--------------------EL
-------------------------------------TDEPADGKSASFL-LTTTSGTIY
FINGEGENSGKTGTLECHKVIG-----REPQGFRR---RLSSIIFSS--GNGLSKENP--
-------------SLVTNSFSFE-SK--NALLVVEVSPDLLSVFNMLEPSEVW---TLK-
-----------------------------TKEFFQQRVTYFFEQDLKRVPNLVRSHLIDV
SVFRGG------------------------L--MCLVGGTHE-D---TPLVSLFIVWLPP
DW-QTKQPTEF-------VWSA-KI-PINEHRAL---FAKQ--D--PQVYS---------
--------------------NSTLCIPKDTAESKSAERTDGIIIVNPFFAISLYLPFDLY
KPKKALSLYR---------------------------------YISLPA------RDQLI
GCSIGK--------------------------TYTYIILLENGVSTVRLLPRGFS-----
------------------------------------------------------DG----
------SMMYNKTQIVVPSLAAGTDDWGVLSELLT---------EMVAAGLP------KT
PVFQSLHKSF--ELFAEKDMAKASELLKEVHNMAD--Q------------ELCRVVQQFL
SAIIDYSDA---------------------------------------------------
--------------------------ANKTDTELHAKRVLTARF--HLFLKHMGL-----
--WDRIIVSPCTVM----RGGVAQMRVGPTMLGEISERVSATSAIWTWKCSD--------
------------ESNAA------------------IFDVIIEKALRIPE-----------
----VQDLGLKDKDALFGRCGLVHHIPMIAAQQLD--KEILTKA-KA-------------
-----------------HRMEVFHSVCDLLTGVRDAIFTWR----KTRIPVPR-------
--------------------------------LPLW--WTAET-FAP-CYRLVAERILE-
---------------------ELRDGQASD------------SERTR-LFMYILGIYDFY
LS----------------------------------------------------------
------------------------------------------------------------
-----E-----MDGRPDNDKILQD----------LIAM----------------------
-----GKVGDAIELAERHKDFGT-------------------------------------
-LIKNFLN--------------------------TEIHT----RQKTFE-R---YKKTYE
--NDDFEMYLCDYLKRNGRNDVLLQQG------------GRRVDAYLDNF----KELRYG
REIA-NKQFGKAALTLMSLAEAE-------------------SKSFSKFS-DFLTRAYYC
ASICQDGTDV--------------------SEVFDFYKRRYPEMKHRNRIPPEILKT---
-----------------------------------------GYGNDFDAMM---------
----------------------------------------SVEEMLEWNM-----SLQT-
---SDEA---TVDGYARAFHLLADLLVV---HPDSV-ELKEKIEKTWLSVID-YD---EW
SRV-----------------------------------------------RSK--DD---
----------------------VEKNTMFGKFCDWLTS-MYPA-----------------
------------------DKGDPFPAW-MPLSRLVILPSNVDSLLEESTSETTVNQ---R
AWIKGHV-KWVAEQLGHQARL--------PKFAYFRPDPKENGSI----------GQAVL
-------EGFAPILEQRELRVIAMLDKMSGAMK-------A
>gi|71982459|ref|NP_498724.3|	   1127 residues, 50 /line  Nuclear Pore complex Protein family member (npp-15) [Caenorhabditis elegans]
-----------------------------------------MSGRDLELTLDRVSSIEYP
ALVK--------------------------------------------------------
------------------------------------------------------------
--------------------------------------EAFLNNWHASAHRSEVTSNCAS
LNDR-----YCWVLSRNQIFIW--ERAKSS----------------------HRAIIPTQ
LPLPT-------SGLPRSVKCVVVYD------------GVH-RGANKTPCPGILVVS-PE
G--VLRHWTSIESQTYIEEVLDINNEV-------ALRV--------------------EL
-------------------------------------TDEPIDGKSASFL-LTTTSGTVY
FLNGKGQDSAKTGALECNKVAG-----REAHGFRR---RLSSIMFG-----GESKEST--
-------------SLITNSFQHQ-SK--D-LLVVTVSPDVLTVYNMYTPCELW---SLK-
-----------------------------TKEFFQPKIASFFEADLKRTPLKVRARLIDA
AVFRDG------------------------L--MILIGGTHE-E---SQSVHMFMVWMSA
NW-QTEQPTGV-------VWSA-RV-PMNEHRAL---FSKI--D--DSIYS---------
--------------------NLTLCIPKNTAESKKADRTDGIIIINPYFAVSLYLPFDLA
KPKKPESLYR---------------------------------HVSIPP------RDQLL
GYAICS--------------------------QYVYIMMLESGVSTIRLLPRGFA-----
------------------------------------------------------DS----
------SI-YTHEQVVVPSLSVGTDDWPILSELLS---------EMVASGLP------KT
PLYQSLHRAF--ELFAEKHMAESEEELKAIIKMPD--Q------------EIARIVSQFL
YAIIDYSDA---------------------------------------------------
--------------------------ANKTDTELHAKRVLTSRI--MLFLKHMGV-----
--YERIISSPLGIS----RGGILSLRVGGTMLGEVSERVAASTAIWTWKTSN--------
------------ETNSA------------------VFDAIIEKVLRIPE-----------
----VQDLGLKDKDALFGRCGLVHHIPVVAAQQLE--KNVIGKT-KS-------------
-----------------HRFEVFHAVCELLSGIKETIISWR----KTKVAIPK-------
--------------------------------FPIW--WTLET-FAS-CYRDVAEKIIE-
---------------------ELKNGSSTD------------SERAR-LLMYILSIYDFY
LS----------------------------------------------------------
------------------------------------------------------------
-----E-----SDSQPDNDKVLQE----------MIAL----------------------
-----GKPADAMELAEKHKDFGT-------------------------------------
-LVKNYLT--------------------------TDVGT----RQKTFE-R---YKKMFE
--KDDFEMYLCDYLKEHGRNDVLLQQG------------GSRVDAYLDNF----KELRYS
REIA-NKQFGKAALTLMSLADAE-------------------TKSFSKFV-EFLTRAYYC
ACSSIDGTDV--------------------SEVLDFYKRRYPEMKHRKRIPTEILKI---
-----------------------------------------CFGNDLDAMM---------
----------------------------------------SVEDMLEWNM-----AVQP-
---NDEA---SVEGFARAFHLLADLLAV---HPDSD-ELKKKIDKTWKALVD-YD---EW
NRV-----------------------------------------------RSK--ED---
----------------------VEKKTIFGKFCNYLIN-SYPA-----------------
------------------DKGDSFPIW-MPISRRLIFPTDIDTVLDECIANTTGNH---L
SWIKGHL-KWIGEQLCKQALL--------PKSAFFRPDMKQVGSI----------SQAAL
-------EAFGPILQRREQRFIDQLNRDS-MME-------T
>gi|45188089|ref|NP_984312.1|	   1116 residues, 50 /line  ADR216Wp [Ashbya gossypii ATCC 10895]
------------------------------------------------------------
---------MPEPVFQLRKELNV---FASEEGG----------------------ATEDI
SSYAATA-------DSSGI--------TEWNTS-----DKFT-NEMTLTENAKYT--VSQ
L-APN--LSFLP-------------------------------------EQATDLTGAVD
YYSG-----NALCNDRENLYIW--PFNSPQR---------------------RLACIRIP
LHE-E-------HEVLSGAPLCCFTWPSAGEES-----------EQTK-SAGVLIVHANS
G--LVQFYEDIHTINSVSTLISKSRVIQLDL--RFRDR--------------------EH
-------------------------------------ATDVVNAEPSGIL-VATSFGRLL
LLTIRDSSGKPCLKLRQQL---IKSQVGFFSGAMN------------------TFKDI--
-------------VAIKPSLITGKGE---RLLLTITRGGELKIWNVSATMSSY---KR--
VEVN--VYQQILESL----Q---ELYPFA----------------------YGSLQILDL
NPLPSDPY--SLLV----------------------LSSISD------GKETYYILTAIK
VE-ES----SF-------SIFS-VY-RLNTYTKA------------NDKKP---------
--------------------RLFIAGDLENGEQPIEP---QNVPVYLLFEDAVVIT----
---------------QAFTQLDSN----------YPLRKKWEDLVSLKE------DSMVL
GHGNDE--------------------------KALYLINGNRGVVKIEAKME--------
------------------------------------------------------------
---PSEDYRFVKSHIDQAVYFSQVPNT-PVEFNL--------------------------
------PDSI--ELEREEVEEDLLTSGDEILLSYS--S----YIP-PKLHSMTSHLQLRV
DFFVN-------------------------------------------------------
------------------------------------LLQFTRANF-IYKVSPQVK-----
--------------------------L---KLLESYEILNCSLSLSSYLSSDT-------
-----------------------------------DLTTQWHRVLL-----------SEE
VTEE---------ELMLHQLKRFPELFGKFLAEID-EPLRSSSD-IK---F---------
---------------------KVAAADLVNCVIYHSCLERG----ESEYRCN------QL
-NL--DLT-E-------VGDD-------------LP--WFINF-SIPDSLNKILLH----
------------------LFYSFEDG----------------NVPDE-YHDKLLEIIKSL
YYMCKQSDVWYAVKG---------------------------------------------
------------------------------------------------SNAYE--AGYQG
---FNL-----NSTLSNHLTWIQI----------LLKI----------------------
-----GRSVDALNIADFYHDLSG-------------------------------------
-LVETLSS--------------------------FDYEK-------AHP-LYEEYFTKYG
---YQFSKTLFTTVIEQGKINDLFSR-----FPS----HHDDLVRFFDEY-PQYGHVSWI
GNIF-DQQYNAAAEVLVSVSSPDAA----------------KKLDLNQLQ-VRLSIAKLS
ALAEEPIL---------------------NMDLLNTIQSGLDLIDSQKKAAEL-------
-----------------A---GEHTSLSKRYLETESHYQSILEKLKTNIVL---------
----------------------------------------SEYELVGIYTVL-DD-----
---------------VTAFAKALHFLSLIKT-IPED-SRQFLVSMIWRKCIL-FN---DW
NHT-----------------------------------------------SDD--LST--
-AL--YATL--LAFFKEEY----------YRAGIPLPH-VP-------------------
-------------------------KL-TAPISKDTLSEQLFAGV---------EC---G
NLLLDGA-EADTSALSAVQTD----------MESRIRFLIGSAHSEAGASCVVNYETNT-
------------------------------------V---D
>gi|46136899|ref|XP_390141.1|	   1381 residues, 50 /line  hypothetical protein FG09965.1 [Gibberella zeae PH-1]
---------------------------MFSPSI---A-QGGPATATR-SRRRQRPV----
---SSERTTQQPKAKRQRLPLTE---QTFVN----PDNQQEMVEV-KTDAKVATLPTKNK
NKNIEPPPEPASPVLRKELNVRVKKPKHGDRAA-----NKGD-GSLVLTSTNAYT--VSK
L-PAL--PDRIRSD-------------------------------------WSAYQTADI
FSTG-----YALSLTQTHALVW--PYTSTSQ---------------------SPETFSFS
LPSTT-------R-PNEPLPVGCLVSP----------------SASSA-EPGLVVVMGGS
G--KVVYWESIASAATFVFMKKDRTGVEYTIS-GMHSG--------------------EK
-------------------------------------VVAITNAESAGFI-LTFNSGRLA
YMNVRDSQGRPSISVQFLRNNLSPPTGGIFGSI-------RHAF-----QHLSLKGDI--
-------------AAVRADRSARTGE---RNIVALTGKGRLNAWRVHRGGHNE---II--
GDAD--VREEIIAAL----Q---EIDPVS------------------QEYPEDSFEAIDF
TYVPKGLE-SKYLDLSRLSDAMTTDDSSVQH--LLVLVSLTL------RSTSRYALVEAI
LT-PRD----C-------QIGM-IR-PITSYSSP---FSSSQLS--ETPRP---------
--------------------RLYLPRPAL--------------VAFVVFDRATVIA----
---------------SIAVPPQSPESQLQT--DSHILPAAFEDVIDFREDD----VHEII
GSGFEE------IASASSHEEHRL-HRPKTKNPAVVLMVRGAGAVRIVTTE--VD-----
------------------------------------------------------KF-AS-
---DQPPKVSAKSKIEQAVFFGVKQDN-PLIFDG--------------------------
------RQDI--KFADDEIAAAALEVSHEILSSST--P----FIS-TLPASLEDNLRARS
NALER-------------------------------------------------------
------------------------------------LITQLRIMG--ADLDRKTR-----
--------------------------W---SLLYDAEKMHVATLLWKRHEAFTAARPAND
-------------KKSL------------------VGTIVEFIHQGQKHN------PVAE
IGEVDR-----VRHWFINDVFRLELFVAWAYEVIKTLYKDNLLD-DA-------------
-----------------KVNVMIYEAIQVYNCTYTAAHDFR----KNSLSSYG-----LG
-FE--ELR-LGILRDGYDDLP-------------EP--WTGSQ-YVANNAKRLVDLSDQW
VLKNHDAGESS-------KAAN------QPDP----------KVVSK-IFEELPTLIDGM
LTSVLEY-ARW-SAT---------------------------------------------
------------------------------------------------QT------EQKL
MSQQFA-----KVYSTDRFEKPLA----------LARS----------------------
-----GKWEEGASIAEKHECLRA-------------------------------------
-LSVILLDHIQILENRLGEPGLSLVETQNLKRLRD---S----KKS----KLQNSFSTYG
---QAFAFPAYEFLLQKHGVEDVLEF-----DLD----NHGFKTLFLRSK-PELARISWI
NDVQQEKDVGHSADTLIDLALKK-------------------EQQVWNKK-IELSLGKLA
LMAELEEKDIKA-----GGLKVNADE-VRAEERLKKVDRELVAIRIQDQLYHQVLPSTYD
AVDD---AAALNFAMEVH---SMN--IPRRQKAQHQIFEDGMKRLLQHEAL---------
----------------------------------------DAMTLIDLLTLI-YLKPES-
---RAEI--------ANPFWLALLVAES---SCHSD-EVKEAKRMIWRRLFI-RD---DW
SRI-----------------------------------------------NDT--QLK--
-DDRE--------------VIERLEDTELYSMLTDCIS-FQDP-----------------
------------------REP-FRP-Q-PPNEALGAFTENLDRRF----RDFEASF---R
TKLIEVM-KHEDKLLHQFVEK--------NRLGQWVHTTFEAVRA----ELDRTLDTVT-
-------KNSSVVDTDKVMAGSIFDTGMSADTSPGGR---L
>gi|50288059|ref|XP_446458.1|	   1154 residues, 50 /line  unnamed protein product [Candida glabrata]
------------------------------------------------------------
-------MTDVKPMFQLRKDIL--------------------------------------
--NDETT-------GTSAIENVDSGNEESMIYQ-----QVGD-QTKVLTENDKYL--VKC
I-NSF--NAEQLPI-----------------------------------PSHVPFYSTID
GVNK-----QCSYNDNENLYVW--NFINSKWD--------------------DSNYCKIP
LNTDS-------SSSVNALPKSVFILPTNYDTDAEML-GLENSNSSNGIVGGVILVENTA
DATYLVYYEDMRSINHLSTSISKNMAHLLDL--KLHSE--------------------EK
-------------------------------------VTLMLNSEPAGLV-LATTEGRLM
FITIRETNGKPCLTLKQQLIRP--KGSGPLAF--------LSLF--------SSSNEI--
-------------ISLRNGPIIGKGE---RIVYVLTRNGRFQVWKLSVASKCV---KM--
MDTN--FYDSILDDL----V---ELYPFA----------------------QGSLKILDT
HPITNQPF-SPQVV----------------------LTQISS------SDETNFILSTII
LD-EQT--NSF-------TIFS-TY-RLNTYIMK-------GNS--ALAKP---------
--------------------KLCVPSSLQSATSK-------YFDLFIVFDKAVVIT----
---------------QTSSKLDST----------YTLKRKWEDIISFNK------EIQIL
AESND--------------------------ASTVYLLTKGMGIISIIPKKERGE-----
------------------------------------------------------------
---TAYEESFVKSHLDQAIYFSSSSSN-PVEFNL--------------------------
------PGGL--HLEQDEVENDLKTASEEILLSSS--K----YIP-PLTDNIEKHLSLRL
VYFRN-------------------------------------------------------
------------------------------------LISFVKDNF-AFSISPSKK-----
--------------------------L---DIIENFELLNCFHKFNNFISSSN-------
----------------F------------------ELKSFWDRTLEA-------------
------NGNINEIELAVEKIHRFPDLFSTYLNTII-KELPSK------------------
------------------SYTFKLTLADLIIETIYDAILEE----GEKKLRYE-----FL
-SL--DPL-E-------LNTH-------------LP--WFISI-DILDSINQLFFD----
------------------LKFSLEGQ------------------EKN-ANTQLLVIVKTL
YYLFNQVRLFF-LKE---------------------------------------------
------------------------------------------------NNMND--VSAQD
FMKKCD-----QLYENNHLAWNQT----------LCEL----------------------
-----GLNEDSLEISEFYHDFVS-------------------------------------
-LVETLDT--------------------------LEAVE----SKAL----YEEYFARFG
---EQFAHTLFEYYVKKSKLQDLFYR-----FPE----QQEFLVSFFKKY-PQYGRVSWI
FSII-NYDYASAAATLYDITSGDRA----------------SAMTLESAQ-LYLNIAKLS
TLAAHENHANV------N-----------LLGALKRIQANLDVVDGGKDLVEKLKRVD--
-------GAPSHLQANY------------KGTEFEKLFDLLVKKVTNGTML---------
----------------------------------------QFVEVVILYSLI-DD-----
---------------KECLYHALKLLAIDGDILELE-LKKFLISLIWRRSIL-FD---IQ
NAY-----------------------------------------------DTT--SED--
-STL-HFVL--KQYLEDEL----------FRANCPLPT-VGVL-----------------
------------------T---------EKTMFTESLLSSLFSNY----EL----D---T
KKLQDIL-EKEYNTVESTAVD----------IEKRIIETISSLDKANDNSYTVNYHDLTI
-------EY--------------------------Q----N
>gi|50302831|ref|XP_451352.1|	   1106 residues, 50 /line  unnamed protein product [Kluyveromyces lactis]
------------------------------------------------------------
----------MKQLFQLRKELSV---PAAAPED-------------------------SV
ISAEETT-------TGSAV------------TN-----VQFS-NEQVITENGKYK--VSK
L-A-----------------------------------PSLSFLP-SNV----ELCCSVD
AKSG-----YALCCDTDNVYVW--PFLSSET---------------------HPSFVRIP
LHDEE-------YESWSRPPLCCFTWPSVL------------ERDLKS-SPGLFLVNSRS
G--DIQFYEDVDTVSQVASFLTQTKR-HKSVL-KLRDG--------------------EY
-------------------------------------VENLINAEPAGIL-LSTNYGRVE
FCTIRDANGKPFVSLKQTIIK---CQVGIFSSM-------------------SKSKRV--
-------------VSLKLGEISGKGE---RIVSILTQGGRYQVWNLSSVGNCY---KK--
IDLN--VQSEISQAV----L---EHFPLA----------------------TSTLKLLDC
HPLSGDS--DAYLF----------------------LSFLAE------SNETHYLLSTII
VD-EDT--NSF-------AIFS-TY-RLNTYTRP--------LS--DEFAP---------
--------------------RLIVPTAYTKEHLP-------ITSVYTLFSDAAVLT----
---------------QTSSKLDSN----------YPFKRKWEDIIRFNK------DMKVL
GYDCNS--------------------------SSLYITDGRTCALKLETFEKYEN-----
------------------------------------------------------SD----
----FQEIRFIKSHVDQYVYFGGQSTDSLLDFNL--------------------------
------PDNL--DLQPQEIETDIQMSSDEIKYALS--N----HIP-PVANNPMKHLKIRS
ELFER-------------------------------------------------------
------------------------------------LLTFVAHNF-LDQTSSQFK-----
--------------------------L---DLISDFEMIKCLESLYSLLPQQP-------
----------------T------------------SISQAWKTVLSE----------SSY
QSDS---------DFISDGIVKIPELLGAFLKHLK-DLMKSTNE-TM---L---------
-----------------KSQIAKLINQLVYHSILEEC---------ENSYRYG-----LF
-QM--SPD-D-------VSKN-------------IP--WFTTN-SIIENLNDIFFL----
------------------LRHASEDL----------------AVVSE-FVEELLLLVKSL
FYMVRQI-TMW-IDA---------------------------------------------
------------------------------------------------NA---------I
TDSSYK-----QFFEENHLLWNRV----------LRDV----------------------
-----NRSQDSILITDFYQDFEG-------------------------------------
-LVETLQS--------------------------LP-------KITAFS-LYDEFFQKYG
---YDFAKSLFSYYIKEGLWDDLYESFG----ET----HSEYLDQFLGE-CPEYGKVKWI
GNIY-CHKYDEATTTLLSISTGTQSL----------------GQDLKQRQ-AQLSIAKLT
ALAAEVQD----------------------LEKLNEIQTELDLIDGQILLSQELQEST--
-----------------------LNPLFKDFTTYRTLFKYLSDAVKRRESL---------
----------------------------------------SVPHMIELFTLL-NQ-----
---------------DTSYGFALSILAID-HTLPTE-VKKYCEYQIWRRCLL-SD---EN
AVR-----------------------------------------------QTL-------
-----------RVFFKQQF----YHQSIELPIIDNLA-----------------------
----------------------------NEKLITDSYLDGMYHGL---------TD---L
NKLASDV-KREVALFANSNLD-----------VTMLQSIIGEINEETGNQCVIN------
------------------------YATNTIETSPTS----F
>gi|50418871|ref|XP_457956.1|	   1173 residues, 50 /line  hypothetical protein DEHA0C06919g [Debaryomyces hansenii CBS767]
---------------------------MSFTQ-------GSIFKPRQSSRSPAADNGSST
SNE---------------------------------------------------------
------------------------------PAE-----GSSK-SVFELTKNKKYC--VSR
L-PAL--PAVLESD-----------------------------------SSDNLLNGYSD
NASN-----YALVINEKAIHVW--NYNSTDP---------------------SPLSIQFP
LDP----------SSYSLLPLGILTRPS---------------SGTSQ-DPGLVIIDSSS
G--LVKFYESVQHAPALGLINNKL--LELTIPLNSSKG--------------------EY
-------------------------------------VTLAENVEPAGIV-IATSWKRCV
LISLRDFKSKPQLSYIELLGPS--HSGGLLSSI-------FNGFSKNDDHNGNVKDEI--
-------------VSIKSGKIANHGM--TQQIIIQDSVGGFNLFSYQLFSANAIPYIEKK
KTLKQNLGVYLENSI----D---GFLPGS----------------------SLNTKFLDL
WPLESQELHNIYLG----------------L--CLIDEAYR------DNEGKNLLLVTMK
ID-ETG----V-------LFYG-SH-KLIRYDPN------LIIS--SNNKP---------
--------------------KLYVPNLGK--------------TAFITFDNSVILT----
---------------DINTSYIESKGTV------QYYKPRWEDIVKLKS------NVQVI
GQGYEN--------------------RSTNTNPAVILLTSNSGVIRIERFPEISD-----
------------------------------------------------------NDMEID
DVDVVDPIQITKSHIEQAIFYSKSSA---IEFDI--------------------------
----------NEEYSSDIVIKALKKVLDEILDSTS--P----YLP-VFLPSIKDFLSMKS
KLYHG-------------------------------------------------------
------------------------------------LIDYTKRNF--MPLWRDIG-----
--------------------------P---QITEYLEKTEVALNLWVFISEEP-------
-------------GTTE------------------KLTGVFRESILEVD-------AVKY
SKDE-----DLIRKFFSQGLSSINQVLTTFIEKLI-------------------------
--------------------QIDYSLTNILNLIVKTMHDGV----FENDSRYI-------
------IG-SD------IPRY-------------KL--WIFET-SLLLRIEEVFSKA---
------------------YCNNNKDHEYISTQ----------QTRSI-LI----QSCEIL
YYFVTNA-IKF-MQE---------------------------------------------
------------------------------------------------QE------GTSD
QLREYI-----RWYKSRKFEWIDA----------LIKR----------------------
-----GLDKEAIDIAEKYHDLSS-------------------------------------
-LAQILEA-----EKSAINERYGENSQ-EYKV--------------LLN-RYSYYFEKFQ
---YEFASNLFDSYIKNDNIQSLLVG-----FEN----YNHYVEEYFSKNSKKTSEISWI
RNLM-DKKFVQGAETLIDSARSKNED------------------FQENIE-LKYSLAKLS
AIASKNSDDMT------DNPK--------LEELLYDAENNLILIRIQKHLYLELLSFVSG
QKGL---LNLDYVLKNF-------INDSLDLNTSKKLIEPFFQQFLENRPL---------
----------------------------------------TPTQLITLLTLI-----KQ-
---YSGF--------VNGFSNALKVASL---ITNEH-EYKLQSRMIWLRLLTSTD---DW
STL-----------------------------------------------AKT--ENK--
-TDEY--------------TKQKIHDSILYKTISSL-----GA-----------------
------------------KSE-LLNEL-D---------ELLLRYT----ESLDDDR---E
TELIQSLNARYLDTLQSYIAK--------YDLKTWIMSIKQEVKN---------------
-------------------------NSTGMLKNPDS----K
>gi|50543148|ref|XP_499740.1|	   1124 residues, 50 /line  hypothetical protein [Yarrowia lipolytica]
------------------------------------MSQIGNIRKLRQKAVQQELNRVVP
ATLFNDDVTEK-------------------------------------------------
-----------------------SFTNLSAVED-----SLAD-YGSEITRTAMYN--VTR
L-AAR--PDLSGVE--------------------------------IAFDSGEHV--SSS
LSDD-----FGLVVVGNKAHVW--KYTSPEP---------------------TPETFTHS
LGVQD-------NALGHLIPVTPS-------------------FKDVG-HPGLVLVGVNS
G--LCVFWESVGGAAAEGYLRTRQQ-VETQI--KLYSG--------------------EV
-------------------------------------IEHVNRMDDVTLV-LSLSSGRLI
GLSLRD-KDEAALNYWTLRD----TKAGLLSNI-------RSAF-----SVSSNRRGI--
-------------TGVRVVPSTNRSW---R-IYVATSECHLGVWEVTEGGDAT---I-LA
-DKD--LKPMLSADV----S---TLYNTS------------------------SIYLHDI
EYVAEED-----------------------Y--LVVLTSILV------DNSIFYIIYTID
LH-KDK-------------VVS-RH-RVQSYVRP--------GL--DRGTP---------
--------------------RLARPSPGD--------------TLYVVLDHAVVLI----
---------------DMVTRSNLN----------FVEYGKWEDSILLKP------TVSIL
GFGAED--------------------KNRSRDSAIVAITDAAGVLKITRFPEQDD-----
------------------------------------------------------KE-QTR
SLN-TLERGICKSRIEQGVFFAGGDFT-PLQFAA--------------------------
------TGEYDVKFPDDVVRRALLQVSHEICTSTS--S----HLE-GRFPGLGFSLEFRV
DRLRI-------------------------------------------------------
------------------------------------LNQYAYDNF-ASQLDVA-------
------------------------TKL---TLASNAEKLAACEAIWAMLDVKD-------
-------------GYIV------------------LENII-VKSV-----------DKNQ
NTDQ-----DPVQDFFTSRTLEAANLIYGVFDNIQ-QPNMGSI-----------------
-----------------FAATVGSAISAILTAREESLSALR----VSNDD----------
-----------------TGEN-------------CP--WWCES-RMMETWDSLFRF----
------------------IANNTNDH------------------------RPLGPLAQSL
CSQSVVA-ITW-ARN---------------------------------------------
------------------------------------------------SG---------N
DWQAYE-----NTYHQRRGDWIKA----------VVSV----------------------
-----GQVSQALHICETFRLYRC-------------------------------------
-LAEILDHDL----RVAITNNNKQSESD---------------AEYAIR----KYLHNFG
---YDFASQLYSYWIETRDFESLFTR-----FQD----YREMLKQYFRSS--NHANISWI
LSLG-LGEYQSAAEALVQAAKEGQDT--------------IPGGDLRNRL-VQLSMAKLA
FMQARSGTRMD------------------PSREQTEVNNELNLSLIQKRLAEHISGHVQG
T--Q---IFSEQILSPQL---PK---------GVTDAAKKLVTKVVQKKVL---------
----------------------------------------TSLELVELCSCV-IG-----
--------------------FSEEALQAIS-DSNNA-KTSIMSLTVWVRVLL-ET---DW
MEV-----------------------------------------------LDK--SDR--
-TDQE--------------QEALLLDTPLFQLLKYAFD-TGLI-----------------
------------------GQQ-NSPLQ-VPNFEN-LHKPNSATLA----SEERF-----R
TNLDSDL-LSEFDAALKVLDT--------GDTRRSVVGLVNR------------------
-----------------------------AKLDAHS----T
>gi|58266380|ref|XP_570346.1|	   1327 residues, 50 /line  hypothetical protein [Cryptococcus neoformans var. neoformans JEC21]
---------------------------MLSSLP---SL--SRLSHIADSSHSQQANQYST
QIMPSSNQVQPYLSGQVGVPVQQGVYPQLPGTQPYPQTPYNPYGG-TAPGMGTVGA----
-------------------PI--SQNQALSQPF-----APGS-GAVGQPY-------PSQ
P-VAQ--WNRYITPLQAPQSLESVSKDEDPIYGPLGRASGKV---------ERGLRGDVD
ISAD-----LEEKLGPSAQIQD--PYAAPPSAS----------------------AAYKC
CSVTK-------RTPLPDALHQELNFKHLTAKMGL------------F-EEIERAWFTVD
N--KLFLWDYGDGRDFSR---YDEQTDTIQAVGL----VK-----------------ARK
-------------------------------------DVFVDDITHVLVI-CTSTKATLL
GLSRSLTSREILLYHTNLTVD----TPTVMVDIKG---TDEGRVFVLGANKDLYELD---
-------------YSSDSSWLFGSST---SVRLKNRTSGGVSNWVPSVVASKV-KAGIES
FAVDSQQKRLYTLHT----GGEIEFYDVSANRFDLRSKYNRLKHDLNRDPRGGAVTIVSI
SAIG--G-----------------------H--ESKRACLVA-I---ASNGVRAYFVSTP
SF-YPIILR---------------------------------------------------
-----------------------APPPLQLGLSV------SDQSIY--TSGTFIAVQYDP
NAPLTQTHLTFA---IPQS---GRQSALR-ENYETLEPPVFQEWTATEIVPSQVWAIVEL
SDANPKNSPASLRR-SDGLALSAL-PRQAEAGPRGFLVLAASGLFWVD------------
------------------------------------------------------------
----------------------------QPRPVDI---------LKANLEIE------KD
VAVNTIR----------MTFGKTQLAAMALLLGST--PE--TKHP-DLISSLSTILLTSG
EPVVKDSTGGKTITYSSRHDGLALAIARYLRPIWSAKVTLPLV-----------------
---------------------G-GKQILGIKETVLSKVQANLESL-RRYLEEHPFQSYQV
EGEAKIAWAQE-------EMSLHGLNI---LLKQAVEAISFVLLLSDY-----KITDIVA
KCDPVTQSALASL-----------------------------------------------
---------------------TFESLITSLDGRAV-ARKLVTAL-IE---Q---------
-----QIGQELGIDTLSEILQQRCGTFIQPGDVVQYKAEES----MRRAEATRDPLEKTE
-SL--AES-LR------LFIRAAGSIPIPRLQEV--------------------------
------------------------------------------SERYR-TLNYTLGAIELA
LRTASDL-DPH-K-----------------------------------------------
------------------------------------------------KAIDF--VRDGE
HPADPR-----KALFEARKECYAE----------VIK-----------------------
----------ALKVADDRLD-KA-------------------------------------
-VAEGDAA--------------------------TA-------TQNRNE-AYA---LAIA
SDDELFHFYLYDWQVERGLQEQLLEF-----DTP----FIEDYLKITISNVEDRRDLLWK
FYAR-REQYLPAAEALSSLATRPSPMPLHDR-------------LYYLAQ-ALTSAKSAA
SLGSED------------------------VEFTSRLQEQIDVAQVQMEVARAVEVHPEM
TGEE----------------------------------------KLEVLAS---------
----------------------------------------LNDGLLQL--------DEL-
---YQNY--------ARPFRLYEPILLIL--KTADT-RVDDVCEAVWRQLLG-SA---G-
-KI-----------------------------------------------GGA--AGV--
-SEVVKSLG--RRYFPSEAAPMDIMIPVVYAEAAGYPG-SPGW-----------------
------------------AST-TLL---DAGVPLRDLWEAVTGLY----EN----S---D
DEEREFY----AEQISILAQR----WM--SQMDEIPAAEIERF-----------ASAYIL
---------RTNGASDDST-RAIRDKLLAAKQAAVK----Y
>gi|6322935|ref|NP_013008.1|	   1157 residues, 50 /line  Nup133p [Saccharomyces cerevisiae]
------------------------------------------------------------
-------MSEKKVHLRLRKELSV---PIAVVEN----------------------ESLAQ
LSYEEES-------QASLMDI--SMEQQQLRLH-----SHFD-NSKVFTENNRYI--VKT
L-QTD--YS-------------------------------------SGFSNDDELNGYID
MQIG-----YGLVNDHKKVYIW--NIHSTQK---------------------DTPYITVP
FRSDD-------NDEIAVAPRCILTFPATMDESPLAL-N---PNDQDE-TGGLIIIK--G
S--KAIYYEDINSINNLNFKLSEKFSHELELPINSSGG--------------------EK
-------------------------------------CDLMLNCEPAGIV-LSTNMGRIF
FITIRNSMGKPQLKLGKLLNKP--FKLGIWSKIFN------------------TNSSV--
-------------VSLRNGPILGKGT---RLVYITTNKGIFQTWQLSATNSHP---TK-L
IDVN--IYEAILESL----Q---DLYPFA------------------HG----TLKIWDS
HPLQDES-----------------------S--QLFLSSIYD-S---SCNETYYILSTII
FD-SSS--NSF-------TIFS-TY-RLNTFMES-------ITD--TKFKP---------
--------------------KIFIPQMENANDTN------EVTSILVMFPNAVVIT----
---------------QVNSKLDSS----------YSMRRKWEDIVSLRN------DIDII
GSGYDS--------------------------KSLYVLTKQMGVLQFFVKE--NE-----
------------------------------------------------------ET-NS-
----KPEVGFVKSHVDQAVYFSKINAN-PIDFNL--------------------------
------PPEI--SLDQESIEHDLKLTSEEIFHSNG--K----YIP-PMLNTLGQHLSVRK
EFFQN-------------------------------------------------------
------------------------------------FLTFVAKNF-NYKISPELK-----
--LDL-IEKF--------------------------EILNCCIKF-NSIIR---------
--------------QSD------------------VLNDIWEKTLSNYNL----------
----TQNEHLTTKTVVINSPDVFPVIFKQFLNHVV-FVLF-----PS-------------
-----------------QNQNFKLNVTNLINLCFYDGILEE----GEKTIRYE-----LL
-EL--DPM-EV------DTSK-------------LP--WFINF-DYLNCINQCFFD----
------------------FTFACEEE----------------GSLDS-YKEGLLKIVKIL
YYQFNQF-KIW-INT---------------------------------------------
------------------------------------------------QPVKS--VNAND
NFININ-----NLYDDNHLDWNHV----------LCKV----------------------
-----NLKEQCIQIAEFYKDLSG-------------------------------------
-LVQTLQT--------------------------LDQN-----DSTTVS-LYETFFNEFP
---KEFSFTLFEYLIKHKKLNDLIFR-----FPQ----QHDVLIQFFQESAPKYGHVAWI
QQIL-DGSYADAMNTLKNITVDD----------------SKKGESLSECE-LHLNVAKLS
SLLVEKDNLD--------------------INTLRKIQYNLDTIDAEKNISNKLK-----
-------KGEVQICKRF------------KNGSIREVFNILVEELKSTTVV---------
----------------------------------------NLSDLVELYSML-DD-----
---------------EESLFIPLRLLSVDGNLLNFE-VKKFLNALVWRRIVL-LN---AS
NEG-----------------------------------------------DK--------
-------------------LLQHIVKRVFDEELPKNND-FPLP-----------------
------------------SVD-LLC---DKSLLTPEYISETYGRF----PI----D---Q
NAIREEI-YEEISQVETLNSD--------NSLEIKLHSTIGSVAKE--KNYTINYETNTV
-------E--------------------------------Y
>gi|66519279|ref|XP_395203.2|	   1123 residues, 50 /line  PREDICTED: similar to CG6958-PA [Apis mellifera]
---------------------------MDRT------------------------N----
---IGNTLGRNLTSPRKRIT----------------------------------------
-----------------------------ISVS-----GRSN-QSVQIICKSPNHVVESF
G-SSL--PVLVT--------------------------EALTFVD-RNI-----AVSVNI
SIDG-----WAWLVCGRRLLVW--QCKTTIHDS---------------KQKRTFKSQCRE
LLLPQ-------SDLAHKAECVAVWL-----------------PSGYQ-VPSCMAVS-PE
G--IVRFWVSVAHEG-----------SSVETSA-ELAG--------------------QE
-------------------------------------VDCLTYIPGHGCI-LATTTCTVA
LLQSQFIGGKNSVTCQVLRTSQ--G---WLGGIGR---RMTSLIFGAIPQSPVTETKL--
-------------VKVTCTTLGDRGS-----RVLILAGSSLQYWSFPYNEQEK---IEFD
EDIGHIISQTFQRKI----WESS---ACN------------------P--QNMETWLIDM
QPCNEG------------------------I--VFLMAAYCA-D---ASSFIEFALGLIQ
LS-GTTLANTF-------KWFI-PI-KIDPISYH-----NDAES--TLVSY---------
--------------------RFIL--CGW--------------EAIIYNQYKVLVVNC--
---------------TSENEQDKIDLVRGGDDS-ILGGALCSGTPVLFTKN---------
------------------------------FGLVSIMPSDFISQD---------------
------------------------------------------------------------
-----FNMSYTDNTNADYNYRSNSIQN-FTSLISN---------EEVQDMFY------SS
DNCTQLRAAF--LLSLRQNRAQCEEILSQLFPLQE--E----PIM-DIDANLDTLILKVA
KDLIDDYPA--------------------NDPRWSNHRDLSMT-----------------
---------------------INAVTSMQIPNQLEGKQKAIDLF--IIFLKEHDL-----
--WNRFCAVTY-------RGIIISTPY---VLEEYAEKIIAALTIYNLQNK---------
--------------YAD------------------IIDTIIEQTLSP-ES----------
----YVSDELTARDIFYREVSTVHRFLPTLVNNAS-EVTQSERP-IQ-------------
-----------------QVAHYIMQVNAILLGVLHEVMKYR----QHNAERFL-----PT
-RC--SYG-I--------TEY-------------LP--WTAAI-GRH-GLRNCLTTMYNL
TLKH--------------GITG------TNDS----------TVRNE-LYEQLVSYIDLI
---LDGR-KCH-LES---------------------------------------------
--------------------------------------------------VKG--T---E
KFEILL-----KQYETDRMNLIQP----------LIKE----------------------
-----EQYDNAAMLAEKYCDFAS-------------------------------------
-LIQICEL--------------------------TN-------NKSRLD----GYIKKFA
--AQDFVGFLFSWYVKDGRQGQLVEKCRR----D----GTIELSEKLAEH-PT---LSWV
QSAL-MDDLRFAANTLHSLAIQE-------------------NELVTRKK-SMLSLAKLA
LLASDDLEEE-------------------IRDCVKRIDNELALIAHQEDLPTQLLTT---
----------------------------------------YGYDVEKLRVF---------
----------------------------------------TPTELITLYT-----SDDN-
---IEAN--------EYDFKKALDLLKY---MEQED-EKVSLKLQIWARAAK-RD---QW
DTI-----------------------------------------------GKN-------
-------------------PEQQVQETIFFKLMDLAHF-MGGE-----------------
------------------VNE-FLPPV-D-------------------------------
------M-LLVEPELGNLAAS--------SNFQFLIKFVYEYA-----------YSN---
----------------------------------------Y
>gi|66806945|ref|XP_637195.1|	   1206 residues, 50 /line  hypothetical protein DDBDRAFT_0187493 [Dictyostelium discoideum AX4]
---------------------------MYYSSS---KP----------------------
------------IKKKPNTGISE---FNPTQSQ---------------------------
-----------------------IQQQS-------------------------CNYKITP
T-YDL--PFILT--------------------------QAINDEN-QQHQIEQDLTGSLS
SRDG-----TCFIIYSNELFIW--TIDK--------------------------PQYCDR
IELPI-------KQNITRQHIVVYKN-----------------KSSSE-RFSVFLCSPLT
G--YIRFWGNSSKPN-----------VSQDLPL-ENPGNN-----------------NNF
-------------------------------------KIFITECQPFGVI-VGNSLGSIY
LVSVKNNNNLIS---KKINKSQ--G---MLSYLYL---SRQSPVIS-VFSSPINQQQLQN
NNNSHHHHHHHS-TTLSSNNFSTIPS---RF-IYILTEGSLLKYEIENGTERI---I-LD
FPIQKEITKLFSNFP----KFHQMNIDTI------------------IDQNKDEIQIVNF
ILYET---------------------------------SA-------SQNLVKYYILQIE
IQ-DDQVLR-----------IK-RL-DSFSANKK------LGGG---VTSI---------
--------------------EPILQTNSL--------------KYYLTWFDNIYYYSNGG
GGGGGVNGIISG---SISFQSDIAFSGFY-KNQFYFFSEQGINKL----------DIQPF
GSGQLASSELHIQDTIKNIESDIY--------------MDTDNTTSVTGTP---------
---------------------------------------------------------AT-
--T-ASATISTTPTIVSPILF------------DI---------PKDENLIG-------S
KRNNVLKLMN--SFS----------LKQHTRVDQF--V----KIC-KGYNDFDQVIQQVS
LWIIDQQPN--------------------S-KFWAEDGKLLHM-----------------
---------------------FVKEISVQLNQQLEDKKKRHNFL--LTCIKDTDL-----
--DKLLTT---------------QTKE---ILKKNEIKIKCAIELRNYQNQQEQSRKSLN
YTTTTTTIMKGASSSSS------------------IFSQLIESLVAERNP--------NW
TNIG-----MNVFELFYSNVSGIDQILINITSKLQ-------------------------
-------------------------------ELLQNQPQQQ----QLLTSANK-----AQ
-IL--LEN-CE------LFYLISSSFPVEYLNSPII--QSTSI-SIHNLFPKVIQSILNF
IQLEFPNQVAGLLGGGGIGGLGNGHSS-SSSTILFKKDLGIPNVDKQ-LYDHLYKLTEKY
LYSLK-------------------------------------------------------
------------------------------------------------------------
--INQF-----EQFNQFKTKLIEP----------FVEC----------------------
-----FKFQEAITLANQFDDFFT-------------------------------------
-LINVYCYQQHQLQNSTITIATTITPA--------D-------NNKLLI----DCLNKFE
--KIGQLSKVYEYMLERDLKSELLQL-----PSD----FNDSLFRFLQSN-SE---LSWI
HSIR-MKNWTNVSNTLYQKSISNQHHQQQQQ------QQQHQVMTLKEKQ-KLLSLSKVS
LMVSTATSSSS------SSSSLELQLQPSQQIQLDVINQNLSLIKSQKFFLPDL------
-----------------------------------------------KNVL---------
----------------------------------------SVSEVVQLIL-----QREI-
---GDED---P----MVNFVSCIEIISESPLLLKKE-EVKELLKLILELSIV-NE---TV
FF--------------------------------------------------E--KSI--
-SDIQ--------------LSYSLKETKFYNLISHPHF-PKEI-----------------
------------------ALV-LLSPI----------IEDFYK-----------------
------T-HINSNKFSSLDDK--------RQFEISVARLLELSKL----EI---GQKQ--
----------------------------------------I
>gi|85086089|ref|XP_957622.1|	   1370 residues, 50 /line  hypothetical protein [Neurospora crassa OR74A]
---------------------------MFEPTQ---QDQGGPAKGTRSSRRRARPS----
---NTDATVQAPKAKRQRVPLHE---TTVANTEAHPETDTDMYEA-KSDKLALLDIKRDG
IENLGGP-------RKELSVR--SKKQKAGERT-----AKGD-GSIVLTTNNAYT--VSK
L-PAL--PDRLRADAQSKLDQHSYLPNALPPLEQLSIESGVPNKF-QDR-----QHGAVY
STSG-----YALSLTHTHAFVW--PYASTAA---------------------SPETFTFG
LPYPS-------KNPTDPLPLGSLVSP----------------SAASD-EPGLVVVMPMS
G--KIAYWESISSAATLDFIRQQRHGVEDTIPG-MFSG--------------------EH
-------------------------------------VVQIVNAESAGFV-LVFSSGRLA
YLSVRDMHGRPAISVQFLRSSL--TN--AVGGLLG---SIRQVL-----GSTSAHGDV--
-------------VAVRASHATRVGE---RVIVGATTKGKLNVWRVHRGGHHD---I-LS
-DID--LRSDLIHQI----Q---EADPAS------------------AGLPEESFEIVDF
TCVPRG------------------------L-------DN-------NKSQSHYALVEVV
IS-GQN----K-------KVGA-VR-PLTSYTSP------VRPN--APERP---------
--------------------KLYLPRPAM--------------VAFVVFDRAVVIA----
---------------SMAAPPDSPESQLQ-EDS-HIIPATFEDVVDLRDEG----NVQIV
GSGTEE------PTTNGHFPDELR-SRHRTKNPAAVLLVQGVGTVRVAVSE--VD-----
------------------------------------------------------RF-AT-
--E-KPPTISAKSKLEQAVFFGIKNDN-PLVFQG--------------------------
-------RSL--PFTAQEIGNAAIELSHEIVASKT--P----FIP-NVPASLENNMRTRV
EYLER-------------------------------------------------------
------------------------------------LISYLNTL--RVDLDARTR-----
--WVL-LYDSE-------KMAVATWLW---RKNEQF----IAERPKGD------------
-------------KQNV------------------ISETVVYINENQKTE------PNPA
VGEVDPVRHWFINDVWRLEIF-IAWAYQIIKY----AYTERLTD-EN-------------
-----------------GINRLILEAAIVNKGALQEAEQHR----LKNARLYG-----VN
-PR--KGA-EG------NAIP-------------EP--WTATS-FIGSNLKRLIEFCHEW
LDNY---------------YFPSPEKA-SVDV----------KILKS-IRDMLPALTSRY
FTALDEY-ISW-AEK---------------------------------------------
--------------------------------------------------SLD--PDTRE
SGKRCL-----QEYVENVYEKILR----------LKDY----------------------
-----DLWDEAIALAQEHQAYAA-------------------------------------
-LADVMVQHILTLEESALAPGTSATKAEEYRAKAED-------RKRQMG----GFFNQYQ
---ERFAFPAYEALLDASGVQAVLEF-----PYD----NEGYATKFLRSR-PGLAKISWI
NDVEREKDIDRAAETLLTLGLE--------------------EQHVWSKK-IELSLGKLA
LLADEADQ-RN------GDSEMSNDFSNSKEAKLEKVDQALEIITIQDGLYSQIRPTIEE
AVDE---SAEFELAMQFH---GAWINGQKKQKALQSVFEDGMQRLLKHKAL---------
----------------------------------------QPLDLIDLLTLV-YLDPKH-
---FKAI--------GDQFYLALKVARH---GLKGE-ERRNAERLIWRRCLI-RD---DW
KQV-----------------------------------------------NVT--NLK--
-DDQH--------------QLEVLGETALYRTLFAVVD-EQHA-----------------
------------------NDA-FRPCI-KPSDALGVYTDSLDRRF----DGMDASY---R
NKLMDAM-KVEDAKLKTYIDK--------ARLDEWYKTTLEAAEN----TVAIVYGRMTA
-------KKAAAAAVNGST-RAPLEAAGAVSEGSSF----W
>gi|91087283|ref|XP_975551.1|	   1138 residues, 50 /line  PREDICTED: similar to CG6958-PA [Tribolium castaneum]
---------------------------MDRS------------------------F----
---NSSFSTRSPFSPRSRQNLNA---KKIIPPN---------------------------
-----------------------FRKSSRFSVS-----GKST-QSVQIILSTPYNYVERF
G-QTF--PVLIT--------------------------EALTFAD-RNT-----VVSARI
SKLG-----YLWVVCGRRLLIW--QYRQSPVLLD-----T-------PSKKTSLLNQCFE
LQLPQ-------SDLAHRAELVSVFV-----------------NSDSN-TPSCIAVS-PE
G--VVRYWPAIVHEG-----------ISVEQHV-SLQG--------------------QE
-------------------------------------CDSLTDVEGLGCI-LATTTCTVL
LLQPQLSGGRHSLKCKTLKIPT--G---WLGGISK---RMSSLIFGPIASETSAESGI--
-------------VRVLSVPGTTSDT---W-TVYVLADHNLQKWQLSKNDEEL---I-FV
TELNRIVRDSFCGAL----W---ENCVGD------------------Q--TEIDTWLLDI
QSDKDN------------------------V--IILAAAV-------NIPRVHYAMISLQ
TN-TNQPPTAV-------KDFL-LL-KITDLYRE------NNPG--DSLSY---------
--------------------RFLL--CGI--------------NAYLYNQKHITVI----
---------------KPQEEPDILEFNTP-QDF-LLAGAICVNTPIFFSRN---------
------------------------------HGLVAVASNDMSNDL---------------
------------------------------------------------------------
-----NLSLTGANSFVETSFNDNVVVN-NLSIYNM---------DPEEISIA------YK
DTVSQLKAAF--IYRIQNQEQACKEIIDELFPPDA--S----KLP-GIDSLLDKVVIMMG
KDLIDDTPA--------------------GDPRWSKD--HQVG-----------------
---------------------LGSSHSMQVLDQLKNKQKALSLF--IKFLKESGL-----
--WAQLSASTI-------RNTTTATTY---IMGEISEKIIAAISLKTV------------
-------------AYNQ------------------VLEKAIEKATAESET----------
----KPENGLTYQDVFFREVSQVHRGIQEMVNYCE-DKSHSNMD-PA-------------
-----------------QIVDMIHDTNEIILGALKSVINFR----EQNVVNYK-----PS
-EG--VLA-IA-------PEF-------------LP--WTAAS-GAE-GLFNSLSQMHYL
TYNY--------------GIIL------TNNE----------RLRND-LFDQLVSITDII
---LDGR-KSH-LES---------------------------------------------
--------------------------------------------------IKA--TSFEE
---IIY-----KQYCSDRQKFMKP----------FIHE----------------------
-----KDWERCAKLAEKYLDFET-------------------------------------
-LMILCEA--------------------------TN-------NQRRLD----DYLERFS
--NEGFSEFVYNWFLKENKQGKLIDMCKHVGKSK----NIQKLTNFLSGH-PS---LSWM
QEIF-DKKYNQAANSLQTLALNE-------------------TESVTRQK-TMLSLCKLA
KLAAGTGS----------------------EEALRSVDSRLDLIAYQEDIPDYVLQQ---
----------------------------------------FGYDTINIRVI---------
----------------------------------------PPKDLINLYI-----CKEY-
---TEAA--------ELEFKKALDLLNF---IDDEE-LRQEMSLKIWRYALL-RD---AW
QHQ-----------------------------------------------NLD--S----
-------------------PMEILQHKLFFKLVDLAMD-LEGD-----------------
------------------GWN-LLPPM-D-------------------------------
------T-LIDDDSLGDLRNN--------TNFQFLLKAGYEHI-----------YRSQTV
----------------------------------------E
>gi|115400851|ref|XP_001216014.1|	   1199 residues, 50 /line  conserved hypothetical protein [Aspergillus terreus NIH2624]
---------------------------MFLPR-------S--AGSQRNPRRRQRTS----
----SDDSVKPPRAKRQRSTLGQ---KAPDSS-SENLADRLRNDA-PDHPTPITDETEDT
FSEGPAA----------HNQLPIRSLKKAEKRE-----DDID-GTVLLAI----------
------------------------------------------------------------
----------------------------LASSPSPS------------------DTFTLS
IPEPC-------REPNNIPPLGVLLS-----------------TATAG-VPGLMVVMRQS
G--KIIYWETVSSAASLGLPRQKQTGLQGSVP-NLLSG--------------------EV
-------------------------------------ITDIANAEPSGVI-LTLSSGRVA
HVTS----------------------------------------------APVYR-----
------------------------------------------------------------
--------------LC-------TESVSG--------------------SGDHDIRVLDF
TPTPRGS-LDDAVQ-SEGQNALS----------LSVIVAPA------GTAPTELFLAQID
IT--QD----V-------NVSS-IN-SINLRGIA-----T--FP--EYPKP---------
--------------------RLMLPRPGD--------------TAFVLIGQSVILL----
---------------SLAPVSDSPSRQLLA--DSDRAPQPFQDIINLRSGQ----SYEIL
GSGFED------QA-------------AESPHPACLLMVRDFGVIRVSALPRLKT-----
------------------------------------------------------------
ETDGENAQVTAKHKIEQAVFYGTISGN-PLNLDS--------------------------
------RTNL--DYPVQEIEQAALDICGELLRSTS--R----FIP-ATAISIQQNLRSRA
KALDD-------------------------------------------------------
------------------------------------LASLLMQQN--KAFDRQTW-----
--------------------------W---ELLWGAEKIAAQRAIWKIEEDARKSK-G--
-------------NKTF------------------LTHVIESMSEKFRTK------ARSD
G--DDP-----VRNWFLYDTFRMEHIVPWIFNAVKPQKGFSSRQ-GR-------------
-----------------KISEQILEASELSLAVLETAFRFR----DEHASRYG-----LG
-DG--YIE-DGVLVTGYNGLP---------------EFWTSQS-ISYVETGHLLDLELDS
CRAWIQQRN-SNMEM------------------------PEDKIVKK-ISKNSSRLLRVL
GQMHSER-VRW-LSAQQE------------------------------------------
-------------------------------------------------------SKLVD
ESIATD-----QSHVKQRKWQLFK----------LAGI----------------------
-----GQLEDAITLAEQFRDMDA-------------------------------------
-LVELIIELQDQRKVEDN-SDSLDGNGDVLSRDSHE-------LGE----KISLYFEKFG
---EPWADAFFSRQISMGQS-GVLFS-----MRK----FQPFITRFLRKH-PVYSRLGWI
NDVLGEDKYNAAAESLQTLAVEH-------------------ETDLWSHR-VELSIAKLA
KLATWEENTAP------ADSL--------IHTDIRRLEDLTEIDAVQEVIYAYITPFLQG
AIDQ---KAELDLAVDHF---GKS--ISSDRPSLLELLSETLGMVIARQVI---------
----------------------------------------GAERLVDLLTLM-NP-----
---SQTMEYDHSDLLGKEFYLALRVVRLASFSQQDSRYHAAMQRLIWRRCMI-RD---DW
VET-----------------------------------------------GKA--AER--
-LGAD--------------SEASAYETSLFRTLSLCLG-DRHN---ESAESASLYIPKSP
QEVLLNDADAEVLASRF-----------------------------------RAEQ---R
GRLTQDF-KKESDILSRYIEQ--------GKLEFWFNNLFTSGEE----AVTT-------
AAELSSLD----EQPKAQS-PE-SVEESNEKARLSW----L
>gi|119501358|ref|XP_001267436.1|	   1340 residues, 50 /line  Nup133 nucleoporin, putative [Neosartorya fischeri NRRL 181]
---------------------------MFVPKA---GLSS--VASLRNPRRRQRTS----
----SDESVKQPDAKRQRSALRS---ESPGRS-SEAQSDFKKRLP-KDPGLDTGDASDPT
VAKKLGV----------QKSLPVRSLNELKRPA-----NEVN-AAVVLSKTDFYA--VSQ
L-PAF--PDQIQGL-------------------------------------PSDFRGIFG
TANG-----YALALTASHAIIW--PYSPSASASSPV------------------DVFTLT
IPESC-------RESHGAAPLGVFLS-----------------SANGE-IPGLMVVMPYT
G--RIIYWETISHAGSLGLPRQRQSGLQGHVS-GLLPG--------------------EY
-------------------------------------VTDVINCEPSGVI-VTFSSGRVA
HITFRDSQGRPTVMANFLRNSSSSS--GLLNG-------IKSVF-----SGGCWRKDV--
-------------AAVKAARSHQRGQ---RDIIVGTTTGVFEIWDTHWSNGSI---MK--
KQFD--IRQELCRSLG-------RKHTEA--------------------ASDTDLKILDF
ALLSCGD-NAQDLQ-HSGAESWR----------LCLVVAPSR-----ETGRRCISVVQLL
LS--EE----V-------HVLA-AI-SIDLNFSP-----TLSNA--PQPNI---------
--------------------KLHVATVSQ--------------TAFIVIGQSVLLL----
---------------SLVSYGDSPTSQLLL--DSGRLPSPFNDHITFRSGA----DYKLL
GSGCED------EP-------------GEGSSSACLVMVRNFGVIRIAVRPRQSA-----
------------------------------------------------------------
GNEIEDAHITAKTKIEQAVFYGARRGN-PLDLTD--------------------------
------KGGF--DFSSQEIEEAALEICGELLRSTS--H----YIP-ATSVTLDQNLRLRA
KALDD-------------------------------------------------------
------------------------------------LASLLLQHK--KPLRRQTW-----
--------------------------Y---ELLWGAEKLAAQRALWKLEDKARRAMGQ--
-------------GNTF------------------LAHVIGSMNAKFKTK------SEYQ
-EDKDN-----VRDWFLFDTFRMEHIIPWIFKALKLQKGIPTKQ-GR-------------
-----------------KVLEEIVQASELSLAVLETAFRFR----DEHARQYG-----LE
-DE--HIE-DGVLSSGYDGLS---------------EFWTSQG-IVYLETGHLLDLELDT
CRAWTQQTT-ASLDL------------------------REQKFVRQ-IAENSARQLRVL
SLMHYER-VRW-LSSQDD------------------------------------------
-------------------------------------------------------PKSVD
EGIELE-----QTHTKQRRWQLFK----------LAGI----------------------
-----GQLEDALSLAEKFRDMSA-------------------------------------
-LVELIIELQDQTLADS------EHAGNVTNYESEQ-------LGR----RISTYFEKFG
---EPWADAFFTRQISMGQS-EILFT-----MRR----FQPFINRFLHKN-PTYARLCWI
NDAIGEDNYEAAARSLETLALER-------------------ESDLWCHR-VELSLSKLA
TLAAWEESSAT------GKPI--------LGNEIKRLEDLAELDAVQEVVYAYMMPALQG
AIDR---KAETELAIDQF---GRF--V-NDTPSLHEVLSVLITKVISRQIL---------
----------------------------------------RVDQLVDLLTLI-DG-----
---GQVSEETQNEFVGKEFYLALRVIRLNSSTQEGPLYHVPLQKLVWRRCMI-RD---DW
Q-L-----------------------------------------------ERN--ADN--
-TDHE--------------PGDHIQCVSLLRTLTLCLR-DKHC---ADADPCPLYVPSSP
LDVVLNESDLDFILSSY-----------------------------------PQEQ---R
SRICRDL-SKENDILRQRIEE--------GKLEFWYRKLLISAEE----AVAS-------
SATHSTGATVQSSDGLQAH-HS-ETGTLSTRAQLSW----L
>gi|121706418|ref|XP_001271471.1|	   1339 residues, 50 /line  Nup133 nucleoporin, putative [Aspergillus clavatus NRRL 1]
---------------------------MFVPKA---GFSS--AAPSRNPRRRQRTS----
----SEESVKAPNAKRQRSTLRQ---GGSEIP-SKRLSDPQDRLP-NEELGTTDIGFAPT
NTDNTSL----------QKSIPIRGLKLTEASA-----NKAD-EPIVLSRTDLYT--VSQ
L-PSF--PDKFCAS-------------------------------------NSEFRGYFG
ADNG-----YALALTESYAIIW--PYHASAPTTNPL------------------DAFTIA
FPESW-------RDSHGTVPLGVFLS-----------------NATGE-MPGLLVVQPIT
G--RITYWETILNAGSLGLPRQKESGHHGCIA-GLLSG--------------------EH
-------------------------------------ATDIINCEPSGVV-ITLSSGRVV
HLTLRDSQARPALMAYFLRSPNTNG--GILGG-------IKSVF-----GGGCWRKDV--
-------------AAVKAAQSHQRGQ---RDIIIATSTGVFEVWDTHWSNGSM---LK--
RHFD--IRRELCSSLG-------REFADG--------------------ASDFDLKILDF
SVMTCDN-NLRDSQ-DAGAETWR----------LCLIVAPSR-----EAIHEGFSVVQVI
LS--EE----M-------RVVS-TS-TIGLNLSE-----TSVHD--SHLKT---------
--------------------KVFIPKTGH--------------TGFVVIGQSVILL----
---------------SLPSFDNSPTQQLLM--DSDRIPPPFLDQILFRSGD----DYKIL
ASGFEN------PP-------------QLDPGPTCLIMVRNFGIIRITITSRQEN-----
------------------------------------------------------------
EDGIDDAHVTAKTKLEQAVFYGTKLGN-PLNLSD--------------------------
------KGGL--DFPLNEIEQAALDICKELLRSTS--S----YIP-TTSVTLDQNLRLRS
KALED-------------------------------------------------------
------------------------------------LAALLLRHH--KNLRRQTR-----
--------------------------Y---ELLWSAEKLAAQKALWKVEDVSRRAKGQ--
-------------GHTF------------------LAHVIRSMNEKFKTK------TKSQ
TGDADE-----VRDWFLYDTFRMEHIVPWIFKAIKPQRSHSANN-CR-------------
-----------------IMTEEIVEASELSLAVLETAFHYR----DGHARQYG-----LV
-ID--CIE-DGVSTADYGGLP---------------EFWTSEG-IIYIETGHLLDLELET
CRAWIQQTT-PSLEL------------------------PEHQALRR-IAENSARQLRVL
SLVHCER-VRW-LSVQDD------------------------------------------
-------------------------------------------------------PKLVD
ESIAIE-----QAHIQQRRWQLFK----------LAGI----------------------
-----GQLEHAITLAENFRDMSA-------------------------------------
-LVELIIELQDQTL-DS------EDAAESTNRESEQ-------LSK----RISTYFERFG
---ESWADAFFSRQISMGQS-GTLFT-----MRK----FQPFITRFLHKY-PTYARLCWI
NDAIGENNYEVAGRSLESLAVEH-------------------ESDIWSHR-VELSLSKLT
KLAALEGDDGA------NKSI--------LNKEIRRLEDLAEIDAVQEVIYSYVMPALQG
AIDQ---KAEIELAMDQF---GKL--V-VDMPSLREVLCHALTKVINRHIL---------
----------------------------------------TFDEMVNVLTLM-DG-----
---CQVPDDILSEFSSKEFYLALRVIRLASS-QGDPLYQVPFQKLVWRRCMI-RD---DW
QIM-----------------------------------------------REA--EGG--
-VRDE--------------LEDPIYNTALFRTLSLCTK-DRHF---AGTNPPSIYIPSSP
SDVLLSESEVEVILSRF-----------------------------------PLER---R
SRINRDL-SRENEVLHKQITK--------GQLDFWFRRLVASAEE----TAVS-------
TDAVDNLNA-RASDTFEGE-RI-DQKPLATRLQLTW----L
>gi|83769359|dbj|BAE59495.1|	   1258 residues, 50 /line  unnamed protein product [Aspergillus oryzae]
------------------------------------------------------------
------------------------------------------------------------
--------------------MPIRGSKKSER-R-----GEAD-GTIVLIRFADYN--QAS
L-AYFLAIDIVNTN-------------------------------------TDSYKCFFG
AGNC-----YALAMTNSHAIIW--PYSIATSSPSPA------------------DVFTIS
IPEPC-------REPNGPVPLGILLS-----------------SVTAG-LPGLMIITPDT
G--RIIYWETVSCAASLGLARQKQKTIQGSIP-NLLSG--------------------EH
-------------------------------------ITDLVNGEPSGVI-VTLSSGRVA
HITVRDPQGKPTVTVNFLRNTSGLSRIGFFGG-------IRNVL-----GGGFARKDL--
-------------AAVRAGESHQRGQ---RDIIIATSGGLFEIWDTHWNNGII---LK--
RQFD--ITNDLCHHLG-------TGDSNS--------------------SDDSNIEILDF
SLMPAEY-SVRELQASTSVPSWH----------LSLLVTQS------EMGSQSMSLVQVN
LA--EE----V-------HILS-TH-PIDLHGVS-----T---A--LDSKP---------
--------------------RLYLPKPGD--------------TAFVLMGHSVVLL----
---------------SLSLGKDQSAQ--------HQQPRVFQDSISFRSGK----AFEIL
GSGAED------KR-------------DENSCPACLIMVRDFGIIRITALPHHNS-----
------------------------------------------------------------
PPTAECVRITAKQKIEQAIFYGTMLGN-PLNLNN--------------------------
------KSSL--DFSVMDIEQAALEICRELLQSRS--K----FIP-TTAISLEQNLRSRA
KALDD-------------------------------------------------------
------------------------------------LACLLMQQN--KLLGEQIW-----
--------------------------W---ELLWGAEKLAAQRAMWKIEEGSRKLKGK--
-------------GSTF------------------LTHVINSMSDKFKTR------VEKQ
DGEVDP-----VRNWFLHDTFQMEHVVPWIFNAIKPKKGHSSRQ-GR-------------
-----------------KMSEQILEASELSLAVLETAFRFR----DEHASRYG-----IR
-DG--YLE-DGVLVTGFKGLP---------------EFWTSQN-FSYVETGHLLDLELDS
CRAWIQQAT-SVTEA------------------------PESLTVKR-IAGNSARQLCVL
GQMHYER-VRW-LSAQED------------------------------------------
-------------------------------------------------------PKLVD
EGIATE-----QAHVKQRKWRLFK----------LAGI----------------------
-----GRLDDAITLAEKFRDMSA-------------------------------------
-LVELIIELQDQTKGEIL-PSSRNDASDTISCESDH-------LNK----KISLYFEKFG
---ESWANAFFSRQISMRQS-GILFA-----MKK----FQPFITQFLRKD-AAYSRLGWI
NDVIGENDYNAAAQSLEKLAIEG-------------------ESDLWSHR-VELSLAKLA
KLATLEETNIP------SHSG--------FHNDIRHLEDLSEIDAVQELIYAYISPALQG
AIDQ---RAEVDLAIDHF---GKN--IAGDRPSLHELLSETLTKVVTRQII---------
----------------------------------------DIHQLVDILTLI-DS-----
---DKASEYGQSELSGKEFYLALRVIRLGIYAQQDSLNYITMQKLVWRRCMI-KD---NW
VAT-----------------------------------------------GRA--AES--
-MDNG--------------SEPFIYDTALFRTMGLCLR-DRYD---EDASYASLYIPSSP
QDVFLNRSDSELLSTRY-----------------------------------RLEQ---R
TRIIHDL-ERENEILHENVEK--------GRLDFWFKNLLTSAEE----SASI-------
PIPPTFTSEESNNNNQQVK-RSPQPREGSSKARLSW----L
>gi|145256389|ref|XP_001401365.1|	   1340 residues, 50 /line  hypothetical protein An04g00020 [Aspergillus niger]
---------------------------MFVPKA----LSS--AASQRNPRRRQRTN----
----SDESPKPPSAKRQRSNLRQ---NDLVPA-SQILNNNHAKLEFQERQQSTLSNEGVA
ISETAHI----------HRNIPIRAVKRSEKRE-----DEAE-GTVVLLPTLPDQ--VLG
L-Q-------TGER-------------------------------------AGPFRGSFG
TSHG-----YALALTKSHAIVW--AYSNTAPSPSPA------------------DVFTLT
IPESC-------KEPGNTAPLGLLLS-----------------TVAGG-VPGLMVVMPYT
G--KIIYWETISSAATLAFSRQKHSGIQGCVP-GLLSG--------------------EH
-------------------------------------ATDVINSEPSGVV-VLFSTGRVA
HITTRDSQGKPAVTVSFLRSPAGGGRPGLFGS-------LRNAL-----GGGFYRKDI--
-------------ATVRAGESHQRGQ---RDVVIATSLGLFEIWDTHWNNGSI---LK--
HQFD--VYDLLSEALG-------PLIVGQ--------------------ADDYRLKVLDF
VLADCKSTNPRDGP-HSSLV-TA----------VVVSVSQSA-----PGIVRDMFVVQMR
FS--DD----V-------QILS-TN-TIDFHGLR-----T--HL--DLPRV---------
--------------------RLFVPSPGH--------------TAFIVVGQSIVLL----
---------------SLAIPEHLTIAQETV--PITQQERAFKDIIPLRSGE----SYEIL
GSGYEN------QN-------------GEGSLAACLLMVRDFGIIRIAAFPSERT-----
------------------------------------------------------------
KSNVDDGRITAKHKIEQAIFYGTMTKN-PLNLTG--------------------------
------NDGI--GFPINETEDAALEICQELMRSAS--D----FIP-STGISVDQNLKLRA
KALDD-------------------------------------------------------
------------------------------------LALLLTQQN--ETIRREVW-----
--------------------------W---QLLWSAEKLAAQRAMWKLEDEARKCASK--
-------------NSTL------------------LAHIIGLMSEKFKTK------IEEQ
TGECDP-----VRHWFLYDTFQMEHIVPWVFHAIKPQKGSSSKP-GR-------------
-----------------RMSEQLLEASDLSLAVLETAFRYR----DENSSRYG-----IG
-DG--YLE-NGILTGDYTGLS---------------EFWTSQR-YCYIEFGHLLDLELDS
CRAWIQKTT-IGVEL------------------------PETQTVRR-IARNSSRQLQIL
GLMHCER-VRW-LSAQEN------------------------------------------
-------------------------------------------------------QKLID
ESIATK-----QAHIKQRKWQLFK----------LAGI----------------------
-----GHLDDAIMLAEQFRDMGA-------------------------------------
-LVELIIELQDQTKSLVTHQDSPNKNAGADENASER-------LSQ----KISFYFEKFG
---ESWADSFFSRQISMGQS-GILFA-----MKK----FQPFVTRFLRKH-PAYLRLGWI
NDVIGENDYEGAARSLEKLATKH-------------------ESDIWSHR-VELSLAKLA
NLAVWEESRMP------DSLV--------VRRNVRRLEDLAEVDAVQEVIFAYVSPALHS
AIDQ---KAEIDIAIEQF---RNP--AAADRPSLHEIFSEALAKIVTRQVL---------
----------------------------------------DSDELVDLLTHI-YL-----
---SQASEQGQDEIVGKQFYLALRIIRLSY-DQRDPQYHAALQKLVWRRCMI-DN---NW
ERM-----------------------------------------------EEA--AEG--
-LGMD--------------TESFLYATTLSRTLCWCLR-DGLD---EDSNYPSIYVPNGP
HDVLLSESDADLITTRF-----------------------------------PPER---R
ARISRDL-ARENEILLQQIEK--------GKLDFWFKNLFDSAKA----TRQG-------
PSGLSA----DDDKNGTAH-NETQHDLSTDKAQLSW----L
>gi|67528174|ref|XP_661897.1|	   1293 residues, 50 /line  hypothetical protein AN4293.2 [Aspergillus nidulans FGSC A4]
---------------------------MFVPKA-----GS--ATTLRNPRRRQRTS----
----SGESIKAPSAKRQRSILSQ---DDNPDT-GIPTYGAPNHRS-SIPTA--TTEVDST
PAPGGEN----------QKNIPIRTFNATEKRK-----SDVL-GPIILYLNCHVY--LTK
-----------SET-------------------------------------SVQKIADVL
SPPAMGMGLLSLNSRPSFGRIP--PWSHR-------------------------------
-PYLP-------MDASDVSPLGVILS-----------------TATSS-TPGLMILMPHN
G--RIIYWETVSCAASLSLPRQKQTGLQGYVP-GMLSG--------------------EC
-------------------------------------ATDIVNAEPSGVI-VTFSTGRVA
HITLRDSQGKPAVTVNFLKNPHSTGGIGFLDG-------IKNVF-----GAGYWRKKV--
-------------AAVRAGESFQRGQ---RDIIIATSAGLVEVWDTHWNNGSI---LK--
NQYD--VKEDLLAATR-------K---DE--------------------ASDYEVKIWDL
AVVTSSCEDSSNP--------WE----------ISVLVGLFS-----GVTIQGVFVTRLR
LT--DG----A-------RVLS-TN-PISLHTFP-----T--DS--LHLEP---------
--------------------RLFIPKPHE--------------TAFIVIGQSIILL----
---------------SLTDAEGTSSSQLLI--DNGQ-PRTFHDSINFRSGQ----AYEIL
GSGFED------QS-------------EEYANPSCLLMIREFGVVRITALPRQET-----
------------------------------------------------------------
---AETARISAQHKLEQAVFYGTMLGN-PLNLSS--------------------------
------KGDL--DFPVPEIEQATLAICQGLLRSTS--K----FIP-SAAISIDQNLKLRS
KALDD-------------------------------------------------------
------------------------------------LSRILLDQN--KIIDRRIW-----
--------------------------W---ELLWGAEKLAAQRAIWRLEASARKRNSS--
-------------GATF------------------LAHVLGLMNEKFKTK------LDDT
D---DP-----IRQWFLFDSYRMEHIVPWIFHAIKPQKGNTSKQ-MR-------------
-----------------RMSEQILEAGELSLAVLETAFRYR----DEHASQFG-----IG
-DG--YLE-EGVLTTNYEGLP---------------EFWTSQS-ISYSEIGHLLDLELDS
CRA-IQQTS-TSSDG------------------------GDQQISAK-IARNSARHLRIM
GQMYSER-IRW-LSAQED------------------------------------------
-------------------------------------------------------QKLID
EASATK-----QSHIKQRRWQLFK----------LAGI----------------------
-----GQLNEAIELAESFQDMSA-------------------------------------
-LVELIIELQDQNKVVFTNVDTPD---------GIE-------LDR----KISLYFEKFG
---DAWADAFFGRQISMGQP-GILFS-----AKK----FQSFVTRFLHKH-QPYARLSWI
NDVIGEADYECAAKTLEHLALEQ-------------------EQDVWGHR-VKLALAKLS
HLARWEKDAPS------DTRA--------LQNDIKRLEGLAEMGAVQEVIYSYVSPVLRD
AIDQ---KAEIDLAIDHF---AKS--TAQKLPSLHELLKEALTGVVTRKML---------
----------------------------------------SLDQLVDVLTLI-DP-----
---SQDPDIGQNDFSGDEFHLALRVIRLGHNAQGDPNYSLALQKLVWRRCII-RD---KW
DAT-----------------------------------------------GGT--AEQ--
-MGSE--------------TESPLTATALSRTLALCLN-DR-----TDPSKPPLYRPTRP
QDVLLNDSDSALISSRF-----------------------------------RPEQ---R
ARIIRDL-ERENSTLLRYIEK--------SELECWFKSLLSSAEK----ERTS-------
DDALQT----P----CSMD-AESSLSQTNRKERLSW----L


Ad blocker interference detected!


Wikia is a free-to-use site that makes money from advertising. We have a modified experience for viewers using ad blockers

Wikia is not accessible if you’ve made further modifications. Remove the custom ad blocker rule(s) and the page will load as expected.