Fandom

Proteins Wiki

At2g05070.1/MSA

< At2g05070.1

47,922pages on
this wiki
Add New Page
Talk0 Share
>gi|15224465|ref|NP_178582.1|	   265 residues, 50 /line  LHCB2.2 (Photosystem II light harvesting complex gene 2.2); chlorophyll binding [Arabidopsis thaliana]
---MATSAIQQSSFAGQTA--LKPSSDLIQKV---------------GVLGGGRVTMRRT
VK-----STPQSIWYGPDRPKYLGPFS-ENTPSYLTGEYPGDYGWDTAGLSADPETFAKN
RELEVIHSRWAMLGALGCTFPEILSK-NGVKFGEAVWFKAGSQIFSEGGLDYLGNPNLIH
AQSILAIWAVQVVLMGFIEGYRIGGGP---LG--EGLDPLYPGGA-FDPLNLAEDPEAFS
ELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIENLFDHLADPVANNAWSYATN------F
VPG-K
>gi|115453971|ref|NP_001050586.1|	   263 residues, 50 /line  Os03g0592500 [Oryza sativa (japonica cultivar-group)]
-M-AASALHQTTSFLGTAP--RR--DELVRRV---------------GD-SGGRITMRRT
VK-----SAPQSIWYGPDRPKYLGPFS-EQTPSYLTGEFPGDYGWDTAGLSADPETFARN
RELEVIHSRWAMLGALGCVFPEILSK-NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLVH
AQSILAIWAVQVVLMGFVEGYRVGGGP---LG--EGLDKVYPGGA-FDPLGLADDPDTFA
ELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIENLFDHVADPVANNAWAYATN------F
VPG-K
>gi|115472785|ref|NP_001059991.1|	   266 residues, 50 /line  Os07g0562700 [Oryza sativa (japonica cultivar-group)]
-MASTIMAPTSRVLAAKTP----FL-GHPRPSNA-PVRDIAAAAT---------------
----GRITMSKELWYGPDRVKYLGPFS-AQTPSYLRGEFPGDYGWDTAGLSADPEAFARN
RALEVIHGRWAMLGALGCITPEVLEKWVRVDFKEPVWFKAGAQIFSDGGLDYLGNPNLVH
AQSILAVLGFQVVLMGLVEGYRINGLPG--VG--DGND-LYPGGQYFDPLGLADDPVTFA
ELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLLDHLADPVANNAWVYATK------F
TPG-S
>gi|115793|sp|P27523|CB23_HORVU	   268 residues, 50 /line  Chlorophyll a-b binding protein of LHCII type III, chloroplast precursor (CAB)
-MASTIMAAASRAVVAKTP----FLSGQGRAASASPLRDIAAATN---------------
----GRITMGNDLWYGPDRVKYLGPFS-AQTPSYLNGEFPGDYGWDTAGLSADPEAFARN
RALEVIHGRWAMLGALGCVFPEVLQKWVGVEFKEPVWFKAGSQIFSEGGLDYLGNPNLVH
AQSILAVLGFQVLLMGLVEGFRINGLDG--VG--EGND-LYPGGQYFDPLGLADDPVTFA
ELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLFDHLDDPVANNAWVFATK------F
APG-S
>gi|115794|sp|P27489|CB23_SOLLC	   265 residues, 50 /line  Chlorophyll a-b binding protein 13, chloroplast precursor (LHCII type III CAB-13)
-MASMAATASSTTVVKATP----FL---GQTKNANPLRDVVAMGS---------------
----ARFTMSNDLWYGPDRVKYLGPFS-AQTPSYLNGEFPGDYGWDTAGLSADPEAFAKN
RALEVIHGRWAMLGALGCIFPEVLEKWVKVDFKEPVWFKAGSQIFSDGGLDYLGNPNLVH
AQSILAVLGFQVVLMGLVEGFRINGLPG--VG--EGND-LYPGGQYFDPLGLADDPTTFA
ELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLLDHLDNPVANNAWVYATK------F
VPG-A
>gi|15239602|ref|NP_200238.1|	   265 residues, 50 /line  LHCB3 (LIGHT-HARVESTING CHLOROPHYLL BINDING PROTEIN 3) [Arabidopsis thaliana]
-MASTFTS--SSSVLTPTT----FL-GQTKASSFNPLRDVVSLGS---------------
----PKYTMGNDLWYGPDRVKYLGPFS-VQTPSYLTGEFPGDYGWDTAGLSADPEAFAKN
RALEVIHGRWAMLGAFGCITPEVLQKWVRVDFKEPVWFKAGSQIFSEGGLDYLGNPNLVH
AQSILAVLGFQVILMGLVEGFRINGLDG--VG--EGND-LYPGGQYFDPLGLADDPVTFA
ELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLLDHLDNPVANNAWAFATK------F
APG-A
>gi|115826|sp|P22686|CB2_CHLMO	   256 residues, 50 /line  Chlorophyll a-b binding protein of LHCII type I, chloroplast precursor (CAB) (LHCP)
-MAFALISNRALTVKVE-----AAKK------------------------AAGTKQTK-A
----APAKSAGIEWYGPDRAKWLGPFST-NTPAYLTGEFPGDYGWDTAGLSADPETFKKY
RELEVIHARWALLGALGILTPELLSTYAGVKFGEPVWFKAGAQIFSEGGLDYLGSPALIH
AQNIVATLAVQVVLMGLIEGYRVNGGP---AG--EGLDPLYPGES-FDPLGLADDPDTFA
ELKVKEIKNGRLAMFSCFGFFVQAIVTGKGPIQNLADHLADPGTNNAFAAATK------F
TPS-A
>gi|87313235|gb|ABD37914.1|	   254 residues, 50 /line  light-harvesting chlorophyll-a/b binding protein LhcbM9 [Chlamydomonas incerta]
-MAFALASSRKALSVVA-----ASKK------------------------TAPAKKAA--
-----APKSSGVEFYGPNRAKWLGPYSENATPAYLTGEFPGDYGWDTAGLSADPETFKRY
RELELIHARWAMLGALGCLTPELLAK-NGTKFGEAVWFKAGAQIFSEGGLDYLGNPSLVH
AQNIVATLACQVILMGLIEGYRVNGGP---AG--EGLDPLYPGES-FDPLGLADDPDTFA
ELKVKELKNGRLAMFSMFGFFVQAIVTGKGPVQNLDDHLANPTVNNAFAFATK------F
TPS-A
>gi|19423285|gb|AAL88456.1|AF479777_1	   256 residues, 50 /line  major light-harvesting complex II protein m10 [Chlamydomonas reinhardtii]
-MAFALAKSSLAPRCLA-----STVK------------------------VEARRTVKPA
----SKASTPDSFWYGPERPLFLGAFT-GEPPSYLTGEFPGDYGWDTAGLSADPETFKRY
RELELIHARWAMLGALGCITPELLAK-SGTQFGEAVWFKAGAQIFSEGGLDYLGNPSLVH
AQNIVATLAVQVILMGLVEGYRVNGGP---AG--EGLDPLYPGES-FDPLGLADDPDTFA
ELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPIQNLDDHLSNPTVNNAFAFATK------F
TPS-A
>gi|115771|sp|P12329|CB21_MAIZE	   262 residues, 50 /line  Chlorophyll a-b binding protein 1, chloroplast precursor (LHCII type I CAB-1) (LHCP)
-MAASTMAISSTAMAGTP-----------IKV---------------GSFGEGRITMRKT
VGK-PKVAASGSPWYGPDRVKYLGPFS-GEPPSYLTGEFPGDYGWDTAGLSADPETFAKN
RELEVIHSRWAMLGALGCVFPELLSR-NGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLIH
AQSILAIWACQVVLMGAVEGYRIAGGP---LG--EVVDPLYPGGS-FDPLGLADDPEAFA
ELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHIADPVNNNAWAYATN------F
VPG-N
>gi|115799|sp|P15195|CB23_POLMU	   265 residues, 50 /line  Chlorophyll a-b binding protein type 1 member F3, chloroplast precursor (Chlorophyll a-b binding protein type I F3) (CAB-F3) (LHCP)
-MATSTAALTSTFSGQQLK----PVNELSRKV---------------GA-GEARVQMMAP
KSK----APSGSIWYGSDRPLYLGPFS-GSPPSYLSGEFPGDYGWDTAGLSADPETFAKN
RELEVIHSRWAMLGALGCVTPELLAK-NGVKFGEAVWFKAGSQIFAEGGLDYLGNPSLVH
AQSILAIWACQVILMGAVEGYRVAGGP---LG--EVEDPIYPGGS-FDPLGLADDPEAFA
ELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIENLSDHLADPAVNNAWAYATN------F
TPG-K
>gi|693916|gb|AAA80591.1|	   265 residues, 50 /line  chlorophyll a/b binding protein
-MAAATMALSSPSFAGQAV----KLSPSASEI-----------------SGNGRITMRKA
V---AKSAPSSSPWYGPDRVKYLGPFS-GESPSYLTGEFPGDYGWDTAGLSADPETFAKN
RELEVIHCRWAMLGALGCVFPELLSR-NGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVH
AQSILAIWACQVVLMGAVEGYRIAGGP---LG--EVVDPLYPGGS-FDPLGLAEDPEAFA
ELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAFATN------F
VPG-K
>gi|14041685|emb|CAC38830.1|	   274 residues, 50 /line  chlorophyll a/b binding protein [Pinus contorta]
---MASCGIGSCAFAGGQISSLKPHTNQLLGVGA-------------GVHGEARVTMRKA
ATKKVSVSASTSPWYGPDRVLYLGPFS-GEPPSYLTGEFPGDYGWDTAGLSADPETFAKN
RELEVIHSRWAMLGALGCVFPELLAR-NGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLVH
AQSILAIWACQVILMGAVEGYRIAGGP---LG--EVTDPIYPGGS-FDPLGLADDPDAFA
ELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPIENLADHLADPVSNNAWAYATN------F
VPG-K
>gi|3417451|dbj|BAA32346.1|	   266 residues, 50 /line  light-harvesting chlorophyll a/b-binding protein of photosystem II [Cryptomeria japonica]
--MAAMAKLSSPAFAGQMV--NGDFARQLRALNV-----------------GERVNMRRG
AT---KAPVSSSPWYGPDRVKYLGPFS-GEPPSYLTGEFPVTTGGTPPVCQPDPETFAKN
RELEVIHARWAMLGALGCVFPELLSR-NGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVH
AQSILAIWACQVILMGAVEGYRVAGGP---LG--EITDPLYPGGS-FDPLGLADDPEAFA
ELKVKEIKNGRLAMFSMFGFYVQAIVTGKGPLENLADHLADPVNNNAWAYATN------F
VPG-K
>gi|349443|gb|AAA60965.1|	   270 residues, 50 /line  light-harvesting chlorophyll a/b binding protein of photosystem II
MATMASAGVASSAFAGQIV--LKPQNEFVGGVH-----------------GEGRITMRKT
ASKK-VVASSGSPWYGPDRVKYLGPFS-GEAPSYLTGEFPGDYGWDTAGLSADPETFAKN
RELEVIHSRWAMLGALGCVFPELLSR-NGVKFGEAVWFKAGSQIFSDGGLDYLGNPSLIH
AQSILAIWACQVILMGAVEGYRIAGGP---LG--EITDPIYPGGS-FDPLGLADDPDAFA
ELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIENLADHLADPVNNNAWAFATN------F
VPG-K
>gi|4757371|dbj|BAA77273.1|	   268 residues, 50 /line  chlorophyll a/b-binding protein precursor [Physcomitrella patens]
-MATAATAMNSTVLAGQAL--LKPVSELSRKVNA----------------GEARVTMRKT
VSK---SSGSDSIWYGADRPKFLGPFS-GETPSYLNGEFAGDYGWDTAGLSSDPETFARN
RELEVIHARWAMLGALGCLTPELLAK-SGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLVH
AQSILAIWACQVILMGAVEGYRVAGGP---LG--DVTDPIYPGGS-FDPLGLADDPDTFA
ELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLNDHLADPVANNAWAYATN------F
VPG-N
>gi|20269804|gb|AAM18057.1|AF495473_1	   256 residues, 50 /line  major light-harvesting complex II protein m1 [Chlamydomonas reinhardtii]
-MAFALAKSSARAAVSRRS----------------------------TVKVEARRTVKPA
----SKASTPDSFWYGPERPLFLGAFT-GEPPSYLTGEFPGDYGWDTAGLSADPETFKRY
RELELIHARWAMLGALGCIFPELLGSY-GVPFGEAVWFKAGAQIFQEGGLDYLGNPNLVH
AQSILAILGTQVLLMGAIEGYRVNGGP---LG--EGLDKLYPGGS-FDPLGLADDPDTFA
ELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLQNLSDHLANPGTNNAFAYATK------F
TP--Q
>gi|3928891|gb|AAC79711.1|	   251 residues, 50 /line  chlorophyll a/b binding protein [Acetabularia acetabulum]
-MSFAVQSVLVGA----------TAKTALV------------KGNKR-------------
-----VSVQAAVEWYGPDRAKWLGPYSDGAVPSYLTGEFPGDYGWDTAGLSADPETFKKY
RETELIHARWAMLGALGCVTPEILAKYGGTSFGESVWFRAGAQIFKDGGLDYLGSPALIH
AQSIGAIVISQVILMGLIEGYRVNGGP---AG--EGLDPLYPGES-FDPLGLADDPDTFA
ELKIKEIKNGRLAMFSMFGFYVQAIVTGKGPVENWAEHIADPFTANAFSYATK------F
TPT-A
>gi|87313205|gb|ABD37899.1|	   249 residues, 50 /line  light-harvesting chlorophyll-a/b binding protein LhcbM2 [Scenedesmus obliquus]
-MAFALKQA---V----------ATKAAAT------------RATR--------------
-----QVTRAAIEWYGPDRPKFLGPFSEGDTPAYLTGEFAGDYGWDTAGLSADPQTFAKY
REIEVIHARWAMLGALGCITPELLAK-NGVPFGEAVWFKAGAQIFQDGGLNYLGNENLVH
AQSILATLAVQVLLMGAAESYRANGGAPGGFG--EDLDSLYPGGA-FDPLGLADDPDTLA
ELKVKEIKNGRLAMFSMFGFFVQAIVTGQGPIANLDAHLSDPSGNNAWNYATK------F
VPG-N
>gi|87313177|gb|ABD37885.1|	   267 residues, 50 /line  light-harvesting chlorophyll-a/b binding protein LhcbM1 [Mesostigma viride]
-MAAALASSTFLGAAVVA----PAQKVEAKKINT-----VVEARRT--------------
-----KSATPDSPFYGPDRVTFLGPFT--DVPSYLTGEYPGDYGWDTVGLSADPETFAAY
REIELMHARWAMLGTLGCFLPEALEKYSGINFGESVWFKAGGQIFQEGGLDYLGNPSLVH
AQSIIATVFIQALLMGLVEGYRVGGGP---LG--EAGDKMYPGGS-FDPLGLGDDPDTLA
ELKVKEIKNGRLAMFSMFGYFIQAIVTGKGPVENLDAHLADPFVNNGFAYATSSGLVGLI
NKS-V
>gi|115831|sp|P15773|CB2_MALDO	   268 residues, 50 /line  Chlorophyll a-b binding protein AB10, chloroplast precursor (LHCII type I CAB-AB10) (LHCP)
-MYIPRLSVSICLHPLLIYKIAKPSKLNPI------------SS---TLIVTAGFTMLKH
-----AAKSKVSSSTCDRRVKYLGPFS-GEWPSYLTGEFPGDYGWDTAGLSAYPETFAKN
RELEVIHSRCAMSAALGCIFPELLSV-MGQGFGEAVWFKAGAQIFSEGGLDYLGNPSLVH
AQSILAIWTTKVILMGAVEGYRIARGP---LG--EVTDPLYPG-S-FDSLGLAEDTEAFA
ELKVKELKNGRLAMFSMFGFFVQAIVSRKDRLENLADHLGWTVNNNALSNVTN------F
VPG-N
>gi|19749357|gb|AAD03732.2|	   268 residues, 50 /line  light harvesting complex II protein precursor [Chlamydomonas reinhardtii]
---MMLSRTVVNVQAKLTKKGGAPKKAAPA------------SAQKKTIREKAGW--WSN
-----GGNEKLSAFYGPDRGLWLGPLS-GTTPAYLTGEFPGDYGWDSAGLSADPETFKRY
RELELIHARWAMLGALGCITPELLAK-NGTPIVEPVWFKAGAQIFAEGGLDYLGNPGLVH
AQSILATLAVQVILMGAIEGYRVNGGP---AG--EGLDKLHPGGQFFDPLGLAEDPDAFA
ELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLANLDEHLASPFTSNAFTYAQK------F
TP--Q
>gi|2407314|gb|AAB70556.1|	   251 residues, 50 /line  chlorophyll a/b binding protein [Tetraselmis sp. RG-15]
-MAAVAARSFA--------ATVAGQVGASA------------RGQKQVT-----------
--------RAAVEFYGPDRAKWLGPFS-DDTPSYLTGEFPGDYGWDTAGLSADPETFASY
RELELIHARWAMLGALGCVTPELLSKYAGVEFGEAVWFKAGAQIFADGGLDYLGNSSLVH
AQSILAILGCQVVLMGGAEAFRVNGGP---LG--EDLDKLHPGGA-FDPLGLADDPDTFS
ELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPVENWAEHIADPSGSNGFVYATK------F
VPG-N
>gi|87313209|gb|ABD37901.1|	   255 residues, 50 /line  light-harvesting chlorophyll-a/b binding protein LhcbM4 [Scenedesmus obliquus]
-MAFAVASRRSSVLVQA------------------------------KKGGKAKAPAKRA
----AAAPSKGTEFYGPNRAKWLGPFS-TATPGYLTGEFAGDYGWDTAGLSADPETFRRY
RELELIHARWAMLGALGCITPELLAK-NGVPFGEAVWFKAGAQIFQEGGLNYLGNSSLIH
AQSILATLACQVILMGLVEGYRVNGGP---AG--EGLDPLYPGEA-FDPLGLADDPDTFA
ELKVKEIKNGRLAMFSMFGFFVQAIVTGQGPIANLDAHLSDPSGNNAWNYATK------F
VPG-N
>gi|90191869|gb|ABD91646.1|	   253 residues, 50 /line  major light-harvesting chlorophyll a/b protein  2.1 [Dunaliella salina]
-MAALIARSG-----------LKALNIR-------------------------QTRQQRM
----ATVPRAAVEFYGPDRAKFLGPFSENDTPEYLTGEFPGDYGWDTAGLSADPQTFARY
REIELIHARWALLGALGILTPELLSQYAGVQFGEPVWFKAGAQIFADGGLNYLGNESLIH
AQSIIATLAVQVVLMGLAEAYRANGGS---EGFLDDLDTLYPGGP-FDPLGLADDPDTFA
ELKVKEIKNGRLAMFSCLGFFVQAIVTGKGPVQNLTDHLADPTVNNAFASATK------F
TPG-V
>gi|145079054|tpg|DAA05896.1|	   255 residues, 50 /line  TPA_inf: chloroplast light-harvesting complex II protein precursor Lhcbm13 [Acetabularia acetabulum]
-MSVVSAKTFVGTQVAS-----KKMVTSMR------------RTQKK-------------
------GSAPDSVWYGPDRPQFLGPFS-GDTPSYLTGEFPGDYGWDTAGLSADPETFRRY
RELELIHARWAMLGALGCVTPEILSKYGGVSFGESVWFKAGSQIFQEGGLDYLGNANLVH
AQSILAILGCQVVLMGAIEAYRVNGGP---LG--EGLDPLYPGDK-FDPLGLADDPDTFA
ELKIKEIKNGRLAMFSMFGFFVQAVVTGKGPIENWAEHVADPFSVNAWNYATK------F
VPGGY
>gi|145079118|tpg|DAA05899.1|	   229 residues, 50 /line  TPA_inf: chloroplast light-harvesting complex II protein precursor Lhcbm9 [Acetabularia acetabulum]
-------------------------------------------SVRN-------------
------VSRNAIEWYGPDRPKWLGPFSEGDVPSYLTGEFPGDYGWDTAGLSADPETFKAY
REQELIHARWAMLGALGCVTPEILAKYAGVSCGESVWFKAGSQIFQEGGLDYLGNPSLVH
AQSILAILGCQVVLMGLIEAYRVNGGP---LG--EGLDPLHPGDK-FDPLGLADDPDTFA
ELKVKEIKNGRLAMFSMFGFYVQAIVTGKGPIENWADHVADPFNVTAWNYATK------F
VP--Q
>gi|145079253|tpg|DAA05906.1|	   220 residues, 50 /line  TPA_inf: chloroplast light-harvesting complex II protein precursor Lhcbm8 [Acetabularia acetabulum]
----------MQTAVVV-----NSAVLAQT------------KSIRN-------------
------VSRNAVEWYGPDRAKWLGPFSEGDVPSYLTGEFPGDYGWDTAGLSADPETFKAY
REQELIHARWAMLGALGCVTPEILSKYGGVSFGESVWFKAGSQIFQEGGLDYLGNSNLIH
AQSILAILGCQVVLMGLIEAYRVNGGP---LG--EGLDPLHPGDK-FDPLGLADDPDTFA
ELKVKEIKNGRLAMFSMFGFYVQAIVTGKGPI----------------------------
-----
>gi|87313227|gb|ABD37910.1|	   246 residues, 50 /line  light-harvesting chlorophyll-a/b binding protein LhcbM2a [Chlamydomonas incerta]
-----IMKSAVRS---------SVRPTVSG------------RSARV-------------
------VPRAAIEWYGPDRPKFLGPFSEGDTPAYLTGEFPGDYGWDTAGLSADPETFKRY
RELELIHARWAMLGALGCITPELLAK-NGIPFGEAVWFKAGSQIFAEGGLNYLGNENLVH
AQSIIATLAFQVVVMGLAEAYRANGGP---LG--EGLDPLHPGGA-FDPLGLADDPDTFA
ELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPIQNLDDHLANPTAVNAFAYATK------F
TPS-A
>gi|125620170|gb|ABN46977.1|	   269 residues, 50 /line  chlorophyll a/b-binding protein [Nelumbo nucifera]
MAASVIMTLSSPSLAGKAL----KLTGFTSK-----------------NLGEGGFTMRST
LSR-PRQSITGGPWYGPDRVKYMGPFS-GQTPSYLTGEFPGDYGWDSAGLSAEPETFAKN
RELEVIHARWAMLGTVGCIVPELLER-NGVKIGEAVWFKAGSQIFRDEGLNYLGDPKLIH
AQNILAVLAAQVILMGAIEGYRISGGP---LG--EPTDPLYPGGN-FDPLHLADDPEEFA
ILKVKEIKNGRLAMFAMLGFYVQAIVTGKGPLENLYDHLADPFKNNAWAFATA------F
DPSNS

Ad blocker interference detected!


Wikia is a free-to-use site that makes money from advertising. We have a modified experience for viewers using ad blockers

Wikia is not accessible if you’ve made further modifications. Remove the custom ad blocker rule(s) and the page will load as expected.