Fandom

Proteins Wiki

At2g04842.1/PDB

< At2g04842.1

47,923pages on
this wiki
Add New Page
Talk0 Share
&&&&&&&&&&&&&&&&&&&& BEGIN  /usr/local/www/html/proteins/Compiled_Programs/WYRM/PyMOL_highlight_conserved_residues &&&&&&&&&&&&&&&&&&&&

Successfully read 2 file paths from WYRM_file_paths.txt

generic_input                                         /usr/local/www/html/proteins/workspace/
generic_output                                        /usr/local/www/html/proteins/htdocs/results/

======================================================

Sequence file type = 3

Sequence type = 3

Got here 1
Got here 2
Got here 3
Sequence 1
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Sequence 2
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Read 2 amino_acid sequences from PIR Sequence file /usr/local/www/html/proteins/workspace/At2g04842-1qf6_A.pir.txt

======================================================

Assigned types to 650 residues in Sequence 2-4842, 6 remain unknown
Assigned types to 630 residues in Sequence 1qf6_A, 26 remain unknown

======================================================

Successfully read 576 entries for residue match scoring matrix /usr/local/www/html/proteins/workspace/BLOSUM62.dat

Read the residue match scoring matrix /usr/local/www/html/proteins/workspace/BLOSUM62.dat

======================================================

Error in function WYRM_analyze_conservation_in_sequence_alignment()
Path index 33  All residues are positively and negatively charged

Error in function WYRM_analyze_conservation_in_sequence_alignment()
Path index 34  All residues are positively and negatively charged

Error in function WYRM_analyze_conservation_in_sequence_alignment()
Path index 35  All residues are positively and negatively charged

Error in function WYRM_analyze_conservation_in_sequence_alignment()
Path index 124  All residues are positively and negatively charged

Error in function WYRM_analyze_conservation_in_sequence_alignment()
Path index 177  All residues are positively and negatively charged

Error in function WYRM_analyze_conservation_in_sequence_alignment()
Path index 593  All residues are positively and negatively charged

Translated sequence file At2g04842-1qf6_A.pir.txt into sequence alignment.

======================================================

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

>1QF6.pdb  Made from 6667 ATOM records in 1QF6.pdb
PVITLPDGSQRHYDHAVSPMDVALDIGPGLAKACIAGRVNGELVDACDLI
ENDAQLSIITAKDEEGLEIIRHSCAHLLGHAIKQLWPHTKMAIGPVIDNG
FYYDVDLDRTLTQEDVEALEKRMHELAEKNYDVIKKKVSWHEARETFANR
GESYKVSILDENIAHDDKPGLYFHEEYVDMCRGPHVPNMRFCHHFKLMKT
AGAYWRGDSNNKMLQRIYGTAWADKKALNAYLQRLEEAAKRDHRKIGKQL
DLYHMQEEAPGMVFWHNDGWTIFRELEVFVRSKLKEYQYQEVKGPFMMDR
VLWEKTGHWDNYKDAMFTTSSENREYCIKPMNCPGHVQIFNQGLKSYRDL
PLRMAEFGSCHRNEPSGSLHGLMRVRGFTQDDAHIFCTEEQIRDEVNGCI
RLVYDMYSTFGFEKIVVKLSTRPEKRIGSDEMWDRAEADLAVALEENNIP
FEYQLGEGAFYGPKIEFTLYDCLDRAWQCGTVQLDFSLPSRLSASYVGED
NERKVPVMIHRAILGSMERFIGILTEEFAGFFPTWLAPVQVVIMNITDSQ
SEYVNELTQKLSNAGIRVKADLRNEKIGFKIREHTLRRVPYMLVCGDKEV
ESGKVAVRTRRGKDLGSMDVNEVIEKLQQEIRSRSLKQLEEXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXX

======================================================

Best alignment:
1QF6.pdb    70  IRHSCAHLLGHAIKQLWPHTKMAIGPVIDNGFYYDVDLDRTLTQEDVEAL   119
                IRH+CAH++  A+++L+P  K+ IGP IDNGFYYD D++  LT +D++ +
2-4842      82  IRHTCAHVMAMAVQKLFPDAKVTIGPWIDNGFYYDFDME-PLTDKDLKRI   130

1QF6.pdb   120  EKRMHELAEKNYDVIKKKVSWHEARETFANRGESYKVSILDENIAHDDKP   169
                +K M  +  +N  +++++VS  EA++      E YK+ ILD  I  +   
2-4842     131  KKEMDRIISRNLPLLREEVSREEAKKRIMAINEPYKMEILD-GIKEEPIT   179

1QF6.pdb   170  GLYFHEEYVDMCRGPHVPNM-RFCHH-FKLMKTAGAYWRGDSNNKMLQRI   217
                  +   E+ D+C GPHV    +      +L   AGAYWRGD   +MLQRI
2-4842     180  VYHIGNEWWDLCAGPHVETTGKINKKAVELESVAGAYWRGDEKRQMLQRI   229

1QF6.pdb   218  YGTAWADKKALNAYLQRLEEAAKRDHRKIGKQLDLYHMQEEA-PGMVFWH   266
                YGTAW  ++ L AYL   EEA +RDHR+IG+ LDL+ +Q+EA  G+VFWH
2-4842     230  YGTAWESEEQLKAYLHFKEEAKRRDHRRIGQDLDLFSIQDEAGGGLVFWH   279

1QF6.pdb   267  NDGWTIFRELEVFVRSKLKEYQYQEVKGPFMMDRVLWEKTGHWDNYKDAM   316
                  G  +   +E   +    E+ Y  +  P +    LW+ +GH D Y++ M
2-4842     280  PKGAIVRNIIEESWKKMHVEHGYDLIYTPHVAKADLWKISGHLDFYRENM   329

1QF6.pdb   317  FTTSS-ENREYCIKPMNCPGHVQIFNQGLKSYRDLPLRMAEFGSCHRNEP   365
                +     E+  Y ++PMNCP H+ ++ +  +SYRDLP+R+AE G+ +R E 
2-4842     330  YDQMEIEDELYQLRPMNCPYHILLYQRKRQSYRDLPIRVAELGTVYRYEL   379

1QF6.pdb   366  SGSLHGLMRVRGFTQDDAHIFCTEEQIRDEVNGCIRLVYDMYSTFGFEKI   415
                SGSLHGL RVRGFTQDDAHIFC E+QI+DE+ G + L  ++ S FGF K 
2-4842     380  SGSLHGLFRVRGFTQDDAHIFCLEDQIKDEIRGVLDLTEEILSRFGFNKY   429

1QF6.pdb   416  VVKLSTRPEKRIGSDEMWDRAEADLAVALEENNIPFEYQLGEGAFYGPKI   465
                 V LSTRPEK +G D++W++A   L  AL++    +E   G GAFYGPKI
2-4842     430  EVNLSTRPEKSVGGDDIWEKATCALRDALDDKGWSYEVDEGGGAFYGPKI   479

1QF6.pdb   466  EFTLYDCLDRAWQCGTVQLDFSLPSRLSASYVGEDNERKVPVMIHRAILG   515
                +  + D L R WQC T+Q+DF+LP R   +YV  ++++K P+MIHRA+LG
2-4842     480  DLKIEDALGRKWQCSTIQVDFNLPQRFDITYVDTNSDKKRPIMIHRAVLG   529

1QF6.pdb   516  SMERFIGILTEEFAGFFPTWLAPVQVVIMNITDSQSEYVNELTQKLSNAG   565
                S+ERF G+L E +AG FP WL+PVQV ++ +TD+Q E+  E+++KL   G
2-4842     530  SLERFFGVLIEHYAGDFPLWLSPVQVRVLPVTDNQLEFCKEVSKKLRACG   579

1QF6.pdb   566  IRVKADLRNEKIGFKIREHTLRRVPYMLVCGDKEVESGKVAVRTRRGKDL   615
                +R +     E++   IR    +++P M V G KEVE+G V VR+R G +L
2-4842     580  VRAEL-CHGERLPKLIRNAETQKIPLMAVVGPKEVETGTVTVRSRFGGEL   628

1QF6.pdb   616  GSMDVNEVIEKLQQEIRSRS   635
                G++ V+++I K+   + +R+
2-4842     629  GTIPVDDLINKINIAVETRT   648

======================================================

Highlighted IDENTICAL residue ILE   71  index1   70  path   85  %Seq 100.00
Highlighted IDENTICAL residue ARG   72  index1   71  path   86  %Seq 100.00
Highlighted IDENTICAL residue HIS   73  index1   72  path   87  %Seq 100.00
Highlighted IDENTICAL residue CYS   75  index1   74  path   89  %Seq 100.00
Highlighted IDENTICAL residue ALA   76  index1   75  path   90  %Seq 100.00
Highlighted IDENTICAL residue HIS   77  index1   76  path   91  %Seq 100.00
Highlighted IDENTICAL residue ALA   82  index1   81  path   96  %Seq 100.00
Highlighted IDENTICAL residue LEU   86  index1   85  path  100  %Seq 100.00
Highlighted IDENTICAL residue PRO   88  index1   87  path  102  %Seq 100.00
Highlighted IDENTICAL residue LYS   91  index1   90  path  105  %Seq 100.00
Highlighted IDENTICAL residue ILE   94  index1   93  path  108  %Seq 100.00
Highlighted IDENTICAL residue GLY   95  index1   94  path  109  %Seq 100.00
Highlighted IDENTICAL residue PRO   96  index1   95  path  110  %Seq 100.00
Highlighted IDENTICAL residue ILE   98  index1   97  path  112  %Seq 100.00
Highlighted IDENTICAL residue ASP   99  index1   98  path  113  %Seq 100.00
Highlighted IDENTICAL residue ASN  100  index1   99  path  114  %Seq 100.00
Highlighted IDENTICAL residue GLY  101  index1  100  path  115  %Seq 100.00
Highlighted IDENTICAL residue PHE  102  index1  101  path  116  %Seq 100.00
Highlighted IDENTICAL residue TYR  103  index1  102  path  117  %Seq 100.00
Highlighted IDENTICAL residue TYR  104  index1  103  path  118  %Seq 100.00
Highlighted IDENTICAL residue ASP  105  index1  104  path  119  %Seq 100.00
Highlighted IDENTICAL residue ASP  107  index1  106  path  121  %Seq 100.00
Highlighted IDENTICAL residue LEU  112  index1  111  path  126  %Seq 100.00
Highlighted IDENTICAL residue THR  113  index1  112  path  127  %Seq 100.00
Highlighted IDENTICAL residue ASP  116  index1  115  path  130  %Seq 100.00
Highlighted IDENTICAL residue LYS  122  index1  121  path  136  %Seq 100.00
Highlighted IDENTICAL residue MET  124  index1  123  path  138  %Seq 100.00
Highlighted IDENTICAL residue ASN  131  index1  130  path  145  %Seq 100.00
Highlighted IDENTICAL residue VAL  139  index1  138  path  153  %Seq 100.00
Highlighted IDENTICAL residue SER  140  index1  139  path  154  %Seq 100.00
Highlighted IDENTICAL residue GLU  143  index1  142  path  157  %Seq 100.00
Highlighted IDENTICAL residue ALA  144  index1  143  path  158  %Seq 100.00
Highlighted IDENTICAL residue GLU  153  index1  152  path  167  %Seq 100.00
Highlighted IDENTICAL residue TYR  155  index1  154  path  169  %Seq 100.00
Highlighted IDENTICAL residue LYS  156  index1  155  path  170  %Seq 100.00
Highlighted IDENTICAL residue ILE  159  index1  158  path  173  %Seq 100.00
Highlighted IDENTICAL residue LEU  160  index1  159  path  174  %Seq 100.00
Highlighted IDENTICAL residue ASP  161  index1  160  path  175  %Seq 100.00
Highlighted IDENTICAL residue ILE  164  index1  163  path  178  %Seq 100.00
Highlighted IDENTICAL residue GLU  177  index1  176  path  191  %Seq 100.00
Highlighted IDENTICAL residue ASP  180  index1  179  path  194  %Seq 100.00
Highlighted IDENTICAL residue CYS  182  index1  181  path  196  %Seq 100.00
Highlighted IDENTICAL residue GLY  184  index1  183  path  198  %Seq 100.00
Highlighted IDENTICAL residue PRO  185  index1  184  path  199  %Seq 100.00
Highlighted IDENTICAL residue HIS  186  index1  185  path  200  %Seq 100.00
Highlighted IDENTICAL residue VAL  187  index1  186  path  201  %Seq 100.00
Highlighted IDENTICAL residue CYS  193  index1  192  path  208  %Seq  50.00
Highlighted IDENTICAL residue HIS  194  index1  193  path  209  %Seq  50.00
Highlighted IDENTICAL residue LEU  198  index1  197  path  214  %Seq 100.00
Highlighted IDENTICAL residue ALA  202  index1  201  path  218  %Seq 100.00
Highlighted IDENTICAL residue GLY  203  index1  202  path  219  %Seq 100.00
Highlighted IDENTICAL residue ALA  204  index1  203  path  220  %Seq 100.00
Highlighted IDENTICAL residue TYR  205  index1  204  path  221  %Seq 100.00
Highlighted IDENTICAL residue TRP  206  index1  205  path  222  %Seq 100.00
Highlighted IDENTICAL residue ARG  207  index1  206  path  223  %Seq 100.00
Highlighted IDENTICAL residue GLY  208  index1  207  path  224  %Seq 100.00
Highlighted IDENTICAL residue ASP  209  index1  208  path  225  %Seq 100.00
Highlighted IDENTICAL residue MET  214  index1  213  path  230  %Seq 100.00
Highlighted IDENTICAL residue LEU  215  index1  214  path  231  %Seq 100.00
Highlighted IDENTICAL residue GLN  216  index1  215  path  232  %Seq 100.00
Highlighted IDENTICAL residue ARG  217  index1  216  path  233  %Seq 100.00
Highlighted IDENTICAL residue ILE  218  index1  217  path  234  %Seq 100.00
Highlighted IDENTICAL residue TYR  219  index1  218  path  235  %Seq 100.00
Highlighted IDENTICAL residue GLY  220  index1  219  path  236  %Seq 100.00
Highlighted IDENTICAL residue THR  221  index1  220  path  237  %Seq 100.00
Highlighted IDENTICAL residue ALA  222  index1  221  path  238  %Seq 100.00
Highlighted IDENTICAL residue TRP  223  index1  222  path  239  %Seq 100.00
Highlighted IDENTICAL residue LEU  229  index1  228  path  245  %Seq 100.00
Highlighted IDENTICAL residue ALA  231  index1  230  path  247  %Seq 100.00
Highlighted IDENTICAL residue TYR  232  index1  231  path  248  %Seq 100.00
Highlighted IDENTICAL residue LEU  233  index1  232  path  249  %Seq 100.00
Highlighted IDENTICAL residue GLU  237  index1  236  path  253  %Seq 100.00
Highlighted IDENTICAL residue GLU  238  index1  237  path  254  %Seq 100.00
Highlighted IDENTICAL residue ALA  239  index1  238  path  255  %Seq 100.00
Highlighted IDENTICAL residue ARG  242  index1  241  path  258  %Seq 100.00
Highlighted IDENTICAL residue ASP  243  index1  242  path  259  %Seq 100.00
Highlighted IDENTICAL residue HIS  244  index1  243  path  260  %Seq 100.00
Highlighted IDENTICAL residue ARG  245  index1  244  path  261  %Seq 100.00
Highlighted IDENTICAL residue ILE  247  index1  246  path  263  %Seq 100.00
Highlighted IDENTICAL residue GLY  248  index1  247  path  264  %Seq 100.00
Highlighted IDENTICAL residue LEU  251  index1  250  path  267  %Seq 100.00
Highlighted IDENTICAL residue ASP  252  index1  251  path  268  %Seq 100.00
Highlighted IDENTICAL residue LEU  253  index1  252  path  269  %Seq 100.00
Highlighted IDENTICAL residue GLN  257  index1  256  path  273  %Seq 100.00
Highlighted IDENTICAL residue GLU  259  index1  258  path  275  %Seq  50.00
Highlighted IDENTICAL residue GLY  262  index1  261  path  279  %Seq 100.00
Highlighted IDENTICAL residue VAL  264  index1  263  path  281  %Seq 100.00
Highlighted IDENTICAL residue PHE  265  index1  264  path  282  %Seq 100.00
Highlighted IDENTICAL residue TRP  266  index1  265  path  283  %Seq 100.00
Highlighted IDENTICAL residue HIS  267  index1  266  path  284  %Seq 100.00
Highlighted IDENTICAL residue GLY  270  index1  269  path  287  %Seq 100.00
Highlighted IDENTICAL residue GLU  278  index1  277  path  295  %Seq 100.00
Highlighted IDENTICAL residue GLU  287  index1  286  path  304  %Seq 100.00
Highlighted IDENTICAL residue TYR  290  index1  289  path  307  %Seq 100.00
Highlighted IDENTICAL residue PRO  296  index1  295  path  313  %Seq 100.00
Highlighted IDENTICAL residue LEU  303  index1  302  path  320  %Seq 100.00
Highlighted IDENTICAL residue TRP  304  index1  303  path  321  %Seq 100.00
Highlighted IDENTICAL residue GLY  308  index1  307  path  325  %Seq 100.00
Highlighted IDENTICAL residue HIS  309  index1  308  path  326  %Seq 100.00
Highlighted IDENTICAL residue ASP  311  index1  310  path  328  %Seq 100.00
Highlighted IDENTICAL residue TYR  313  index1  312  path  330  %Seq 100.00
Highlighted IDENTICAL residue MET  317  index1  316  path  334  %Seq 100.00
Highlighted IDENTICAL residue GLU  323  index1  322  path  341  %Seq 100.00
Highlighted IDENTICAL residue TYR  327  index1  326  path  345  %Seq 100.00
Highlighted IDENTICAL residue PRO  331  index1  330  path  349  %Seq 100.00
Highlighted IDENTICAL residue MET  332  index1  331  path  350  %Seq 100.00
Highlighted IDENTICAL residue ASN  333  index1  332  path  351  %Seq 100.00
Highlighted IDENTICAL residue CYS  334  index1  333  path  352  %Seq 100.00
Highlighted IDENTICAL residue PRO  335  index1  334  path  353  %Seq 100.00
Highlighted IDENTICAL residue HIS  337  index1  336  path  355  %Seq 100.00
Highlighted IDENTICAL residue SER  347  index1  346  path  365  %Seq 100.00
Highlighted IDENTICAL residue TYR  348  index1  347  path  366  %Seq 100.00
Highlighted IDENTICAL residue ARG  349  index1  348  path  367  %Seq 100.00
Highlighted IDENTICAL residue ASP  350  index1  349  path  368  %Seq 100.00
Highlighted IDENTICAL residue LEU  351  index1  350  path  369  %Seq 100.00
Highlighted IDENTICAL residue PRO  352  index1  351  path  370  %Seq 100.00
Highlighted IDENTICAL residue ARG  354  index1  353  path  372  %Seq 100.00
Highlighted IDENTICAL residue ALA  356  index1  355  path  374  %Seq 100.00
Highlighted IDENTICAL residue GLU  357  index1  356  path  375  %Seq 100.00
Highlighted IDENTICAL residue GLY  359  index1  358  path  377  %Seq 100.00
Highlighted IDENTICAL residue ARG  363  index1  362  path  381  %Seq 100.00
Highlighted IDENTICAL residue GLU  365  index1  364  path  383  %Seq 100.00
Highlighted IDENTICAL residue SER  367  index1  366  path  385  %Seq 100.00
Highlighted IDENTICAL residue GLY  368  index1  367  path  386  %Seq 100.00
Highlighted IDENTICAL residue SER  369  index1  368  path  387  %Seq 100.00
Highlighted IDENTICAL residue LEU  370  index1  369  path  388  %Seq 100.00
Highlighted IDENTICAL residue HIS  371  index1  370  path  389  %Seq 100.00
Highlighted IDENTICAL residue GLY  372  index1  371  path  390  %Seq 100.00
Highlighted IDENTICAL residue LEU  373  index1  372  path  391  %Seq 100.00
Highlighted IDENTICAL residue ARG  375  index1  374  path  393  %Seq 100.00
Highlighted IDENTICAL residue VAL  376  index1  375  path  394  %Seq 100.00
Highlighted IDENTICAL residue ARG  377  index1  376  path  395  %Seq 100.00
Highlighted IDENTICAL residue GLY  378  index1  377  path  396  %Seq 100.00
Highlighted IDENTICAL residue PHE  379  index1  378  path  397  %Seq 100.00
Highlighted IDENTICAL residue THR  380  index1  379  path  398  %Seq 100.00
Highlighted IDENTICAL residue GLN  381  index1  380  path  399  %Seq 100.00
Highlighted IDENTICAL residue ASP  382  index1  381  path  400  %Seq 100.00
Highlighted IDENTICAL residue ASP  383  index1  382  path  401  %Seq 100.00
Highlighted IDENTICAL residue ALA  384  index1  383  path  402  %Seq 100.00
Highlighted IDENTICAL residue HIS  385  index1  384  path  403  %Seq 100.00
Highlighted IDENTICAL residue ILE  386  index1  385  path  404  %Seq 100.00
Highlighted IDENTICAL residue PHE  387  index1  386  path  405  %Seq 100.00
Highlighted IDENTICAL residue CYS  388  index1  387  path  406  %Seq 100.00
Highlighted IDENTICAL residue GLU  390  index1  389  path  408  %Seq 100.00
Highlighted IDENTICAL residue GLN  392  index1  391  path  410  %Seq 100.00
Highlighted IDENTICAL residue ILE  393  index1  392  path  411  %Seq 100.00
Highlighted IDENTICAL residue ASP  395  index1  394  path  413  %Seq 100.00
Highlighted IDENTICAL residue GLU  396  index1  395  path  414  %Seq 100.00
Highlighted IDENTICAL residue GLY  399  index1  398  path  417  %Seq 100.00
Highlighted IDENTICAL residue LEU  403  index1  402  path  421  %Seq 100.00
Highlighted IDENTICAL residue SER  409  index1  408  path  427  %Seq 100.00
Highlighted IDENTICAL residue PHE  411  index1  410  path  429  %Seq 100.00
Highlighted IDENTICAL residue GLY  412  index1  411  path  430  %Seq 100.00
Highlighted IDENTICAL residue PHE  413  index1  412  path  431  %Seq 100.00
Highlighted IDENTICAL residue LYS  415  index1  414  path  433  %Seq 100.00
Highlighted IDENTICAL residue VAL  418  index1  417  path  436  %Seq 100.00
Highlighted IDENTICAL residue LEU  420  index1  419  path  438  %Seq 100.00
Highlighted IDENTICAL residue SER  421  index1  420  path  439  %Seq 100.00
Highlighted IDENTICAL residue THR  422  index1  421  path  440  %Seq 100.00
Highlighted IDENTICAL residue ARG  423  index1  422  path  441  %Seq 100.00
Highlighted IDENTICAL residue PRO  424  index1  423  path  442  %Seq 100.00
Highlighted IDENTICAL residue GLU  425  index1  424  path  443  %Seq 100.00
Highlighted IDENTICAL residue LYS  426  index1  425  path  444  %Seq 100.00
Highlighted IDENTICAL residue GLY  429  index1  428  path  447  %Seq 100.00
Highlighted IDENTICAL residue ASP  431  index1  430  path  449  %Seq 100.00
Highlighted IDENTICAL residue TRP  434  index1  433  path  452  %Seq 100.00
Highlighted IDENTICAL residue ALA  437  index1  436  path  455  %Seq 100.00
Highlighted IDENTICAL residue LEU  441  index1  440  path  459  %Seq 100.00
Highlighted IDENTICAL residue ALA  444  index1  443  path  462  %Seq 100.00
Highlighted IDENTICAL residue LEU  445  index1  444  path  463  %Seq 100.00
Highlighted IDENTICAL residue GLU  453  index1  452  path  471  %Seq 100.00
Highlighted IDENTICAL residue GLY  457  index1  456  path  475  %Seq 100.00
Highlighted IDENTICAL residue GLY  459  index1  458  path  477  %Seq 100.00
Highlighted IDENTICAL residue ALA  460  index1  459  path  478  %Seq 100.00
Highlighted IDENTICAL residue PHE  461  index1  460  path  479  %Seq 100.00
Highlighted IDENTICAL residue TYR  462  index1  461  path  480  %Seq 100.00
Highlighted IDENTICAL residue GLY  463  index1  462  path  481  %Seq 100.00
Highlighted IDENTICAL residue PRO  464  index1  463  path  482  %Seq 100.00
Highlighted IDENTICAL residue LYS  465  index1  464  path  483  %Seq 100.00
Highlighted IDENTICAL residue ILE  466  index1  465  path  484  %Seq 100.00
Highlighted IDENTICAL residue ASP  472  index1  471  path  490  %Seq 100.00
Highlighted IDENTICAL residue LEU  474  index1  473  path  492  %Seq 100.00
Highlighted IDENTICAL residue ARG  476  index1  475  path  494  %Seq 100.00
Highlighted IDENTICAL residue TRP  478  index1  477  path  496  %Seq 100.00
Highlighted IDENTICAL residue GLN  479  index1  478  path  497  %Seq 100.00
Highlighted IDENTICAL residue CYS  480  index1  479  path  498  %Seq 100.00
Highlighted IDENTICAL residue THR  482  index1  481  path  500  %Seq 100.00
Highlighted IDENTICAL residue GLN  484  index1  483  path  502  %Seq 100.00
Highlighted IDENTICAL residue ASP  486  index1  485  path  504  %Seq 100.00
Highlighted IDENTICAL residue PHE  487  index1  486  path  505  %Seq 100.00
Highlighted IDENTICAL residue LEU  489  index1  488  path  507  %Seq 100.00
Highlighted IDENTICAL residue PRO  490  index1  489  path  508  %Seq 100.00
Highlighted IDENTICAL residue ARG  492  index1  491  path  510  %Seq 100.00
Highlighted IDENTICAL residue TYR  497  index1  496  path  515  %Seq 100.00
Highlighted IDENTICAL residue VAL  498  index1  497  path  516  %Seq 100.00
Highlighted IDENTICAL residue LYS  505  index1  504  path  523  %Seq 100.00
Highlighted IDENTICAL residue PRO  507  index1  506  path  525  %Seq 100.00
Highlighted IDENTICAL residue MET  509  index1  508  path  527  %Seq 100.00
Highlighted IDENTICAL residue ILE  510  index1  509  path  528  %Seq 100.00
Highlighted IDENTICAL residue HIS  511  index1  510  path  529  %Seq 100.00
Highlighted IDENTICAL residue ARG  512  index1  511  path  530  %Seq 100.00
Highlighted IDENTICAL residue ALA  513  index1  512  path  531  %Seq 100.00
Highlighted IDENTICAL residue LEU  515  index1  514  path  533  %Seq 100.00
Highlighted IDENTICAL residue GLY  516  index1  515  path  534  %Seq 100.00
Highlighted IDENTICAL residue SER  517  index1  516  path  535  %Seq 100.00
Highlighted IDENTICAL residue GLU  519  index1  518  path  537  %Seq 100.00
Highlighted IDENTICAL residue ARG  520  index1  519  path  538  %Seq 100.00
Highlighted IDENTICAL residue PHE  521  index1  520  path  539  %Seq 100.00
Highlighted IDENTICAL residue GLY  523  index1  522  path  541  %Seq 100.00
Highlighted IDENTICAL residue LEU  525  index1  524  path  543  %Seq 100.00
Highlighted IDENTICAL residue GLU  527  index1  526  path  545  %Seq 100.00
Highlighted IDENTICAL residue ALA  530  index1  529  path  548  %Seq 100.00
Highlighted IDENTICAL residue GLY  531  index1  530  path  549  %Seq 100.00
Highlighted IDENTICAL residue PHE  533  index1  532  path  551  %Seq 100.00
Highlighted IDENTICAL residue PRO  534  index1  533  path  552  %Seq 100.00
Highlighted IDENTICAL residue TRP  536  index1  535  path  554  %Seq 100.00
Highlighted IDENTICAL residue LEU  537  index1  536  path  555  %Seq 100.00
Highlighted IDENTICAL residue PRO  539  index1  538  path  557  %Seq 100.00
Highlighted IDENTICAL residue VAL  540  index1  539  path  558  %Seq 100.00
Highlighted IDENTICAL residue GLN  541  index1  540  path  559  %Seq 100.00
Highlighted IDENTICAL residue VAL  542  index1  541  path  560  %Seq 100.00
Highlighted IDENTICAL residue THR  548  index1  547  path  566  %Seq 100.00
Highlighted IDENTICAL residue ASP  549  index1  548  path  567  %Seq 100.00
Highlighted IDENTICAL residue GLN  551  index1  550  path  569  %Seq 100.00
Highlighted IDENTICAL residue GLU  553  index1  552  path  571  %Seq 100.00
Highlighted IDENTICAL residue GLU  557  index1  556  path  575  %Seq 100.00
Highlighted IDENTICAL residue LYS  561  index1  560  path  579  %Seq 100.00
Highlighted IDENTICAL residue LEU  562  index1  561  path  580  %Seq 100.00
Highlighted IDENTICAL residue GLY  566  index1  565  path  584  %Seq 100.00
Highlighted IDENTICAL residue ARG  568  index1  567  path  586  %Seq 100.00
Highlighted IDENTICAL residue GLU  576  index1  575  path  594  %Seq 100.00
Highlighted IDENTICAL residue ILE  582  index1  581  path  600  %Seq 100.00
Highlighted IDENTICAL residue ARG  583  index1  582  path  601  %Seq 100.00
Highlighted IDENTICAL residue PRO  591  index1  590  path  609  %Seq 100.00
Highlighted IDENTICAL residue MET  593  index1  592  path  611  %Seq 100.00
Highlighted IDENTICAL residue VAL  595  index1  594  path  613  %Seq 100.00
Highlighted IDENTICAL residue GLY  597  index1  596  path  615  %Seq 100.00
Highlighted IDENTICAL residue LYS  599  index1  598  path  617  %Seq 100.00
Highlighted IDENTICAL residue GLU  600  index1  599  path  618  %Seq 100.00
Highlighted IDENTICAL residue VAL  601  index1  600  path  619  %Seq 100.00
Highlighted IDENTICAL residue GLU  602  index1  601  path  620  %Seq 100.00
Highlighted IDENTICAL residue GLY  604  index1  603  path  622  %Seq 100.00
Highlighted IDENTICAL residue VAL  606  index1  605  path  624  %Seq 100.00
Highlighted IDENTICAL residue VAL  608  index1  607  path  626  %Seq 100.00
Highlighted IDENTICAL residue ARG  609  index1  608  path  627  %Seq 100.00
Highlighted IDENTICAL residue ARG  611  index1  610  path  629  %Seq 100.00
Highlighted IDENTICAL residue GLY  613  index1  612  path  631  %Seq 100.00
Highlighted IDENTICAL residue LEU  616  index1  615  path  634  %Seq 100.00
Highlighted IDENTICAL residue GLY  617  index1  616  path  635  %Seq 100.00
Highlighted IDENTICAL residue VAL  621  index1  620  path  639  %Seq 100.00
Highlighted IDENTICAL residue ILE  625  index1  624  path  643  %Seq 100.00
Highlighted IDENTICAL residue LYS  627  index1  626  path  645  %Seq 100.00
Highlighted IDENTICAL residue ARG  635  index1  634  path  653  %Seq 100.00
Highlighted 253 residues for visualization

Wrote PyMOL macro into file /usr/local/www/html/proteins/htdocs/results/At2g04842-1qf6_A.pir.txt.1QF6.pdb.conservation.pml

===============================================================================

The program

/usr/local/www/html/proteins/Compiled_Programs/WYRM/PyMOL_highlight_conserved_residues At2g04842-1qf6_A.pir.txt PIR amino_acid 1QF6.pdb _ 100.0 BLOSUM62.dat 

completed successfully.

@@@@@@@@@@@@@@@@@@@@ END  /usr/local/www/html/proteins/Compiled_Programs/WYRM/PyMOL_highlight_conserved_residues @@@@@@@@@@@@@@@@@@@@

Ad blocker interference detected!


Wikia is a free-to-use site that makes money from advertising. We have a modified experience for viewers using ad blockers

Wikia is not accessible if you’ve made further modifications. Remove the custom ad blocker rule(s) and the page will load as expected.