FANDOM


>gi|22325483|ref|NP_671778.1|	   650 residues, 50 /line  threonyl-tRNA synthetase, putative / threonine--tRNA ligase, putative [Arabidopsis thaliana]
MASSHSLLF------------SSSFLSKPSSFTSSLRR-FVYLPTRQFW--PRQRHGFST
VFAVA----------TEP--AISSSGPKKAEPSTVVLPSNESSDKLLKIRHTCAHVMAMA
VQKLF-PD--AK--VTIGPWIDNG---FYYDFDME--P-LTDKDLKRIKKEMDRIISRNL
PLLREEVSREEAKKRIMAINE-PYKMEILD--------GIKE---------EPITVY---
--HIGN--------------------------------E--WWDLCAGPHVETTGKINKK
AVELESVAGAYWRGDEKRQMLQRIYGTAWESEEQLKAYLHFKEEAKRRDHRRIGQDLDLF
SIQDE-AGGGLVFWHPKGAIVRNIIEESWKKMHVEHGYDLIYTPHVAKADLWKISGHLDF
YRENMYDQM------------EIEDELYQLRPMNCPYHILLYQRKRQSYRDLPIRVAELG
TVYRYELSGSLHGLFRVRGFTQDDAHIFCLEDQIKDEIRGVLDLTEEILSR-FGFN-KYE
VNLSTR----PEKSVGGDDIWEKATCALRDALDDKGWSYEVDEGGGAFYGPKIDLKIEDA
LGRKWQCSTIQVDFNLPQRFDITYVDTNSDKKRPIMIHRAVLGSLERFFGVLIEHYAGDF
PLWLSPVQVRVLPVTDN-QLEFCKEVSKKLRACGVRAEL-CHGERLPKLIRNAET-QKIP
LMAVVGPKEVETGTVTVRSRF--GGELGTIPVDDLINKINIAVETRTA------------
L
>gi|116058593|emb|CAL54300.1|	   625 residues, 50 /line  putative threonyl-tRNA synthetase (ISS) [Ostreococcus tauri]
---------------------XKLLTSDESENLLKIRH-TVRVCRSF-------------
--RVV----------GGG--VGSTRGATRRDAE------KRRLIGEDFLTTQSAHVMAMA
VQKVF-PS--AQ--CTIGPWIERG---FYYDFFYP-EG-FTNQDMKKIQKEMYKIIRKDY
PLRREEVSREEAERRIREINE-PYKLEILD--------AIKT---------EPITIY---
--HIGD--------------------------------E--WWDLCAGPHVESTGKLDQT
AFELESVAGAYWRGDETKPMLQRIYGTAWENAEQLKAYTEFKEEAKRRDHRTIGKDLNLF
SLQQDSAGGGLVFWHPKGAQMRHMIETYWKDLHLARGYELLYSPHVARQELWQTSGHSDF
YSENMYQPI------------KVEEEMYQLKPMNCPFHIVVYQDGYYSYKDLPIRWAELG
TVYRYERSGTMHGLFRVRGFTQDDAHIFCLPDQITSEIKRVLDLTEEILST-FGFT-DFE
VNLSTR----PEKSVGEDAIWTTAENALRDALGEKGWDYIVDDGGGAFYGPKIDIKILDA
IGRKWQCSTVQLDFNLPERFDLNYIDRDNNKQRPIMIHRAIFGSLERFFGILTENYAGEF
PLWLAPVQVRLLPVTDE-VSDYTEGVAAKLREAGCRVEI-CTGQRLAKLVRTAEK-AKIP
VMAVVGRDEAANNTLAVRTYK--DGDVGSLSVDEVLSRITTANATKGTD-----------
F
>gi|116626335|ref|YP_828491.1|	   644 residues, 50 /line  threonyl-tRNA synthetase [Solibacter usitatus Ellin6076]
--------------------MSNIQITLPDGSTQSVAA-ETRPIDIAK-SI-SPRLADAA
LVAKV----------NGE--LFDLTRPIEKDA-TLEILTAKNPESLDVYRHSTAHLLAAA
VLELY-PE--TQ--LGIGPPIENG---FYYDFDRP-AP-FTPEDLEKIEKKMWEIQARAL
PYERVLTPKDEGLKKYSEAW---MKCQLID--------ERA--------G-EIFTEY---
--TLGP--------------------------------K--FIDFCRGPHLPDTSKI--K
AFKLLSIAGAYWKGDEKNKQLQRIYGTAFFSPKDLDAYLKQVEEAKKRDHRKLGKELDLF
SIQEL-AGPGLIFFHPKGGIIRKLLEDWMRDQYLKRGYSLVYTPHVAKLDLWKTSGHANF
YAQNMFTPI------------ELDDAEYQLKPMNCPFHILIYADRQRSYRDLPVRLGELG
TVYRYERSGTLNGLFRVRGFTQDDAHIFCMQSQAEEEVVNCLQFAIDTLAA-YGFE-KYD
AEISTWDGGASGKYDGTPDQWEMAEGALRRAVDKLKINAKVVADEAAFYGPKIDVKLVDA
IGRKWQLSTVQFDFTLPRRFGLEYIGEDGKAHQPIMVHRALYGSIERFFGILVEHYAGAF
PVWLAPVQATILPITDR-QTEYARGIKKQLEEAGIRATVDERNEKVNLKIRDAQM-QKIP
YMLVVGDREQESGKVAVRNRK--HADQGVKTLADFIAEIRALIESKAVS-----------
E
>gi|94971761|ref|YP_593809.1|	   659 residues, 50 /line  threonyl-tRNA synthetase [Acidobacteria bacterium Ellin345]
-------------------MSDQIKVKLPDGSVKEVSK-GTTALDIAK-GI-SPRLADAA
LAAKVAPLPHNGDQPEAR--LVDLTRPLEEDS-ELKLLTDRDPEALEVYRHSSAHLLAAA
VLDLF-PE--TK--LGHGPSTENG---FFYDFYRQ-TP-FTPEDLEKIEKRMQELVKEDV
PYAREFLPREESLERFKTEGD-FMKCHFIE--------QFTK------PD-EKISIY---
--KTG---------------------------------K--FLDFCRGPHIPSTGKI--K
AFKLLNIAGAYWLGDEKNPQLQRIYGTSFFSKKDMDEYFAKLEEAKKRDHRVLGKQLDLF
SIQEL-AGPGLIFWHPKGGIIRKEMEDWMREEYLKRGYSLVVTPHVARTDLWKISGHTGY
YKQNFFTPM------------ELDDAEYMLKPMNCPGHVLIYRDQLRSYRDLPMRLGEMG
TVYRYERSGVMHGLLRVRGFTQDDAHIFCTPSQIEDEISGCIDFAISVLHT-YGFN-EFK
VELSEWDPNDRKSFIGTDEQWNLAQGSLKKVLDARGIPYKSMPGEAAFYGPKIDVKLVDA
IGRLWQLSTVQFDFTLPQRFELEYVGEDGKRHQPLMVHRALYGSIERFFGVLIEHYAGAF
PVWLSPVQTVLVPIGEK-HLEYANKVGDVLKAKGIRVEVDGRNEKMNAKIREHAL-QKVP
FILVVGDKEAEATSVNVRTRG--KDKTETVPLDSFVERIEKLIAEKKPTL----------
D
>gi|116747872|ref|YP_844559.1|	   644 residues, 50 /line  threonyl-tRNA synthetase [Syntrophobacter fumaroxidans MPOB]
-------------------MSAEISVTLADGTTKSFPR-GVSAGEVLK-AS-G--GPNGW
VAAKV----------NGV--PVDLIVGIEEDA-AVEGIRADSEVGLEILRHSAAHVMAQA
VKSLF-PE--AR--VAIGPAIDNG---FYYDFEVE-RP-FTQDDLDRIEAKMKELVGAKL
KFERKVLPRDEAIDFFTRRGE-GYKVELLQ--------GFSD---------PTVSFY---
--TQG---------------------------------D--FVDLCRGPHVPHSGYV--R
AFKLTSVAGAYWRGDEHNAMLQRIYGTAFADRDALKKYLHFLEEAQKRDHRRLGRELDLF
SFSDE-VGAGMVIYHPRGALLRHILEAFEKREHLRRGYHIVMGPTLLKTELWKRSGHFEH
YRENMYFT-------------EIEEQSYGIKPMNCLAHMLIYKSRLRSYRDLPLRYFELG
TVHRHERSGVLHGLTRVRQFTQDDAHILCTPEQLHGEIQSIIDFVIEVMGI-FGF--NHE
MEISTR----PAKSIGSDEDWERATSALIDALEDKGIPYQVCEGEGAFYGPKIDVKLRDA
LDRKWQCATIQCDFTLPDRFDLTYVGVDGNRHRPVMVHRVVLGSLERFIGVLVEHFAGAF
PTWLAPVQAIVVTVTDG-QIEFARNMYDRLREAGVRVELDDRNEKLGYKIREAQM-QKVP
YMLVIGDREVAAGGVAPRRRD--GTQLELIAPEAFAAMIQKECLEATK-GRVGLGI----
V
>gi|85858497|ref|YP_460699.1|	   645 residues, 50 /line  threonyl-tRNA synthetase [Syntrophus aciditrophicus SB]
--------MDLGFL-----VMKEIKIVLPDGSERSHNE-GVTVRDVLS-SW-NPALLATT
AAARY----------NQN--LLDLSRSLHDDG-VLEPIDIHSREGLEILRHSISHIMAQA
VQDIF-PG--VL--VSIGPAIEDG---FYYDFEYG-NT-FTPEELEKIEARMQEIVKEDH
PFVREEVSREEAVAFFQGKGE-SYKVELLN--------DLPG-------NIKTVSLY---
--RQG---------------------------------H--YTDLCRGPHVPSTSMI--R
AFKLLNVAGAYWRGDERNKMLQRIYGTGFASREELDEYLKILEEAKKRDHRKLGKDLDLF
QVSEE-AGAGLIIFHPKGTILRTIIEDWEKKEHLRRGYDMVMGPQILKVDLWKKSGHFDH
YRENMYFT-------------EVEGQSYGIKPMNCLSHMLIYKTKIRSYRDLPIRYFELG
TVHRHEKTGVLHGLLRARQFTQDDAHILCTPEQLNSEIRAIADFVGYAMKI-FGF--EYE
VELSTR----PDNSIGSDQDWELATSALENALKDNQMTYDINEGDGAFYGPKIDFKLKDA
LKRKWQCATIQCDFTLPERFDLTYVGADGEKHRPVMLHRVILGAIERFMGVLIEHYGGAF
PVWLAPVQAILLSVTDR-HIPYGKTVYQQLMDAGIRVEGDFRNEKLGYKIREAQT-QKIP
YMLVIGDKEMASGEVAVRQRG--GDNLGTLPVSAFIELVKEKSSQYL-------------
-
>gi|118746506|ref|ZP_01594443.1|	   646 residues, 50 /line  threonyl-tRNA synthetase [Geobacter lovleyi SZ]
----------MPFLFKERYIMSMIQVTLPDNSIRELAD-GATVADLAA-SI-GAGLAKAA
LAGQV----------NGL--LVDLSTPLADGD-NVAIITEKSPEALEIIRHSTSHLMAQA
VKELF-PA--AK--VTIGPAVENG---FYYDFDVA-AP-FTPEDLEKIEKRMAELAAAGQ
PLTRKVMSAAEAIAFFEQMGE-PYKKELIE--------GIGA---------ETVSIY---
--TQG---------------------------------E--FADLCRGPHVPNTNKL--K
AFKLLSIAGAYWRGDEKNRMLQRIYGTAFVDKKELEAYLHRLEEAKRRDHRKLGRELDLF
SFNDE-VGAGFAIWHPKGAMLRTLLEDFERKEHLKRDYDIVVGPQILKTELWQRSGHYDN
YRENMYFT-------------EVDEQSFGVKPMNCLSHMMIYKSQLRSYRDLPQRYFELG
TVHRHERAGVLHGLLRVRCFTQDDAHILCTPEQLDAEIKGVLKFVSDVMGI-FGF--EYE
MELSTR----PEKSIGSDEDWERATGALLGALKDTGRDFEINEGDGAFYGPKIDIKLRDC
LDRRWQCATIQCDFTLPERFDLTYVASDGEKKRPVMVHRVILGSIERFIGVLIEHFAGNF
PLWLAPVQAVVLTVTDN-QIPYAQEVYKQLRSAGIRVQEDLRNEKLNFKIREAQL-QKIP
YMLVIGDKEVEQGTVTPRFRD--GKNLHAMKPDAFIAFVEAETKAYK-------------
-
>gi|82523876|emb|CAI78599.1|	   631 residues, 50 /line  threonyl-tRNA synthetase [uncultured delta proteobacterium]
--------------------MGQIKIKLHDGSEIIVQK-GCRIDSVLN-D------SNKF
VVAKY----------NDN--FVDLTSLITEPG-YILGILPNSEEGKGILRHSASHIMAQA
VMELF-PG--IK--IAIGPAIENG---FYYDFERA-ES-FTPDDLEHIEKRMHEIIKKSV
PIVREDISKEQAIEYFKQHGE-IYKVELLE--------DIAD---------NNVSIY---
--KQG---------------------------------D--FVDLCRGPHLIHTGKL--K
AFKLLSIAGAYWRGNEKNKMLQRIYGTAFPTSKELKEHLNHLEEVKKRDHRKLGKELDLF
SLSEE-VGAGMILWHPKGAMFRYLLEDFEIKEHLKRGYQKVIGPQLLRSELWKKSGHFDH
YRENMYFS-------------EIDNQSYGIKPMNCLAHMLIYKSHIHSYRDLPIRYFELG
TVHRHEKSGVLHGLLRVREFTQDDAHILCTPEQLDNEIKSILDFIKYVMGI-FGF--KYE
VEISTR----PEHSIGSDEDWERATNALKSALEESGTGYDLNEGDGAFYGPKIDFKLKDA
LDRKWQCATIQCDFTLPERFELSYVGQDGVKYRPVMLHRVILGAIERFVGILIEHYAGAF
PVWLSPVQAVILTVTDR-VDEYAQNLYQELIDADIRVEMDIRNEKLGLKVREAQL-QKIP
YMLIIGDKEVSEKRVTLRCRD--DKKQSELNIEDFIGLVKKDCDLYR-------------
-
>gi|78357681|ref|YP_389130.1|	   644 residues, 50 /line  threonyl-tRNA synthetase [Desulfovibrio desulfuricans G20]
-----------------------MKVSI-EGSVVEVES-GASCRDVLKQAL-SGKKFKKV
LAARC----------GGT--MLDLTATVPTACETLEPVYADSPEGLGLIRHSAAHVMADA
VQRLF-PG--VK--VTIGPAIENG---FYYDFDYE-RP-FTADDLEAIEAEMDKIIKAAH
PFERSVMSKDEAKKMFADMGE-TYKLELID--------AVPD---------DIVSIY---
--RSG---------------------------------D--FVDLCRGPHIPDTGCI--N
AFKLMSVAGAYWRGDEKNAMLSRVYGTAFPDEKELKSYLNRIEEAKKRDHRKLGTQLDLF
SFQEE-GGSGMVYWHPKGALVRAILEDFERKEHLKRGYQIVQTPQILRRELWEKSGHYDN
YRENMYFT-------------DIDEQPYGVKPMNCVAHMLIYKSRSHSYRDLPVRLFELG
VVHRHEKSGVLHGLLRVRQFTQDDAHIICTPDQLESEIVGVLNFVRDVMGV-FGF--EYS
MEVSTR----PEKSIGSDEDWDRATSALVKALEGQGLPYEINEGDGAFYGPKIDVKLRDC
LGREWQCATVQCDFTLPDRFDLVYIGQDGERHRPVMVHRVILGSVERFIGVLTEHFAGAF
PTWLAPVQARLLTVTDA-QNEFAEEARAALMAQGIRVEVDTRNEKLGYKVREAQL-EKIP
YILVIGDKEVEARGVNVRLRK--GDNLGLKTLDEVVDIIRADCEEPFKSGGMRYSF----
S
>gi|94986656|ref|YP_594589.1|	   642 residues, 50 /line  Threonyl-tRNA synthetase [Lawsonia intracellularis PHE/MN1-00]
-----------------------MQSDI-NKNHLTMTE-GLTY--INESGL-KEEESKNI
VGYNI----------NGS--IIDLFTPLPTITKEVIPITIDSEDGLEMLRHSAAHILAAA
VKNLF-PT--VK--ISIGPSIENG---FYYDFDAE-RP-FTPEDFPAIEAEMQRIINESI
PFERIEISKAEALEFFSSLHE-NYKVEIIN--------SLED---------GNITLY---
--RIG---------------------------------N--FTDLCKGPHVPNTNFI--K
AFKLLSVAGAYWRGNENNQMLSRIYATAFPNKKLLKTYLTQLEEAKRRDHRKLGKELNLF
EFHED-IAPGMVFWQPNGMLLRTILEDFLRKEHLKRGYQLVQGPQLLRRELWEKSGHYTN
YKENMYFT-------------EIEEDVYGIKPMNCVSHMLLYKTHLHSYRELPQRYFELG
VVHRHEKSGVLHGLLRVRQFTQDDAHIICMPEQLEEEIIQVITFVRDLMSL-FDF--NYH
IVISTR----PEKSIGSDYAWELATSALIQAVEKINLPYSINHGDGAFYGPKIDIKVTDA
IGREWQLSTIQCDFTLPERFELEYVGQDGKRHQPVMIHRAIFGSIERFIGILTEHYAGAF
PTWLTPIQVKILTVTDA-QTPFAKHVYSQLQDVGIRVGLDIRNEKLGFKIREAQL-AKIP
YILVIGQKELELESVNVRLRT--GENIGMQSVTEFIKLVENDCIQPFKRGGMNYRF----
S
>gi|117923678|ref|YP_864295.1|	   648 residues, 50 /line  threonyl-tRNA synthetase [Magnetococcus sp. MC-1]
----------------------MVEIILPDGSSRSYDQETLTCGQIAA-SI-GKGLAKAA
IAGVV----------NGQ--KVDLDAPVPHGA-QVAIITEDSPEGLEIIRHSASHLMAQA
VKTLF-PQ--AQ--VTIGPAIENG---FYYDFDYE-RP-FTPDDLTAIENCMRKLAKRNE
KVERRVMPRDEAVAYFQAMGE-LYKAEIIG--------AIPA-------G-EDVSLY---
--SQG---------------------------------E--FTDLCRGPHVPSTGKL--K
AFKVMKAGGAYWRGDSRNKMLQRIYGTAWATEADLKAYLTQMEEAEKRDHRRIGKDLDLF
SVQED-AGGGLVFWHPRGSRIRRVIEDFWKDRHVEAGYEFLYTPHIANRQLWNTSGHTDF
YSDSMFSPM------------EVDEQAYQIRPMNCPFHILIYKDRRHSYRELPFRWGELG
TVYRYEMSGALHGLFRVRGFTQDDAHIFCTEQQIEEEIQRILDLTLDILRT-YGFS-DFE
INLSTR----PEKSVGSAAIWDKATEALRRAIVSRDLSYVVDEGGGAFYGPKIDVKITDS
IGRKWQCSTVQLDFNLPERFDMGYIGEDGESHRPIMIHRALMGSLERFFGILVEHYAGWF
PMWLAPVQAVVCSITDA-QHAYAETVLAALKKAGLRVEIDLRNEKVGYKIREHTL-KRVP
YLLVVGDKEREEGTVNVRLRS--GKSLGSLPIQDVVERLVEEAASRALSASEDQEE----
A
>gi|77164649|ref|YP_343174.1|	   644 residues, 50 /line  Threonyl-tRNA synthetase, class IIa [Nitrosococcus oceani ATCC 19707]
----------------------MPVITLPDGSQRSFDH-PVTVYDVAA-DI-GPGLAKAA
LGGKI----------EGR--LVDSSYPLEKDT-KLTIITERDMDGLEIIRHSCAHLLAQA
VKALY-PE--AQ--VTIGPVIEDG---FYYDFAYP-KG-FTPEDLEAIEAKMRELVEQDL
SVHRELKSREEAVSLFRRMGE-EYKAEIIA--------SIPS-------E-EEISLY---
--RQG---------------------------------D--FVDLCRGPHVPSTARL--K
AFKLTKVAGAYWRGDANNEMLQRIYGTAWPDKKALKAYLHRLEEAEKRDHRRIGADLDLF
SIQEE-AGGGLVFWHPMGARIRRVIEDFWQERHTAAGYEMLYTPHIAHEELWQTSGHTDF
YRESMYQPM------------EDDHQLYQLKPMNCPFHVLIYQGRLRSYRELPIRWAELG
TVYRHEMSGALHGLMRVRGFTQDDAHIFCREEQIENEILGILDLTLEMLAA-FGFD-RYE
IDLSTR----PEKSVGPEAIWEQATQALRSALDKKGLDYAVDEGGGAFYGPKIDIKIEDA
IGRKWQCSTVQLDFNLPERFAMEYVAEDGARHRPIMIHRAVLGSLERFFGVLIEHYEGKF
PPWLAPVQVVVMSITDR-QEGYARQVEEAMRNKGFRSLLDLRNEKIGFKIREHIL-RRIP
YLLVIGDREVANQTVAVRTRY--SQDLGAMSLDAFMEHLSVDVARLGHNISEED------
-
>gi|121519776|ref|ZP_01652891.1|	   636 residues, 50 /line  threonyl-tRNA synthetase [Thermosipho melanesiensis BI429]
-----------------------MKIKFPDGNVKEFEK-GITPGEIAK-SI-SEGLYRNA
VGAIV----------DNI--LWDLNRPINFDC-SLKIVTKKDKEAPEFFRHTMAHILAQA
VMRIY-GEENVR--LGIGPTIENG---FYYDFEILNGT-IKEEDLENIEKEMKKIIKEDL
PIERFELPKDEAIDMMNKKGQ-IYKVELIN--------EIN--------D-EKVSFY---
--KQG---------------------------------E--FVDLCRGPHLPRTGMI--K
HFKLLSASGAYWRGSEKNPMLQRIYGTAFATKEELENYLKMLEEAKKRDHRKLGPKLGLF
FINTD-VAAGMPIFLPKGTIILNELMAFSRSLHEEYGYTEVMTPLVMNVKLWYQSGHWDH
YKENMYFT-------------EKEEVEYAIKPMNCPGHILIYKNNVVSYRDLPIRLFEFG
KVHRYERSGVLHGLLRVRAFTQDDAHIFCRQDQIEEEVSKVVKLIDQLYKP-FGF--SYR
ATLSTM----PEDHMGDEETWEKATNALRKVLEDIKLEFEVAEGEGAFYGPKVDFHVRDS
LGREWQCATIQLDFQMPERFELTYVDKDGIEKRPVMIHTAKYGSLERFFGILIEHFAGAF
PLWLSPIQVVVLPVSDK-YVSYARKIYSILMENGVRVSVDDRNETLGYKIREAQI-NKIP
YMIIVGEREEESGKISIRSRD--GVEQKDIAVEEFLDLLSVSIKERR-------------
-
>gi|145621883|ref|ZP_01777849.1|	   640 residues, 50 /line  threonyl-tRNA synthetase [Petrotoga mobilis SJ95]
----------------------MVKITYPDNSVQEFKD-GITPAEIAK-GI-SEGLYRNA
IAAEI----------NGE--LKDLNTPIMQDS-TIKLITLDDEIAPKIYRHTMAHIMAQA
VARIF-GEDRVK--LAIGPVIENG---FYYDFDIEGHN-LSEEDFSKIEEEMKKIIKEDI
KIIRKEVNKKEAIELFK--DQ-PYKLELIE--------ELE--------E-DTISVY---
--FQG---------------------------------D--FYDLCRGPHLPSTGYV--K
YFKLLSVSGAYWRGDEKNKMLQRIYGTAFPKKEQLDDYLNMIEEAKRRDHRKLGPKLNLF
MLQSE-MAPGMPFFLPNGKIVLNELMAYSRQVHKKYGYVEVETPQIMNIKLWHQSGHWDH
YKENMFFT-------------EKEDMPMAVKPMNCPGHILIYKNNFVSYRDLPIRMFEFG
KVHRYERSGVLHGLFRVRAFTQDDAHIFCMPSQMEEEIIKVIQLTNEIFST-FGF--KYE
AILSTM----PEDHMGDIESWERATDALKKALEKSNMEYRIDEGEGAFYGPKIDFNVTDS
LGRKWQCTTIQLDFQMPERFDMVYADENDAQKRPVMIHRAIFGSLERFFGILIENFAGEF
PTWLSPVQVSILPVSEK-FNEEAKKFSRILEQEGIRVYVNDSDATVGYKIRNEQM-KKVP
YMIVFGEKEMNSDTINIRTRK--GDTIENVSKERFIEEIKNEIKNRNLDLTF--------
-
>gi|148269334|ref|YP_001243794.1|	   640 residues, 50 /line  threonyl-tRNA synthetase [Thermotoga petrophila RKU-1]
---------------------MKIKVKLPDGKEKEYDR-GITPAEIAK-EL-G---VKKA
IGAVV----------NGE--LWDLKRPIENDC-ELRLVTLEDPEAPEFYRHTMAHILAQA
VMRIY-GKENVK--LGIGPTIENG---FYYDFDIKNGK-LTEEDLPKIEQEMKKIIKENL
PIERKEISKEEARKLFN--NQ-PYKLELIE--------EIE--------G-DRVTIY---
--RQG---------------------------------E--FVDLCRGPHLPSTGVV--K
HFKLLSVSGAYWRGSEKNPMLTRVYGTAFAKKEDLDNYLKFLEEAQRRDHRKLGPHLELF
MLNTE-YAPGMPFFLPKGVVVLNELMRFSRELHRERGYQEIFTPLIMNEQLWKISGHWDH
YAENMYFI-------------EKDEERYAVKPMNCPGHILVYKSRTVSYRDLPLRFFEFG
RVHRYERSGVLHGLMRVRSFTQDDAHIFCTPDQIEEEILGVLDLINTIYGQ-FGF--TYR
VELSTM----PEDHMGDEAIWEKATTALKNALERAGLSYKVNEGEGAFYGPKIDFHIRDS
IGREWQCATIQLDFMMPEKFNVTYIGPDNKEHRAVMIHRAIYGSLERFFGILIEHFAGAF
PTWLAPIQVAVIPISEK-HNDGAEKIAKRISQEGFRVFFDNRRETLGYRIRQAQT-QKIP
YMIILGDKELESGKISVRTRT--GKEIKDVDLEHFVETLRNEVLSRKLELLME-------
G
>gi|121541403|ref|ZP_01673155.1|	   637 residues, 50 /line  threonyl-tRNA synthetase [Candidatus Desulfococcus oleovorans Hxd3]
----------------------MITITLPDSSTKTFDG-PVTGEQIAK-SI-SEGLWREC
VAVEV----------DGA--AMDLSEPIATDA-AVRLITTRDPEGLHIMRHSAAHVMAEA
VQRVF-PD--AE--LTIGPVVEDG---FYYDIDME--P-VSEEIFSRVEAEIKKIVSAKI
PFVRKEVDKAEALDRYR--DQ-PYKTEILN--------EIE--------D-DTVSLY---
--TNG---------------------------------D--FTDLCRGPHVPHTGFV--R
AVKLTKISGAYWRGDQNREQLQRLYGTAFFSKKELDAYLTLIEEAKKRDHRKLGAELDLF
SFHEE--AAGMPFFHPNGMKLWNALLDYWRLEHRAAGYVEVKTPVMLDRALWEKSGHWEN
YRENMYVS-------------VIDDNQYAIKPMNCPGGMLLYKEKRYSYRDLPLRVAEIG
LVHRHELSGVLSGLFRVRAFHQDDAHIFMTPDQIEQEIFGVLKLVETIYST-FGL--GFH
LELSTR----PAKSIGTDEQWVKATAGLRAALDAYGKGYAVNEGDGAFYGPKIDVHIKDA
LGRTWQCGTIQLDMSLPERFDLSYIDAGSEKQRPVMIHRVIYGSIERFLGILIEHFAGKF
PLWLAPTQAVLLPLNDD-MIPYAREVRQEFEQAGIRTEIDDRSESLNKKVRQAQI-DKIP
LIITLGGKEKEARTLSVRTLD--GQVRHGVSHEAFFAVAKEHIAKRLQTPVVF-------
A
>gi|126698152|ref|YP_001087049.1|	   639 residues, 50 /line  threonyl-tRNA synthetase [Clostridium difficile 630]
----------------------MIKVALKDGSIKEFEN-AISVMDVAK-SI-SEGLARNV
VAASV----------NGE--VVGLDHIIDTDC-DLNLFKFEDKEGKEVFRHTSAHILAQA
IKRLY-PE--AK--LAIGPSIENG---FYYDIDLD-HR-LVPEDLEKIEAEMKKIAKEDL
KIERFELPRNEALELMKEQGE-DYKVELIS--------DLPE-------S-EIISFY---
--KQG---------------------------------D--FTDLCRGPHLPSTKKV--K
AVKLQSVAGAYWRGDENNKMLQRIYGTSFEKNKDLEEYLHLLEEAKKRDHRKLGKELGLF
MIPEE--GPGFPMFLPKGMELKNELLKFWREIHRKAGYIEIESPIILNRKLWETSGHWYH
YKENMYTV-------------KIDDEDYAIKPMNCPGGLIYYNSQLHSYRDFPMRVAELG
RVHRHELSGALQGLMRVRAFTQDDSHIFMLPEQIKDEIKGVANLIDGIYKT-FGF--EYN
LELSTR----PENSMGSDEEWEAAENGLREALEELGLPYTINEGDGAFYGPKIDFHLKDC
LGRTWQCGTIQLDMQLPRQFDNTYIGQDGEKHRPVMIHRVAFGSIERFIGILIEHYAGKF
PVWLSPTQVKILPISDK-FMDYANEVKKELFDKGIRVELDDRAEKIGFKIREAQL-EKVP
YMLIVGEKEVADNNVSVRSRD--KGEIGSIKLDEFIASISKEIESRESIIQ---------
D
>gi|82747912|ref|ZP_00910404.1|	   635 residues, 50 /line  Threonyl-tRNA synthetase, class IIa [Clostridium beijerincki NCIMB 8052]
----------------------MINIKLKDGSIKEIAD-ESSIYDLAN-SI-SKNLAKVA
VVGEV----------NGT--LVDLNYKLKNND-EVNILTYDDEKAVEVIRHSTSHVMAQA
VKRIY-KD--SK--LAIGPAINNG---FYYDFDIE-NS-LSNEDLDKIEAEMNKIIDENL
SFERIDISRDEAIKLMEEKGE-TYKVELIK--------DLPE-------A-EKISLY---
--KQG---------------------------------D--YIDLCRGPHIPSTKYI--K
AFKLLSVAGAYWRGNEKNKMLQRVYGVAFSSKKELEVHLHNLEEAKKRDHRKLGKELKLF
TFAEE--GPGFPFMLPKGVILKNTLIDFWRKLHYEDGYVEIETPIMLNKKLWETSGHWYH
YRENMYTS-------------SIDEEEFALKPMNCPGGMLVYKSESHSYRDFPMRVGELG
RVHRHELSGALHGLMRVRAFTQDDAHIFMLPDQIKSEIKGVINLIDKVYSK-FGF--KYN
LELSTR----PEDSMGSDEEWELAESSLKGALDELNLEYKINEGDGAFYGPKIDFHLEDS
IGRTWQCGTIQLDFQLPQRFELEYVGSDGEKHRPIVIHRVVFGSIERFIGILIEHFAGKF
PTWLSPVQVKILPISNK-FNSYSEKIKDKLSSEGIRVEIDQKDEKIGYKIREARN-ERVP
YIIIVGEKEAAENNISLRSRS--NGDEGTLNLEDLIERINNEVKNKT-------------
L
>gi|134299469|ref|YP_001112965.1|	   635 residues, 50 /line  threonyl-tRNA synthetase [Desulfotomaculum reducens MI-1]
----------------------MIKITLKDGSVREYAV-GTTVLEVAK-SI-SQGLAREA
LAGKV----------NGK--IVDLEYPLKEDA-ALELLTFNDEEGKTVYRHSTAHVLAQA
VKRLF-PD--AK--LAIGPAIQDG---YYYDFDVE-QP-FTPAQLERIEEEMNKIIKEDI
PFKRVELSREEALEHFKKQDE-IYKIELIT--------DLPE-------D-AVISCY---
--QQG---------------------------------D--FDDLCAGPHVPSTGRL--K
SLKLMSIAGAYWRGSEKNKMLQRIYGTSFPKKAMLDEHLFRIEEAKRRDHRKLGQELDLF
SIQEE--GPGFPFFHPKGMVLRNELENFWRQEHKKRGYQEIRTPIILNRSMWEQSGHWAH
YKDNMYFT-------------KIDEADYAVKPMNCPGSILVYKTRMHSYRDLPLRWGELG
LVHRHELSGALHGLMRVRCFTQDDAHIFMLPSQIKDEIIGVIDLFDYFYNT-FGL--NYH
VELSTR----PEKSMGSDEMWEVATNSLRDALEAKKMDYKVNEGDGAFYGPKIDFHLTDS
LGRTWQCGTIQLDFQMPERFNLNYVGEDGQKHRPVMIHRVVFGSIERFIGILTEHFAGAF
PVWLAPVQVKVLPITDR-HHEYARELVKRLQGLDIRVELDARNEKINYKIREAQT-QKIP
YMLVIGDREMEQGAVAVRERG--KGDVGAISVGDFIKKIEDDIQNKTI------------
-
>gi|28211884|ref|NP_782828.1|	   639 residues, 50 /line  threonyl-tRNA synthetase [Clostridium tetani E88]
----------------------MINITLKDGKVIEVEK-GVKVSDIVM-KI-SPALYKKA
VGAKI----------NGE--IAELMTEIKEDS-ELEILTFDDEEGRKTVRHTSSHILAQA
VKRLY-PE--AK--LAIGPAIDNG---FYYDFDID-FT-FTPEMLEKIEKEMAKIVKENL
EIERFELPREEAIKLVKDASE-PYKVELIE--------DLPE-------G-EVISFY---
--KQG---------------------------------D--FVDLCAGPHLPSTGKI--K
AIKLLSVAGAYWRGDEKNKMLQRIYGTAFLKKSELEAYLKMLEEAKRRDHRKLGKELDLF
TINEE--GPGFPFFHPKGMVVRNILENFWREKHTKAGYDEIRTPVILNEELWHRSGHWDH
YKENMYFT-------------KIDNENFAIKPMNCPGSILVYKSHLHSYKEFPMRLGELG
LVHRHELSGALHGLMRVRCFTQDDAHIFMTKEQIKDEILNVIKLIDSFYKV-FGF--EYF
VELSTR----PEDSMGSDEDWEVATNGLKNALEGAGLEYKINEGDGAFYGPKIDFHLKDC
IGRTWQCGTIQLDFQMPERFDLTYVGQDGEKHRPVMVHRVVFGSIERFIGILIEHFAGAF
PTWLAPVQVKVMTITDS-QKDYANKVVNDLKEKGIRVEFDDRNEKIGYKIREAQL-QKVP
YMIILGDKEVSENKVAVRSRK--EGDLGAISLKEFVAKLNYEIDNRIVENS---------
K
>gi|134098578|ref|YP_001104239.1|	   674 residues, 50 /line  threonyl-tRNA synthetase [Saccharopolyspora erythraea NRRL 2338]
-------------------------MKVPAGTTAG-EA-VLEAGLP------SKGADAVV
VVRDH----------EGA--LRDLSWAPESDV-EVEAVAACTEEGRSVIRHSAAHVLAQA
VQQLH-AE--AK--LGIGPPVRDG---FYYDFDVE-HP-FTPEDLQALEKRMKQIIKSGQ
KFSRRRLDSVEAARE-ELAGE-PYKLELVD--LKSGSDEVDTSEVMEVGG-GDLTVYDNV
D-RHG---------------------------------EVVWGDLCRGPHVPHTRYI--P
AFKLMRVAAAYWRGDQSNQQLQRVYGTAWESKEKLDEHLELLAEAERRDHRRLGSELDLF
SFPDE-IGSGLPVFHPKGGIIRKEMEDYSRRRHEQAGYEFVYSPHITKDALFKTSGHLSW
YKDGMFPAMHLDEERDEDGEVRKPGQDYYLKPMNCPFHNLIYRSRGRSYRELPLRLFEFG
SVYRYEKSGVVHGLTRVRGMTQDDAHIYCTPEQLQDELKSLLNFVLNLLRD-FGLD-DFY
LELSTRN---EEKYVGDDESWRVATEALREAAESSGLELVPDPGGAAFYGPKISVQAKDA
LGRTWQMSTIQVDYHLPDRFELEYTSSDGSRQRPIKIHRALFGSIERFFGVLTEHYAGAF
PAWLAPVQVVGIPIADE-HLDHLDRVAKALRAKGIRVEVDASDDRMQKKIRNHTT-QKVP
FLLLAGGKDVEADAVSFRFRD--GTQINGVPVDTAVAALAHWVERRENSSPTAETFQAEL
A
>gi|29833364|ref|NP_827998.1|	   658 residues, 50 /line  threonyl-tRNA synthetase [Streptomyces avermitilis MA-4680]
--------------------MSDVRVIIQRDSERE-ER-VVTTGTTAA-DL-FPG-ERTV
VAARV----------GGE--LKDLAYEVKDGE-EVEPVQISSEDGLNILRHSTAHVMAQA
VQELF-PE--AK--LGIGPPVKDG---FYYDFDVA-KP-FTPEDLKAIEKKMQEIQKRGQ
RFSRRVVTDEAARE--ELADE-PYKLELIGIKGSASNDDG---ANVEVGS-GELTIYDNL
DAKTG---------------------------------DLCWKDLCRGPHLPTTRNI--P
AFKLMRNAAAYWRGSEKNPMLQRIYGTAWPSKDELKAHLDFLAEAEKRDHRKLGNELDLF
SIPDQ-IGSGLAVFHPKGGIVRRVMEDYSRRRHEEEGYEFVYTPHATKGKLFETSGHLDW
YADGMYPPMQLDE-----------GVDYYLKPMNCPMHNLIFDARGRSYRELPLRLFEFG
TVYRYEKSGVVHGLTRARGFTQDDAHIYCTREKMADELDKTLTFVLNLLRD-YGLT-DFY
LELSTKD---PEKFVGSDEVWEEATETLRQVAEKQGLPLVPDPGGAAFYGPKISVQAKDA
IGRTWQMSTVQLDFNLPERFDLEYTGPDGSKQRPVMIHRALFGSIERFFAVLLEHYAGAF
PAWLAPVQAVGIPIGDA-HVEYLQKFAAEAKKKGLRVEVDSSSDRMQKKIRNAQK-QKVP
FMVIAGDEDMTAGAVSFRYRD--GSQENGIPLDEAIAKIAKVVEERTQ------------
V
>gi|15606769|ref|NP_214149.1|	   638 residues, 50 /line  threonyl-tRNA synthetase [Aquifex aeolicus VF5]
--------------------MEKIKVKI-KGKEYEVEK-GTPLGKIFE-LA----GIKDA
LGGVI----------NGK--IIDLQTPVRESG-EIKPVYRGSKESLEIMRHSLAHIMAQA
LKELY-GA--KKVHLGVGPTTEEG---FYYDVEVEGHK-ITEEDLPKIEQKMKEIIERDY
PILRRELSREEAIKLFDKLKE-KYKIDIIK--------EIPE-------E-EVISVY---
--EQG---------------------------------D--FIDLCKGPHLPSTGKA--G
AFKLTSISGAYWKGRSDQPQLTRIYGIAYWSDKEVKERLKFYEEVKKRDHRRLGKELEFF
TIDDN-VGAGLILWLPRGAIYRKVLEDYLREEHLKRGYQLVYTPHVGKSKLWETSGHLEC
YKQNMFPSM------------KIDEEEYYVKPMNCPFHIAIYKSRTRSYKELPLKLFELG
TVYRYELSGVLHGLLRVRGFTQDDAHIVCTPEQVNDVIRETLDFALSTLKD-FGFN-EFK
IYLSTR----PEYSIGSDEQWEVSQNALKKAIEDLGYEYEIDEGGGAFYGPKIDVKIRDA
IGRMWQLSTIQFDFNLPERFDMTYVGPDNKKHRPYMIHRALLGSIERFTGILLEHYAGLL
PIWLSPTQVMIIPIADR-HHEYAKKVYEFLKENGIRAEMDLREERMNAKIRDAEL-KKIP
VILVVGDREAQNNTVSVRTKK--EGNLGSMELNKFLDWIKEKIKNKE-------------
-
>gi|19703946|ref|NP_603508.1|	   620 residues, 50 /line  Threonyl-tRNA synthetase [Fusobacterium nucleatum subsp. nucleatum ATCC 25586]
------------------------------------------MFEIAK-GI-SNSLAKKS
VGAKV----------DGK--NVDMSYILDHDA-EVEFIDIDSPEGEDIVRHSTAHLMAQA
VLRLY-PD--TK--VTIGPVIENG---FYYDFDPV-EQ-FTEEDLEKIEAEMKRIVKENI
KLEKYVLPRDEAIEYFRDVDKNKYKVEVVE--------GIPQ-------G-EQVSFY---
--KQG---------------------------------D--FTDLCRGTHVPSTGYL--K
AFKLRTVAGAYWRGNSKNKMLQRIYGYSFSNEERLKHHLKLMEEAEKRDHRKLGKELELF
FLSE--YGPGFPFFLPKGMIVRNVLIDLWRREHEKAGYQQLETPIMLNKELWEISGHWFN
YRENMYTS-------------EIDELEFAIKPMNCPGGVLAFKHQLHSYKDLPARLAELG
RVHRHEFSGALHGLMRVRSFTQDDSHIFMTPDQVQDEIIGVVNLIDKFYSKLFGF--EYE
IELSTK----PEKAIGSQEIWDMAEAALAGALDKLGRKYKINPGDGAFYGPKLDFKIKDA
IGRMWQCGTIQLDFNLPERFDVTYIGEDGEKHRPVMLHRVIYGSIERFIGILIEHYAGAF
PMWLAPVQVKVLTLNDE-CIPYAKEIMNKLEELGIRAELDDRNETIGYKIREANGKYKIP
MQLIIGKNEVENKEVNIRRFG--SKDQFSKLLDEFYTYVVDEATIKFD------------
K
>gi|37522455|ref|NP_925832.1|	   627 residues, 50 /line  threonyl-tRNA synthetase [Gloeobacter violaceus PCC 7421]
----------------------MTFRQ---------PA-RRTLSGRFG-AL-KCH-----
--------------------NGGCSCD-SKAM-ENDILRQSDPEKLHRIRHSTSHILAMA
VQKLF-PE--TK--VTIGPAIENG---FYYDFDRP-TP-FTPEDLKKIEKEMRRIVQQKL
PLVREEVPREAMRERLEALGE-PYKLELFE--------GFDH-------D-APVSLY---
--RTG---------------------------------D--WWDLCAGPHVESTAEIHPN
AFKLRSVAGAYWRGDEKRAQLQRIYGTAWETPEQLEEFLRREEEAKKRDHRKLGRELGLF
VFSDL-VGPGLPLWTPKGALLRYILEEFLRKEQVKRGYQQVVTPHIARVDLFKTSGHWFK
YKDDMFPLMATSEE-------EGAEEGFVMKPMNCPFHIQIYKSELHSYRELPIRLAEFG
TVYRYEQSGELGGLTRVRGFTVDDSHLFVTPEQLDDEFKKVVDLIQFVFRS-LQLGDGFS
ARLSFRDP-TSDKYIGSDAAWEKAQAAILKASQDLGLKYFVAEGEAAFYGPKLDFIFRDA
LGREWQLGTVQVDYILPERFELEYVAEDGSRRRPVMIHRAPFGSLERFIAILIEHFAGDF
PLWLAPEQVRILPVTDQ-FVGYAESVKDRLVSLEMRAEVDASSERLGKKIRNGET-AKVP
VLLVVGESEANSGTVAVRTRVEGEKDKGTLPVEEAIAYLQERLAKRT-------------
-
>gi|53687074|ref|ZP_00106792.2|	   633 residues, 50 /line  COG0441: Threonyl-tRNA synthetase [Nostoc punctiforme PCC 73102]
----------------------MSKPTDSDKS----PF-VITSPTVQQ-PM-SPN-----
--------------------SSNQSQQSEQVE-KIYLPRTSESENLKKIRHTASHVMAMA
VQKLF-PK--AQ--VTIGPWIENG---FYYDFDSP-EP-FSENDLKAIKKEMAKIINRKL
PVIREEVSREEAARRIQEIKE-PYKLEILA--------DIKN-------E--PITIY---
--HLGN--------------------------------E--WWDLCAGPHLENISELNPK
AIELESVAGAYWRGDETKAQLQRIYATAWESPEQLAEYKRRKEEALRRDHRKLGKELGLF
IFSDL-VGPGLPLWTPKGTLLRSTLEDFLKQEQVKRGYLSVVTPHIARVDLFKTSGHWQK
YKEDMFPLMADDEE------AAAQEQGFVMKPMNCPFHIQIYKSELRSYRELPMRLAEFG
TVYRYEQSGELGGLTRVRGFTVDDSHLFVTPEQLDSEFLSVVDLILSVFNK-LQLK-NFK
ARLSFRDP-ASDKYIGSDEVWDKAEGAIRRAVETLGMEHFEGIGEAAFYGPKLDFIFSDA
LDREWQLGTVQVDYNLPERFELEYVAEDGVRKRPVMIHRAPFGSLERLIGILIEEYAGDF
PLWLAPVQARLLPVGDT-QLDFAKDVVAKMRALGIRAEVDTSGDRLGKQIRNAEK-EKIP
VMAVVGAKEVETNTLSIRTRA--SGELGVIPVDEVVDKMKDAIAKFEN------------
F
>gi|42523121|ref|NP_968501.1|	   656 residues, 50 /line  hypothetical protein Bd1617 [Bdellovibrio bacteriovorus HD100]
------------------MLMSQITIILPDNSTKVFDH-EPTALEVAM-SI-GPRLAKET
LGAKL----------NGSTEISDLRTVLKDQT-KVALVTTKSPESVEVVRHSCAHIMAQA
IQDIW-PE--VK--VTIGPVIDNG---FYYDFDSP-FA-FTEEHFEKIEKKMSEIVSKDL
PIHREDWPIQKAIETFKGMNE-RFKVELIE--------DLAKK-----GE-TTVGIY---
--FNGT--------------------------------S--WFDLCRGPHIQSTGQI--K
AFKLLSVAGAYWRGDEKNAQLQRVYATAFNDKKDLETYLHNIEEAKKRDHRKLGKELGMF
YFNEL--APGSPFFTGKGATVYNSLQTYLRELYFETGYQEVITPQIFDVNLFHTSGHYQN
YKENMFFT-------------KVDERDFASKPMNCPSHCLLYNSEKYSYRDLPIKMADFG
RLHRYEKSGAMHGLTRVRTFCQDDAHIFCRMDQLQEEIAKFMNLLNRVYDK-LGMG-NYK
IFLSTR----PDNRMGSEEYWDMAEGALAEALKSLNLPFELNPGDGAFYGPKLDIMFVDA
LNRPWQLGTLQVDPNLPQAFDLKYTGEDNKEHRPVMLHRAILGSLERFIGVYLEHTAGHL
PPWMMPVQVAILNVTDR-VNSFCEELQNSLKGHSVRVEFDRRNEKLNYKIREAQL-QKIP
YMIIVGDKEAESRTVSLRLRD--GSEHKGLTVDQVMNLITTDIKTRSLQSSLAKSAT--T
N
>gi|42781481|ref|NP_978728.1|	   640 residues, 50 /line  threonyl-tRNA synthetase [Bacillus cereus ATCC 10987]
------------------MKEQMIEIKFPDGSVKEFVK-GITLEEIAG-SI-SNSLKKKA
VAGKV----------NDG--LYDLRRNIEENA-EVEIITIDSDEGVEIARHSAAHILAQA
VKRLY-GD--IN--LGVGPVIENG---FYYDMDLP-SS-VNIEDLRKIEKEMKKIINENI
KIERVEVSREEAAKLFQEMND-RLKLELLE--------AIPS-------G-ESVTLY---
--KQG---------------------------------E--FVDLCRGPHLPSTGYL--K
AFQLTHVSGAYWRGDSNNQVLQRIYGVAFASQKELEEYLHFVEEAAKRNHRKLGSELELF
MFSEE--APGMPFYLPKGQIIRNELEAFLREIQKEYKYQEVRTPFMMNQELWEKSGHWGH
YKDNMYFS-------------EVDNKSFALKPMNCPGHMLMFKNKLHSYRELPIRMCEFG
QVHRHEFSGALNGLLRVRTFCQDDAHLFVTPEQIEDEIKSVMAQIDYVYKT-FGF--QYE
VELSTR----PEDSMGDDKLWEQAESALANVLHSLNYKYRLNEGDGAFYGPKIDFHIKDA
LNRSHQCGTIQLDFQMPEKFDLNYIDEKNEKKRPVVIHRAVLGSLDRFLAILIEHFGGAF
PAWVAPVQVKVIPVSNAVHVQYADEVADKLAQAGVRVERDVRDEKLGYKIREAQM-QKIP
YVLVIGDKELENGAVNVRKYG--GEKSEVVALDVFVSSIEEEIKNRG-------------
Y
>gi|45658307|ref|YP_002393.1|	   638 residues, 50 /line  threonyl-tRNA synthetase [Leptospira interrogans serovar Copenhageni str. Fiocruz L1-130]
----------------------MYQLTLPDKSIKEVAS-GFTYRDFIE-KE-LPFLKNKA
LAVRL----------NGE-EILDLSRTVEKNS-NIEVLTYSEKLGWETFQHSAAHLLGMA
VQNLY-KN--AN--LTVGPVIDNGPGFFYYDIDFQ-GAIVTPEDFPKIEAEMEKIVKADH
PVWRKVVSKKQAIETFQKLGE-KYKIEIID--------GIP--------S-EEVSIY---
--GMG---------------------------------E--WFDLCRGPHVPNSGVL--K
SFKLTAISGAYWKADKNNSMLTRIYGVAFPTKKELDQYLFQIEEAKKRDHRKIGKEMDLF
SFQKE--GPGFPFWHPKGTILWNSLAEYLRSECNKRGYQEIKTPAVLSSELWKKSGHWDN
FHENMYFT-------------DIDEEDYALKPMNCPGCSLIYKHHLHSYRELPLRFAEFG
SVHRHELHGVLHGLFRVRAFTQDDSHIYAPLDYLESEVMDIIDFTFTVYKK-FGFS-EFK
TFIATR----PEKSQGKDEDWEFATSTLKQSLEKKGIPYGIKEGEGAFYGPKIEFNIKDS
IGRLWQCGTIQVDFSMPERFDLDYTDSDGQKKRPVMIHRAIYGSLERFIGILIEHYEGKF
PLWISPNQIRILTVTEK-VTDYAKNVYRELLDSGFRVELDTRNEKIGAKIRDSIL-KKAN
YLLILGEKEMESNTLAVRMRG--QEDTKILTRTGFISNLQDEIKSS--------------
-
>gi|51245280|ref|YP_065164.1|	   657 residues, 50 /line  threonyl-tRNA synthetase [Desulfotalea psychrophila LSv54]
-----MLIFGLYFSIDPKKLMSDITVTIADGESTQVPI-STTVGEVFV-ALQSNKQRKRT
VAAIL----------NGE--VVDFNTPLSTDC-TLSPVTIDSPEALSVLRHSTAHIMAHA
VRDIYGSD--VK--VAIGPSVDNG---FYYDFLRS-DP-FTPEDFEKIEARMLEIVRTGS
LFEKTLYSSAEAIARFEKEEE-KYKVELIQ--------DLD--------V-EEVSIY---
--TVG---------------------------------D--FADLCRGPHLPSTSFI--G
AFKLLRVAGAYWRGDEKKDVLQRIYGTAFFDSKALRKHLNNIEEAKKRDHRKLGKELELF
TMQDS-IGPGLPLWLPKGARMRHQIEEFWKAEHYRHDYELLYTPHIARQDLWKTSGHLDF
YADSMYAGM------------DIDGVTYQIKPMNCPFHVGVYKAKKRSYRDFPLRWCELG
TVYRYERAGALHGLMRVRSFTQDDAHIFCRPEQLEDEIFNILDFNLFILKS-FGFS-EYD
IYLSTR----PEKSVGTDENWDKSTNALKLALEKKGLKYEIDPGEGVFYGPKIDIKIKDQ
LGRSWQCSTVQVDFNLPERFELSYVGSDNSEHQPIMIHRALMGSLERFIGVLIEHHAGAF
PLWFSPVQARILNITDD-QIEYGEKVYAELRAADIRVEKDLRNEKLNYKIREAQL-VKTP
YMLIIGDKEKEDGTVTVRMRN--GKNLDPMTVQEFVALVLEECQHKGD------------
A
>gi|94264275|ref|ZP_01288069.1|	   641 residues, 50 /line  Threonyl-tRNA synthetase, class IIa [delta proteobacterium MLMS-1]
--------------------MTEITCTY-AGKTATFAA-ATPVAEVVR-ELLSNKERKRT
LALRV----------GQQ--LYDLTAPLTCGG-EIAPLTTADPGALELLRHSAAHVMAEA
VLDLFGPE--VQ--VTIGPATADG---FYYDFDRR-QP-FTPDDLEKIEARMAEIVAADQ
PFERREMSLAQAIDFFTAQGQ-EYKVELLR--------ELE--------A-EQVSLY---
--SQG---------------------------------N--FVDLCRGPHLPSTGWL--K
AFKLTRLAGAYWRGDENNKMLQRIYGTAFFDKKELKQYLAQLEEAKRRDHRKLGKELELF
TIQEQ-IGPGLILWQPKGALLRRLIEDYWRQQHYQHGYDLLYTPHIARRELWQTSGHLDF
YGDNMFAGM------------DIEDVQYQLKPMNCPFHIALYKTRKRSYREFPLRWCELG
TVYRFEKTGALHGLMRVRGFTQDDAHIFCRPEQLEDEIYRILDFNLHVLKA-FGFS-DYE
IYLSTR----PEKYVGSDEHWQQATEALKLALEHKGLAYSVDPGEGVFYGPKIDIKIKDV
LGRAWQCSTIQVDFNLPERFKLGYTGEDSGEHRPIMIHRALMGSLERFFGVLIEHYAGAF
PLWLAPVQARILNITDA-QLDYVGKVYEQLRRAGVRVEKDERNEKLNYKIREAQL-QKIP
YMLVVGDQEAADGTITVRQRD--GKNLPAMTVADFAALVAGQVAESHN------------
L
>gi|51893696|ref|YP_076387.1|	   651 residues, 50 /line  threonyl-tRNA synthetase [Symbiobacterium thermophilum IAM 14863]
-------------------MSSVVHVTLPDGSVREYPQ-GITIAEAVA-QI-GPRLAKAA
LAAKV----------DGR--LVDLSARLEKDC-TLQVLTFKDEEGREVFRHTSTHIMAQA
VKRLF-PE--AK--LTVGPPLENS---FYYDFDLP-RP-LTPEDLEKIEAEMAKIVEADY
PIVRQEVDREEAKRFFAERGE-DYKVLLVD--------KIPE-------D-EVVSIY---
--TQG---------------------------------E--FTDLCVGPHLPSTGRV--K
AFKLLSVAGAYWEGNQANKQLQRVYGTSFESKKDLEDYLFRLEEARRRDHRRLGPELGLY
RFEE--VAPGFAFWLDKGYRLYRELENWSRKLQEARGYEEVSTPWIVSSKLYETSGHWQH
YRQNMFEI-------------RAEDQDFATKPMNCPCHCVLYKSQIRSYRDLPLKIAEYG
PLSRFEASGTLHGLLRVRGFHQDDAHLFVRPDQIEEQIREVIGLVDTIYGT-LGL--EYE
IKLSTR----PEDFMGDIELWNEAEAALARALDGMGRSYKLNPGDGAFYGPKLDFDVTDA
LGRKWQCATVQLDFQLPIKFDLTYIGEDGKEHRPVMIHRAIMGTLERFIGILTEHYAGNF
PLWMAPVQARVLPITDR-HHAYAGEVVAKLQEAGLRVEGDYRNEKVGYKIREAEL-LKIP
FILVVGDKEAEAGAVAVRRRG--MKDLGPMPLADFLALAQSEIASKAMDEACRKAASGTR
D
>gi|67920215|ref|ZP_00513735.1|	   642 residues, 50 /line  Threonyl-tRNA synthetase, class IIa [Crocosphaera watsonii WH 8501]
---------------------MIINLGYHDNDHHY-------------------------
-----------------------NNLPMVSQL-TQSPLSIANPEKLERIRHTCAHVMAMA
VQILF-PE--TK--VTIGPTTDKG---FYYDFDRP-QP-FAPEELKKITKQMRFIIKANL
PIIREEITREEMKAEIEQLGE-PYKLEILD--------SIPE-------G-ETITRY---
--YIGSTDGDGLPNVGQKLKDALPEPSSIKPVKIPSTVS--WWDLCAGHHINYTGEINPK
AFALESVAGAYWRGDETKAQLQRIYGTAWETPEQLDAYLKQREEAKRRDHRKLGKELKLF
SIQEN-AGGGLVFWHPRGAKMRYVIEDYWRKAHLDGGYELLYTPHVANLDLWKTSGHFDF
YRENMFDSM------------KIEEQAYQIKPMNCPFHVLTYKNELHSYREFPLRWAELG
TVYRYERSGVLHGLMRVRGFTQDDAHVFCLPTQIASEILGVLNLTEKILSD-FGFK-DYE
VNLSTR----PDKSVGTDEGWELATQALVEALNGKGWDYIEDKGGGAFYGPKIDIKIKDA
IGRTWQCSTIQVDFNLPERFDMEYVAVDGSRQRPIMIHRAIFGSLERFYGILIENYAGDF
PLWLAPIQLRLLPVSEA-QIEYGETVVATLKQAGYRVEIDCTGERLGKQIRNAEL-EKIP
VVAIVGKKEVETQTLSIRTRQ--QGDIGTMTLTELKESFKSAITNKAN------------
I
>gi|83594816|ref|YP_428568.1|	   643 residues, 50 /line  Threonyl-tRNA synthetase, class IIa [Rhodospirillum rubrum ATCC 11170]
----------------------MVAISLPDGSVRSYEG-PVTGRQIAE-DI-GPGLAKAA
LAVTI----------DGT--MKDLSVPITTDA-SVSLITARDAAALELLRHDAAHVMAQA
VQELY-PG--TQ--VTIGPAIENG---FYYDFARA-EP-FTPEDLERIEERMREIVGRDL
PIVREVWERDEAIAYFTKLGE-TYKAELIT--------GLPA-------N-EDVSVY---
--RQG---------------------------------D--WLDLCRGPHLPSTGKLG-T
AFKLMKLAGAYWRGDSRNPMLQRIYGTAWPDRKQLDAYLTMLAEAEKRDHRRVGQEMDLF
HLQEE--AQGAVFWHPKGWTVYRTLQNYMRRRLDLAGYVEVNTPMLVDRALWEKSGHWEK
FRQNMFIS-------------EAEDKLLAMKPMNCPCHIQIFKQGIKSYRDLPLRMAEFG
ACHRNEASGALHGLMRVRAFVQDDAHIFCTEDQIVSETQAFCDLLKSVYRD-LGFT-EIK
VKFSDR----PEVRAGSDETWDKAEAALREATDAAGLEWTLNPGEGAFYGPKLEFVLRDA
IGRDWQCGTLQVDFVLPERLGADYVGEDGDKHRPVMLHRAILGTFERFMGILIENCAGRF
PFWLAPVQVVVATITSD-ADDYARTVLAALKAKGLRAVADLRNEKINYKVREHSL-AKVP
VMLVVGRKEAETGGVALRRLG--GQSQEVLALDEAIATLANESVAPDLRAAPQ-------
G
>gi|91201672|emb|CAJ74732.1|	   640 residues, 50 /line  strongly similar to threonyl-tRNA synthetase [Candidatus Kuenenia stuttgartiensis]
----------------------MVKVTLPDGTKKDFED-NITIGEVAS-NI-NSKMGGIA
LAARA----------DGV--LVDLNYPIKDDI-SLSVITEETQEGLEIIRHSTAHIMAQA
VCRLF-PG--VK--LGIGPTIENG---FYYDFDCP-NH-FTTEDLKKIEDEMLKIIKEDI
RFERTDMPRELAVKEMEKSGQ-PYKVELIR--------DI-E-------D-DTVSFY---
--RQN---------------------------------E--FIDLCRGPHIQKTGRV--K
SFKLLSVAGAYWRGKETNSMLQRIYGTAFFTNEDLKKYLKMLEEAEKRDHRKIGKDLDLF
SFHED-GGAGLAFWHPKGARMRSIIEDFWRQEHFRRGYEILYSPHIAKINLWKTSGHWDF
YRESMYSPI------------DVDGHEYILKPMNCPFAVLIYKTKLHSYRDLPLRWGELG
TVYRYERSGVLHGLLRVRGFTQDDAHIFCTPDQLEQEILEVIKLAQFMLSS-FGFN-EYE
IELSVRGKGEKEKYIGRDDVWDHAEDALKIALEKTGLHYTRMEGEAKFYGPAIDIKVKDA
IGRGWQGPTIQVDFNLPERFDVNYVGSDGYHHRVVMIHRTVMGAMERFIGCLIEHFAGDF
PLWIAPIQMRILSITDA-QIDYAKKLQTELLLKNFRVECDIGNNKIGYKIREGTL-QKIP
YLLIVGNKEMEEGLVAVRSRK--NGDEGALPVRDFISKVEEEVRGKK-------------
-
>gi|114776996|ref|ZP_01452016.1|	   634 residues, 50 /line  threonyl-tRNA synthetase [Mariprofundus ferrooxydans PV-1]
-----------------------MNISLPDGSSRTLNE-GATAYDLAA-DI-GAGLARAT
IAATV----------NGK--QVDVSHQLHDGD-TVSLITEKSDEGLEVIRHSTSHLMAMA
VQEVF-PG--AQ--VTIGPVIEDG---FYYDFAYE-RA-FTPDDLTKIEEKMRQLSNQKL
PITREEWDRDAAIAHFEGIGE-IYKAKLIG--------RIPA-------G-ETVSLY---
--KQG---------------------------------E--WSDLCRGPHVPNTGVL--K
HFKLMKVSGAYWEGNSDNEQLCRIYGTAWASKGDLKAYLTRLEEAEKRDHRKLAKSLDLF
HLQEE--APGMIFWHPKGWSVWQQVENEIRGVMRDNGYQEIKTPQMVDRKLWEKSGHWDK
FREEMFTT-------------STENRDYAIKPMNCPCHIQVFNQNLHSYRDLPLRLAEFG
SCHRNEPSGTLHGLMRLRNFVQDDAHIFCTEAQIQDEVCNFIDLTYDVYKR-FGFD-DVI
IFLSDR----PEKRVGTDEQWDKAEAALHQALDSKGIEYGLNPGEGAFYGPKIEFSLKDC
LGRVWQCGTIQVDFSMPGKLDAEYVAEDSSRQTPVMLHRAILGSMERFIGILIEHYEGKF
PFWLAPVQVVACNITDA-QADYVAEVTKSMHKAGFRAEMDLRNEKVGYKVRAHTL-ARVP
YILVAGDREREDGTISVRDLS--GQNLGTFSVDDWIAEMVDMRSRHA-------------
-
>gi|120554978|ref|YP_959329.1|	   641 residues, 50 /line  threonyl-tRNA synthetase [Marinobacter aquaeolei VT8]
----------------------MPVITLPDGSHRSFAE-PVTVHDVAA-DI-GAGLAKAA
LAGKV----------NGK--LVDTSHLIENDT-ELAIVTERDEDGVDIIRHSTAHLMAMA
VQELF-PG--AQ--VTIGPVIENG---FYYDFKYE-RP-FTNEDMARIEKRMEELAKQDL
PVSRSIMSRDEAIKLFNEMGE-EYKVRIIE--------DIPG-------E-EDLSFY---
--RQG---------------------------------D--FIDLCRGPHVPSTGKL--K
AFKLTKVAGAYWRGDTSNEQLQRIYGTAWGNKKDLKAYLHRLEEAEKRDHRKIGKKLGLF
HMQEE--APGMVFWHPDGWSLYQEVEQYMRAQQHKHGYKEIKTPQVVSRTLWEKSGHWDK
FKDDMFTT-------------ESEKHDYAIKPMNCPCHVQVFNQGLKSYKDLPLRLAEFG
SCHRNEASGALHGLMRVRGFTQDDAHIFCEEDAIQEEVSAFIAMLHEIYAD-FGFS-EIL
YKLSTR----PEKRVGSDEVWDKSEAALEQALNREGVDWELLPGEGAFYGPKIEFSLKDC
LGRVWQCGTIQVDFSMPGRLGAQYVADNSERKTPVMLHRAVLGSFERFIGILIEEYEGAF
PTWLAPTQVAVLNITDK-QRDYCQNLAKKLDSSGYRVNADLRNEKIGFKIREHTL-NKVP
YLVVVGDKEIENNAVAVRTRK--GEDLGTMSVDDFEKLLAADVERKGRTKTE--------
I
>gi|115422477|emb|CAJ49002.1|	   650 residues, 50 /line  threonyl-tRNA synthetase [Bordetella avium 197N]
----------------------MVQITLPDGSQRQYPG-PVTVAEVAQ-SI-GTGLAKAA
LAGRV-----TVNDAEPK--LVDTSFRIDQDA-KLAIVTAKDADGLDLIRHSTAHLLAYA
VKSLY-PD--AQ--VTIGPVIDNG---FYYDFSYK-RP-FTPEDLQAIEKKMAELARKDE
VVTREEWTRDDAVAYFKSIGE-NYKAEIIA--------SIPS-------N-EKISLY---
--REG---------------------------------E--FIDLCRGPHVPSTGKL--K
VFKLMKLAGAYWRGDSNNEMLQRIYGTAWATKDEQDAYLHMLEEAERRDHRKIGRDLDLF
HFQDE--GPGLIFWHPKGWTLWQQVEQYMRAVYRDNGYQEVKAPQILDLSLWKKTGHWDN
YRENMFTT-------------ESENRVYGLKPMNCPGHVQIFNAGLHSYRELPLRYGEFG
QCHRNEPSGSLHGMMRVRGFTQDDGHIFCTEDQLQDECADFTALLQKVYRD-FGFT-EVL
YKVATR----PEKRIGSDEIWDKAETALMESLRRTGCEFEISPGEGAFYGPKIEYTLKDA
IGRHWQCGTIQVDFSMPVRLGAEYVDQNDQRRAPVMLHRAILGSLERFIGMLIENHAGAM
PPWLAPVQAVVCCISEP-SAEYAAKITQSLKKQGFRVQADLRGEKITRKIREHSL-QKVP
YILVVGDKEAQNGTVAVRGLG--GLDLGAIPFDDFVARLNEDVASRRNVVQPDSKA----
V
>gi|148244740|ref|YP_001219434.1|	   636 residues, 50 /line  threonyl-tRNA synthetase [Candidatus Vesicomyosocius okutanii HA]
----------------------MPIITLPDGTKKIFEQ-VVSVEQVAK-SM---GLVKAA
LAGEV----------DGE--LVSTSFLIKTDA-NLTIITANDDQGLEIIRHSTAHLLAQA
TQMLY-PD--AQ--VTIGPVIDNG---FYYDFAYK-NG-FLEGDLIKIEKNMHKLVKQNL
KIEKFEMSRDETLQFFKDKGE-YYKVKIIE--------SIST-------D-QILSLY---
--KQG---------------------------------D--FIDLCRGPHVPSTAKL--K
NFKLMKLAGAYWRGDSSNEMLQRVYGTAWGNEQDLKVYLHKLEEVARRDHRKIGKTQDLF
HIQEE--TPGMVFWHAKGWILYQLVEQYMRGIFRDNGYQEVHTPQLIDKSLWEKSGHWDK
FGDVMFTT-------------TSGDRDYAVKPMNCPAHIQIYNQGLKSYRNLPLRLAEFG
SCHRNEPSGTLHGIMRVRNFVQDDGHIFCTPEQIQDEVSTFIDLTFNVYKY-FGFE-KIN
IKLSTR----PKKRVGSDEVWDKSEIALVEALNAKNIVWELQEGEGAFYGPKIEFILKDC
LDRQWQCGTLQVDFSMPKRLGAQFIDENSVKKTPVILHRAIMGSLERFLGILIEHYEGAY
PCWLSPIQAVIINISEK-HAKFIVDIVKKLKKQGLRVISDLRNEKVSFKIREHSL-QRYP
YILVVGDREMEKGQVSVRQRG--GKDLGAMSVGTFIKKVNQETLLKNQIK----------
-
>gi|124023562|ref|YP_001017869.1|	   640 residues, 50 /line  Threonyl-tRNA synthatase [Prochlorococcus marinus str. MIT 9303]
----------------------MPIITLPDGNKKKFDQ-PVTIMEVAE-SL-GPGLAKAA
IAGRV----------NGV--LLDTCIPIEKDS-EVNIITAKDQDGIETIRHSFAHLIGHA
VKQLY-PE--AK--MAIGPVIEDG---FYYDIAYD-QP-FTPKDLEAIEARMKELVKLDY
DVNVEIVSREEAHKEFEKRCE-PYKIEIVD--------EIPE-------N-EIIKLY---
--RHQ---------------------------------E--YTDMCRGPHVPNTRHL--R
TFKLMKVSGAYWRGDSNKTMLQRIYGTAWGSSKELKAYLKRLEEAEKRDHRRIAKQMSLF
HTQEE--APGMIFWHAKGWAIYQVLEQYIRETLSLHAYQEIRTPQVVDRSLWEKSGHWEK
FKDDMFTT-------------TSENREYAIKPMNCPCHVQIFNQGLKSYRDLPIRLAEFG
SCLRNEPSGSLHGLMRVRNFVQDDAHIFCTELQVQEEVSKFIDLVFEIYRS-FGFD-SVL
IKLSTR----PEKRVGSDEIWDKSEKALSDALDAKGLAWDLLPGEGAFYGPKIEFSLKDC
LGRVWQCGTIQVDFSMPERLGASYVAEDSQRRTPVMLHRAILGSFERFIGILIEHYAGRM
PVWLAPVQVAVMGITDR-NAQTCQDVCKKLSALEYRTEVDLRNEKIGFKVREHTL-QRVP
FLIIIGDKEQQSGEVAVRTRE--GKDFGSMPLNSFISLLDEAIALKGRSGV---------
S
>gi|146307004|ref|YP_001187469.1|	   640 residues, 50 /line  threonyl-tRNA synthetase [Pseudomonas mendocina ymp]
----------------------MPTITLPDGSQRSFDH-PVSVLEVAQ-SI-GAGLAKAT
LAGKV----------NGK--QVDACDVIDTDA-TLQIITPKDEEGLEIIRHSCAHLVGHA
VKQLY-PN--AK--MVIGPVIDEG---FYYDIAID-RP-FTPDDMAAIEKRMAELIDKDY
DVIKKMTPRAEVIELFRSRGE-EYKLRLID--------DMPD-------E-KAMGLY---
--FHE---------------------------------E--YVDMCRGPHVPNTRFL--K
AFKLTRISGAYWRGDSKNEQLQRIYGTAWADKKQLAAYIQRIEEAEKRDHRRIGKQLDLF
HLQEE--APGMVFWHPNGWTVYQVLEQYMRQVQRENGYVEVRTPQVVDRILWERSGHWSN
YAENMFTT-------------ASENRDYAVKPMNCPCHVQIFNQGLKSYRDLPLRLAEFG
ACHRNEPSGALHGIMRVRGFVQDDAHIFCTEDQVKKEAADFIKLTLQVYAD-FGFT-DIA
MKLSTR----PAKRVGSEELWDRAEGALADALNESGLAWEYQPGEGAFYGPKIEFTLRDC
LGRNWQCGTLQYDPNLPERLDASYIAEDNNRKRPVMLHRAILGSFERFIGMLIEHYAGSF
PAWLAPTQAVIMNITDK-QADFAREAEKTLNQSGFRAKVDLRNEKIGFKIREHTL-LKVP
YLLVIGDREVETRSVAVRTRE--GVDLGSMPLEQFAAQLQQAVSRRGRQDL---------
E

Ad blocker interference detected!


Wikia is a free-to-use site that makes money from advertising. We have a modified experience for viewers using ad blockers

Wikia is not accessible if you’ve made further modifications. Remove the custom ad blocker rule(s) and the page will load as expected.