FANDOM


In the plant Arabidopsis thaliana, At2g04842.1 is a gene model for the locus At2g04842.[1]

This gene model is classified by TAIR as "threonyl-tRNA synthetase, putative / threonine--tRNA ligase, putative". It is located on chr2, region 1698463-1701268 REVERSE.

Physiological functionEdit

At2g04842.1/Function_____________The entry below does not belong to this gene_________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________ ______________ ________________ (At1g78590) NADK3 (At1g78590) is a NAD(H) kinase with a strong preference for NADH over NAD+. NAD(H) kinases phosphorylate NAD(H) with ATP (other phosphoryl donors are not used preferentially) to form NADP(H). Phosphorylation of NAD(H) is the sole known means of generating NADP(H) de novo.

Tissue expressionEdit

At2g04842.1/Expression

Subcellular localizationEdit

At2g04842.1/Localization_____________The entry below does not belong to this gene_________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________

NADK3-GFP has been shown by in vivo transient expression to be localized to the cytosol, confirmed by immunoblotting.

Biophysical propertiesEdit

The gene model At2g04842.1 has 650 amino-acid residues and a molecular weight Mw = 74.779 kDa.

The protein is relatively neutral; at the physiological pH 7.4, its net charge is -3.89, or -0.006 per residue._____________The entry below does not belong to this gene_________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________ NADK3-GFP has been shown by in vivo transient expression to be localized to the cytosol, confirmed by immunoblotting.

Knockout phenotypeEdit

At2g04842.1/Knockout

Protein interactionsEdit

At2g04842.1/Interactions_____________The entry below does not belong to this gene_________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________ This protein does not interact with calmodulin in the presence or absence of calcium or EGTA. NADK3 has been reported to be phosphorylated in vitro by AtMAPK4. NADK3 forms a homodimer.

Domain structureEdit

The gene model At2g04842.1 has 3 recognized domains:

  • Domain_0285_0451 tRNA-synt_2b domain (PF00587, IPR002314) Description: tRNA synthetase, class II (G, H, P and S);Molecular Function: aminoacyl-tRNA ligase activity (GO:0004812), Molecular Function: ATP binding (GO:0005524), Biological Process: tRNA aminoacylation for protein translation (GO:0006418)
  • Domain_0554_0643 HGTP_anticodon domain (PF03129, IPR004154) Description: Anticodon-binding;Molecular Function: aminoacyl-tRNA ligase activity (GO:0004812), Molecular Function: ATP binding (GO:0005524), Biological Process: protein biosynthesis (GO:0006412)_____________The entry below does not belong to this gene_________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________

NADK3 contains the conserved NAD(H) kinase domain, GSTAAMQSAGG for binding NAD and the upstream GGDGT ATP-binding domain.

Amino-acid sequenceEdit

>At2g04842.1
MASSHSLLFS SSFLSKPSSF TSSLRRFVYL PTRQFWPRQR HGFSTVFAVA TEPAISSSGP KKAEPSTVVL PSNESSDKLL KIRHTCAHVM AMAVQKLFPD AKVTIGPWID NGFYYDFDME PLTDKDLKRI KKEMDRIISR NLPLLREEVS REEAKKRIMA INEPYKMEIL DGIKEEPITV YHIGNEWWDL CAGPHVETTG KINKKAVELE SVAGAYWRGD EKRQMLQRIY GTAWESEEQL KAYLHFKEEA KRRDHRRIGQ DLDLFSIQDE AGGGLVFWHP KGAIVRNIIE ESWKKMHVEH GYDLIYTPHV AKADLWKISG HLDFYRENMY DQMEIEDELY QLRPMNCPYH ILLYQRKRQS YRDLPIRVAE LGTVYRYELS GSLHGLFRVR GFTQDDAHIF CLEDQIKDEI RGVLDLTEEI LSRFGFNKYE VNLSTRPEKS VGGDDIWEKA TCALRDALDD KGWSYEVDEG GGAFYGPKID LKIEDALGRK WQCSTIQVDF NLPQRFDITY VDTNSDKKRP IMIHRAVLGS LERFFGVLIE HYAGDFPLWL SPVQVRVLPV TDNQLEFCKE VSKKLRACGV RAELCHGERL PKLIRNAETQ KIPLMAVVGP KEVETGTVTV RSRFGGELGT IPVDDLINKI NIAVETRTAL
________________Given the above incorrect annotations, this may, or may not, be the correct sequence for At1g57680.1 _________________ ___________________________ ____________________ ___________ __________ __________________ __________________ _________________ _________________ MAIRKLLLLLKPIDPYPFLQTEGASLIKNPQVLQYLESRCKVHKNAIKFCQEILSKKPVE WKPISRNDLSHPIRDVDMVITVGGDGTLLHASHFIDDSVPVLGVNSDPTQAHEVEELSDQ FDASRSTGHLCAATVENFEQVLDDILFGRVVPAKVSRISLKLNSETLLSHALNDILIAQP CPAAVSRFSFKIKNKDGASSPKTVNCRSSGLRICTAAGSTAAMQSAGGFVMPMLSRDLQF MVREPISPGSTASLMHSTFKPDQFMDVNWYSDHGTIYIDGCQVQHSVQLGDTIEISSDAP VLNVFLSHGISQIRSRY-

Multiple sequence alignmentEdit

A full-length multiple-sequence alignment (MSA) is available here. This MSA may be visualized by submitting it to a server such as ESPript.

Protein structureEdit

A predicted structure for this protein is available here.

ReferencesEdit

  1. This is a test reference.

Further readingEdit

General database linksEdit

Ad blocker interference detected!


Wikia is a free-to-use site that makes money from advertising. We have a modified experience for viewers using ad blockers

Wikia is not accessible if you’ve made further modifications. Remove the custom ad blocker rule(s) and the page will load as expected.