FANDOM


>gi|15224046|ref|NP_178547.1|	   146 residues, 50 /line  ferredoxin thioredoxin reductase catalytic beta chain family protein [Arabidopsis thaliana]
---MNLQAVSCSFGF--LSSPLG--VTPRT--SFRRFVIRAK----TEPSEKSVEIMRKF
SEQYARRSGTYFCVDKGVTSVVIKGLAEHKDSYGAPLCPCRHYDDKAAEVGQGFWNCPCV
PMRERKECHCMLFLTPDNDFA--GKDQT------------------------------IT
SDEIKETTAN---------------M
>gi|119489844|ref|ZP_01622599.1|	   127 residues, 50 /line  ferredoxin--thioredoxin reductase catalytic chain [Lyngbya sp. PCC 8106]
--MLSSDT---------------------------MTTETNG----NLSTDKSLKAMKKF
AEQYAKRTGTYFCSDPSVTAVVIEGLAKHKDDLGAPLCPCRHYEDKEAEVKNTFWNCPCI
PMRERKECHCMLFLTPDNDFA--GEEQD------------------------------IT
PEDLEAARQSM--------------A
>gi|126661589|ref|ZP_01732623.1|	   122 residues, 50 /line  ferredoxin--thioredoxin reductase catalytic chain [Cyanothece sp. CCY0110]
-----------------------------------MTTTNTN----NNQSDKVLEAMKNF
AEQYAKRTDTYFCSEPSVTAVVIEGLARHKEELGAPLCPCRHYEDKEAEVKNTYWNCPCV
PMRERKECHCMLFITSDNEFA--GEEQE------------------------------ID
ITFIKDVREGMS-------------A
>gi|67922311|ref|ZP_00515824.1|	   123 residues, 50 /line  Ferredoxin thioredoxin reductase, beta chain [Crocosphaera watsonii WH 8501]
-----------------------------------MATINTD----KTQNDKVLEAMKNF
AEQYAKRTGTYFCSEPSVTAVVIEGLARHKEELGAPLCPCRHYEDKQAEVKNTYWNCPCV
PMRERKECHCMLFITSDNDFA--GEQQE------------------------------ID
LDFIKEVRENMS------------GK
>gi|119511697|ref|ZP_01630802.1|	   121 residues, 50 /line  ferredoxin--thioredoxin reductase catalytic chain [Nodularia spumigena CCY9414]
-----------------------------------MISSENN----TTSTDKSLEAMRHF
SEQYAKRTGTYFCSEPSVTAVVIEGLAKHKDDLGAPLCPCRHYEDKEAEVNATYWNCPCV
PMRERKECHCMLFLTPDNEFA--GDQQE------------------------------IT
LETIKEVRDSM--------------G
>gi|17231557|ref|NP_488105.1|	   121 residues, 50 /line  ferredoxin--thioredoxin reductase catalytic chain [Nostoc sp. PCC 7120]
-----------------------------------MISSEAN----TKSSDKSLEAMRHF
SEQYAKRTGTYFCSEPSVTAVVIEGLAKHKDELGAPLCPCRHYEDKEAEVKATYWNCPCV
PMRERKECHCMLFLTPESDFV--GEKQE------------------------------IS
LETIKEVRESM--------------G
>gi|75907863|ref|YP_322159.1|	   121 residues, 50 /line  Ferredoxin thioredoxin reductase, beta chain [Anabaena variabilis ATCC 29413]
-----------------------------------MISSEAN----TKSSDKSLEAMRHF
SEQYAKRTGTFFCSEPSVTAVVIEGLAKHKDELGAPLCPCRHYEDKEAEVKATYWNCPCV
PMRERKECHCMLFLTPESDFV--GEKQE------------------------------IS
LETIKEVRDSM--------------A
>gi|23127578|ref|ZP_00109445.1|	   124 residues, 50 /line  COG4802: Ferredoxin-thioredoxin reductase, catalytic subunit [Nostoc punctiforme PCC 73102]
--MSD------------------------------MITSEHN----TKSSDKSLEAMRHF
SEQYAKRTGTYFCSEPSVTAVVIEGLAKHKDELGAPLCPCRHYEDKEAEVHATYWNCPCV
PMRERKECHCMLFLTPDNEFA--GEKQD------------------------------IS
LETIKEVRDSM--------------G
>gi|56752366|ref|YP_173067.1|	   120 residues, 50 /line  ferredoxin-thioredoxin reductase catalytic chain [Synechococcus elongatus PCC 6301]
-----------------------------------MTQTTSP----ASASDKSLETMRKF
AETYAKRSGTYFCVDPGVTAVVLEGLAKHKEDLGAALCPCRHYEDKQAEVEVAFWNCPCV
PMRERKECHCMLFLTPDNEFA--GPNQE------------------------------IS
LEQIRATTQP---------------A
>gi|113955556|ref|YP_731678.1|	   140 residues, 50 /line  Ferredoxin thioredoxin reductase, catalytic beta chain [Synechococcus sp. CC9311]
--MAGVYS-------GFRSDYV-LS-SPPLSP--MSDASAGS----TEPTAESLEVIRKF
AETYAQRTGTYFCSDPGVTAVVLKGLAKHKDDLGGALCPCRHYEDKQAEVSQAFWNCPCV
PMRERKDCHCMLFLTEDNPFR--CEEQT------------------------------IS
TETIHATA-----------------G
>gi|148243118|ref|YP_001228275.1|	   118 residues, 50 /line  Ferredoxin-thioredoxin reductase catalytic chain [Synechococcus sp. RCC307]
------------------------------------MADDAQ----QPAASDSLEVIRRF
AETYAQRTGTYFCSDPGVTAVVLEGLARHKDELGGALCPCRHYEDKEAEVSQAFWNCPCV
PMRERKDCHCMLFLTEDNPFR--GEKQS------------------------------IT
LDEIQAHTS----------------G
>gi|33864854|ref|NP_896413.1|	   118 residues, 50 /line  Ferredoxin thioredoxin reductase, catalytic beta chain [Synechococcus sp. WH 8102]
-------------------------------------MSDAA----PEPTAESLEVIRKF
AETYAQRTGTYFCAESSVTSVVLKGLARHKDELGGALCPCRHYEDKEAEVSQAFWNCPCV
PMRERKECHCMLFLTEDNPFACPNKTQT------------------------------IS
TETIHATA-----------------G
>gi|87125291|ref|ZP_01081137.1|	   119 residues, 50 /line  Ferredoxin thioredoxin reductase, catalytic beta chain [Synechococcus sp. RS9917]
----------------------------------MTDPSAGN----PEPTAESLEVIRKF
AETYAQRTGTYFCSDPGVTAVVLKGLARHKDELGGALCPCRHYEDKEAEVSQAFWNCPCV
PMRERKECHCMLFLTEDNPFR--GDAQT------------------------------IS
TEEIHASA-----------------G
>gi|148240487|ref|YP_001225874.1|	   119 residues, 50 /line  Ferredoxin-thioredoxin reductase catalytic chain [Synechococcus sp. WH 7803]
----------------------------------MTDAPAGT----SEPTAESLEVIRKF
AETYAQRTGTYFCSDPGVTAVVLKGLARHKDELGGALCPCRHYEDKEAEVSQAFWNCPCV
PMRERKECHCMLFLTEDNPFR--GDEQT------------------------------IS
TETIHATA-----------------G
>gi|78213793|ref|YP_382572.1|	   118 residues, 50 /line  ferredoxin thioredoxin reductase, catalytic beta chain [Synechococcus sp. CC9605]
-------------------------------------MSDAP----QEPTAESLEVIRKF
AETYAQRTGTYFCADSSVTAVVLKGLARHKDDLGGALCPCRHYEDKEAEVSQAFWNCPCV
PMRERKECHCMLFLTEDNPFACPEKTQT------------------------------IT
TETINATA-----------------G
>gi|88807202|ref|ZP_01122714.1|	   119 residues, 50 /line  ferredoxin thioredoxin reductase, catalytic beta chain [Synechococcus sp. WH 7805]
----------------------------------MTDAPAGT----SEPTVESLEVIRKF
AETYAQRTGTYFCSDPGVTAVVLKGLARHKDELGGALCPCRHYEDKEAEVSQAFWNCPCV
PMRERKECHCMLFLTEDNPFR--GDDQT------------------------------IT
TETIHATA-----------------G
>gi|116073827|ref|ZP_01471089.1|	   116 residues, 50 /line  Ferredoxin thioredoxin reductase, catalytic beta chain [Synechococcus sp. RS9916]
-------------------------------------MLAGN----AEPTAESLEVIRKF
AETYAQRTGTYFCSDPGVTAVVLKGLARHKDELGGALCPCRHYEDKEAEVSQAFWNCPCV
PMRERKECHCMLFLTEDNAFR--GDAQT------------------------------IS
TEEIHATA-----------------G
>gi|14275859|emb|CAC39620.1|	   148 residues, 50 /line  ferredoxin-thioredoxin-reductase catalytic subunit B [Solanum tuberosum]
--MRTLQA-STSYSVGFGISSFA--TRPKP--STHRCLTVAK----MEPSEKSVEIMRKF
SEQYARRSETYFCMDKGVTSVVIKGLAEHKDTLGAPLCPCRHYDDKAAEAQQGFWNCPCV
PMRERKECHCMLFLTPDNDFA--GEEQT------------------------------IS
MEEIKETTAN---------------M
>gi|3913670|sp|O49856|FTRC_SOYBN	   144 residues, 50 /line  Ferredoxin-thioredoxin reductase catalytic chain, chloroplast precursor (FTR-C)
---MTTQA-ST-FA--VAVPSVA--TPFRR--HRNPFVVRAQ----AEPSDKSVEIMRKF
SEQYARKSGTYFCVDKGVTSVVIKGLADHKDTLGAPLCPCRHYDDKAAEVAQGFWNCPCV
PMRERKECHCMLFLTPDNDFA--GNEQT------------------------------IT
LDEIKESTAN---------------M
>gi|47155380|dbj|BAD18925.1|	   154 residues, 50 /line  ferredoxin [Codonopsis lanceolata]
MNMRALQA-STSHSSGFGVSSFSTSSPPTCLFHRRLMIVQAK----AEPTQKSVEIMRKF
SEQYARKSGTYFCVDKGVTSVVIKGLADHKDALGAPLCPCRHYDDKAAEATQGFWNCPCV
PMRERKECHCMLFLTPDNDFA--GQEQS------------------------------IT
LEEIKESTTN---------------M
>gi|115478160|ref|NP_001062675.1|	   146 residues, 50 /line  Os09g0249900 [Oryza sativa (japonica cultivar-group)]
--MMSMAS-TTASPF--CPSPMP--RGRKC--TVRVQAGAAG----ADASDKSLEIMRKF
SEQYARRSNTFFCSEKSVTAVVIKGLADHKDQLGAPLCPCRHYDDKAAEVAQGFWNCPCV
PMRERKECHCMLFLTPDNDFA--GQDQA------------------------------IT
LEEIKDATSK---------------I
>gi|125562905|gb|EAZ08285.1|	   163 residues, 50 /line  hypothetical protein OsI_029517 [Oryza sativa (indica cultivar-group)]
--MALHRT-CLLV-------------------AIVLGAGAAG----ADASDKSLEIMRKF
SEQYARRSNTFFCSEKSVTAVVIKGLADHKDQLGAPLCPCRHYDDKAAEVAQGFWNCPCV
PMRERKECHCMLFLTPDNDFA--GQDQACSFFTMFSSQIPSSSPLSLHERHFYKFLKAIT
LEEIKDATSK---------------I
>gi|147852954|emb|CAN81270.1|	   160 residues, 50 /line  hypothetical protein [Vitis vinifera]
---MSLQA-SSSYAF--GISSFV--SPPRR--VRHVPEIRAK----VEPSDKSVEIMRKF
SEQYARKSGTYFCVDKGVTSVVIKGLADHKDSLGAPLCPCRHYDDKAAEAGQGFWNCPCV
PMRERKECHCMLFLTPDNDFA--GQDQR------------------------------RT
SKFFSSVFEFKVAEAMQGLCGMPESK
>gi|88911224|gb|ABD58902.1|	   136 residues, 50 /line  chloroplast ferredoxin-thioredoxin reductase [Mesostigma viride]
-------------GS--LVRPVA--ARPQS--RVRRVAARAA----HEPTDASLEVMRKF
SEQYASRSNTFFCVDKSVTAVVIKGLAEHKDTLGAPLCPCRHYDDKQAEAENGYWNCPCV
PMRERKECHCMLFLTPENDFA--GQEQK------------------------------IS
MEEVKELTKG---------------M
>gi|1346045|sp|P41348|FTRC1_SPIOL	   144 residues, 50 /line  Ferredoxin-thioredoxin reductase catalytic chain, chloroplast precursor (FTR-C) (Ferredoxin-thioredoxin reductase subunit B) (FTR-B) (B2)
--MKALQA-SIAYSF--PISSPA--ASPRR--FSR--VIRAQ----ADPSDKSMEVMRKF
SEQFCRKSDTYFCVDKSVTAVVIKGLADHRDTLGAPLCPCRHYDDKEAEAKQGFWNCPCV
PMRERKECHCMLFLTPDNDFA--GKEQT------------------------------IT
LDEIREVTSN---------------M
>gi|729535|sp|P41347|FTRC_MAIZE	   152 residues, 50 /line  Ferredoxin-thioredoxin reductase catalytic chain, chloroplast precursor (FTR-C) (Ferredoxin-thioredoxin reductase subunit B) (FTR-B)
--MTSTVT-TTVGCGGLPVRPLS--TATRG--RPRRCAVRAQAAGADASNDKSVEVMRKF
SEQYARRSNTFFCADKTVTAVVIKGLADHRDTLGAPLCPCRHYDDKAAEVAQGFWNCPCV
PMRERKECHCMLFLTPDNDFA--GKDQV------------------------------IS
FEEIKEATSK---------------F
>gi|729537|sp|P41349|FTRC2_SPIOL	   148 residues, 50 /line  Ferredoxin-thioredoxin reductase catalytic chain, chloroplast precursor (FTR-C) (Ferredoxin-thioredoxin reductase subunit B) (FTR-B) (B1)
--MKALQA-STSYSFFSKSSSAT--LQRRT--HRPQCVILSK----VEPSDKSVEIMRKF
SEQYARKSGTYFCVDKGVTSVVIKGLAEHKDSLGAPLCPCRYYDDKAAEATQGFWNCPCV
PMRERKECHCMLFLTPENDFA--GKDQT------------------------------IG
LDEIREVTAN---------------M
>gi|113475259|ref|YP_721320.1|	   121 residues, 50 /line  ferredoxin thioredoxin reductase, beta chain [Trichodesmium erythraeum IMS101]
--MT--------------------------------LATEKK----NLSSDKSLNAIKNF
AERYAKKTNTYFCIDPSVTAVVIEGLAKHKEDLGAPLCPCRHYEDKQAEVKATYWNCPCV
PMRERKECHCMLFLTPDNDFA--GEQQE------------------------------IT
QEDLESTRKN---------------M
>gi|87301374|ref|ZP_01084215.1|	   123 residues, 50 /line  ferredoxin-thioredoxin reductase catalytic chain [Synechococcus sp. WH 5701]
--MSD--------------------------------APSAT----AAPSSDNLELIRRF
AEAYAKRTDTYFCSDPGVTAVVLEGLARHKDQLGAALCPCRHYEDKQAEAEQAFWNCPCV
PMRERKECHCMLFLTEDNPFR--GEQQT------------------------------IG
LEEIKTHIEPPA-------------A
>gi|90994577|ref|YP_537067.1|	   124 residues, 50 /line  ferredoxin-thioredoxin reductase beta subunit [Porphyra yezoensis]
--MTINEA---------------------------ILMKKQN----LVSFPENLEAMRKF
SETYAKRTGTFFCIDSSVTAVVIEGLARHKDQYGAPLCPCRHYEDKKAEISATYWNCPCV
PMRERRECHCMLFLTPDNEFA--SDLQE------------------------------ID
KTTLTEQIS-----------------

Ad blocker interference detected!


Wikia is a free-to-use site that makes money from advertising. We have a modified experience for viewers using ad blockers

Wikia is not accessible if you’ve made further modifications. Remove the custom ad blocker rule(s) and the page will load as expected.