FANDOM


MQLSSSFPISPPKIFPSTKHHKPPV----ITHQLAAQI--QSNRRHFVSPVKVSGYFSSI
SRAIEEEEEY----RKARAAVNRKG----------------VELESYAIEG---------
--------------------ISVGGHETCVIVPELKCVFDIGRCPSRAIQQKFLFITHAH
LDHIGGLPMYVASRGL--YNL--------E--PPKIFVPPSIKEDVEKLLEIH-------
----------------------------RTMGQVELNVELI-PLA---------------
------------------------VGETYE-----LRNDIVVRPFATHHV-IPSQGYVIY
SVRKKLQKQYAHLK------GKQ--IEKIKKSG-VE-IT----------DTILSP-----
EIAFTGDTTSEYMLD---PRNADAL------RAKVLITEATFLDESFSTE-HAQAL-GHT
HISQIIENAKWIRSKTVLLTHFSSRYHVEEI---------REAVLKLQS----KVSAK--
VIPLT-EGF---------------------------------------------------
------------------------------------RSRYS
>gi|104781771|ref|YP_608269.1|	   320 residues, 50 /line  Ribonuclease Z [Pseudomonas entomophila L48]
----------------------------------------------------MDLQFLGT
SSGVPT--KA----RNVSATAVIE----------------ATGHGWYLVDCGEGTQHQLL
RS------------------------------------------PLSMRDLRAIFITHVH
GDHCFGLPGLLASAGM--SGRK-------A--PLPLIMPTALHDWVRQGLAAS-------
----------------------------DTYLPFELQLQAL-ET----------------
-------------------------FDGF------TCGNIQVGKVELSHR-VPSYGFVFD
EQDPEPRLDTARLQADGVPAGPL--WGQLARGMTVE--H-EG--RQLDPQHYLQPQRPPQ
RIIVCGDND---RPE---LLAELAK------GVDVLVHESTFTEP--VVE-RAQATFGHS
TAAAVARFAEAAQVPNLVLTHFSARYQGAGAA---RGSSIEDVREEALA----H--YR-G
NLVLA-QDLQRYHLARDGRLVEV-------------------------------------
----------------------------------------L
>gi|26990736|ref|NP_746161.1|	   319 residues, 50 /line  metallo-beta-lactamase family protein [Pseudomonas putida KT2440]
----------------------------------------------------MDLLFLGT
SAGVPT--KA----RNVSATAVIE----------------ASGSHWYLVDCGEGTQHRLL
HT------------------------------------------PLSIRDLRAIFITHVH
GDHCFGLPGLLASAGM--SGRT-------Q--PLEVILPAVLHDWVRQGLVAS-------
----------------------------DTFLPFELRLLPV-EE----------------
-------------------------LIAW------RSETLQVTTVQLSHR-VPSVGFVFT
EINPEPRLDIQRLDAEGITRGPL--WGELAKGLTVT--Y-DG--QLLNGNDYLRPSRPPR
RVIVCGDND---KPE---LLAAVAR------GADVLVHEATFTQA--VVE-RTGGTFGHS
TAAEVARFAEAAGVRNLVLTHFSARYQNDPR----RSPHIDNVRDEALA----H--YS-G
QLTLA-QDLQRYHLGRNGLLEAS-------------------------------------
----------------------------------------A
>gi|146283279|ref|YP_001173432.1|	   337 residues, 50 /line  metallo-beta-lactamase family protein [Pseudomonas stutzeri A1501]
--------------------------------------------------MPVDLLFLGT
SSGTPT--RA----RNVSALALLE----------------ETGKAWYLIDCGEGTQHRLL
RT------------------------------------------PLSLHDLRAICITHVH
GDHCYGLPGLLASAGM--MGRK-------A--PLTIIAPQGIETWVRATLSMS-------
----------------------------QSWLSYELDFHAV-ET----------------
-------------------------LDEW------RSPNMRIEATELSHR-VPCYGYSFS
EARPDPRLDIERLEHDGVPRGPL--WGQLARGFDIE--H-EG--RVLRSHDYLSFSRSPR
RIVVGGDND---RPD---LLAEACR------DAQLLVHEATYTEA--VAN-DARNDFGHS
TAATVARFAQAVGLPNLVLTHFSARYQKHVG----RGHSIEDLRAEAAA----L--YA-G
QLLLA-EDYLRLHLGKDGLLTVVEP-----------------------------------
--------------------------PSTSRPPRRDGESRA
>gi|110669277|ref|YP_659088.1|	   318 residues, 50 /line  Ribonuclease Z (RNase Z) (tRNA 3 endonuclease) [Haloquadratum walsbyi DSM 16790]
----------------------------------------------------MRATFLGT
GGAVPT--TE----RGPSAFFVE------------------RDGERLLFDCGEGTQRQMM
RF------------------------------------------GTG-FSLSHIFVTHLH
GDHILGIPGLIQTLDF--NDRT-------D--ALAIHGPPGSKPHLRHLVETA-------
----------------------------GYRPGYPINIREI-RPG---------------
-------------------------SVAV------DTEEYIIRSFETSHRGVTSIGYALI
ESDRKGRFNRDRAESLGVPVGPK--FGRLHDGESVK-LA-DG--SIVHPEQVVGDSRPGR
RVVYTGDTR---PTE---TTVEAAN------NADLLVHDATFAAD--RAS-RAKQT-GHS
TAQEAAQIATRADARQLALTHVSSRYAGD----------VTPLESDATA----A--FDGQ
RAFVP-DDGYTLDIPFPDADDNHL--------SD--------------------------
--------------------------------------NIP
>gi|115646024|ref|XP_001202680.1|	   333 residues, 50 /line  PREDICTED: hypothetical protein, partial [Strongylocentrotus purpuratus]
------------------------------------------------------------
-------------------------------------------REAWLIDCGEGTQIQLM
RS------------------------------------------NVRPGRITKIFITHLH
GDHSFGLPGLMCTLSAAFMDPD----REGS--IMHIYGPQGLRKYVRVSLELS-------
----------------------------RSELSYSYVVHEL-QVPDTEFPHD-WETWKPS
HEAEGSLHPNEKTGQAIFM-TADGTYKLH------EDDNFIIHAATISHR-VPCFGYVFL
EKPQPGRLDAEMLKARGIKPGPL--YARIKAGHEIE-AP-DG--SVIKPQDVVGPTRQGR
KIVILGDTK---ESS---RIIPIAM------NADVLVHEATLADE--HHD-LCIGR-GHS
TPAMAGQFAAQIQCEHLVITHFSQRYYPLSHQGKEGDETVQKLLDQTRA----T--FPGG
KVTAA-EDFLTISVPARR------------------------------------------
-----------------------------------------
>gi|116333981|ref|YP_795508.1|	   317 residues, 50 /line  Metal-dependent hydrolase of the beta-lactamase superfamily III [Lactobacillus brevis ATCC 367]
----------------------------------------------------MEIEFLGT
GAGSPG--KF----RNVTSTALRLL---------------DERNSVWLFDVGEATQHQIL
RT------------------------------------------TLKPRKIDKIFITHLH
GDHIFGLPGLLSSRSF--QGG-------DA--PLTIYGPKGIRNFVEVSLRVS-------
----------------------------ETKLSYKIRYQELT------------------
-----------------------TDGLVF------EDGKFRVYAQHLDHR-IECFGYRIE
EKDHPGELQVEQLQAAKIPSGPV--YGQLKAGKTVT-LP-DG--RVINGADFLGPAQPGR
IVAILGDTR---QTP---NAEKLAI------NADVLVHESTFAK--GESK-LARSY-YHS
TNIQAAELAKRMHVKQLLLNHISARYTG------KM---AAELQHQARE----V--FK--
QTRVV-KDFDEIEVPFEKLTKEGT------------------------------------
---------------------------------------PS
>gi|116618569|ref|YP_818940.1|	   318 residues, 50 /line  Metal-dependent hydrolase of the beta-lactamase superfamily III [Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293]
----------------------------------------------------MQLEFLGT
GSGQPS--KF----RNVTSIALRLL---------------DERNAVWLFDVGEATQHQIL
KT------------------------------------------TLRPRKVEKIFITHLH
GDHIFGLPGFLSSRSF--QGAD-----KNE--PLTIYGPKGVKEFVQTALRIS-------
----------------------------ETRLSYPIEYVDLT------------------
-----------------------E-GVIF------EDHTFQVVAAPMRHR-IETWGFRVI
EKDHPGELLVDKLKQGNIPSGPV--YGQLKAGKTVT-LP-DG--RIVNGHDFIGKAQKGR
IVTFILDTR---PND---NVEWLAK------NADVLVHESTYGSSEEEAK-MAKAH-AHS
TSANAASVARRAHVNKLVLTHLSARYIG------PM---VKELIHDVRR----N--FA--
NTYVA-RDFDIIDIPFKKDSNES-------------------------------------
----------------------------------------K
>gi|90962068|ref|YP_535984.1|	   317 residues, 50 /line  Ribonuclease Z [Lactobacillus salivarius subsp. salivarius UCC118]
----------------------------------------------------MELEFLGT
GAGSPS--KS----RNVSAVALKLL---------------DEIKKIWLFDVGEGTQHQIL
NT------------------------------------------TIRPRKIDKIFITHMH
GDHIFGLPGFLSSRSF--QGGE-----KMG--PLTIYGPKGISDFVNISLKVS-------
----------------------------QTKLSYELNFVELE------------------
-----------------------EEGLLL------ENDRFKVYAYKLDHR-IECWGYRIE
EKDYPGELQVEKLREAKAPSGPI--YGRLKAGEVVT-LE-DG--RTIDGKDFIGKAKKGR
IVTILGDTR---QTP---NLKLLAK------DADVLVHESTFGK--GEGK-LARNY-HHS
TCVQAATLAKEVGVKQLLLTHISARYVG------KM---VKVLEKEAKK----V--FP--
NTKVV-KDFDTFNIPFPERKDDE-------------------------------------
----------------------------------------Q
>gi|116491094|ref|YP_810638.1|	   325 residues, 50 /line  Metal-dependent hydrolase of the beta-lactamase superfamily III [Oenococcus oeni PSU-1]
----------------------------------------------------MELEFLGT
GAGQPS--KQ----RNVTSIALRLL---------------DERNEVWLFDVGEATQHQLL
KS------------------------------------------NTRSRKVTKIFITHMH
GDHIFGLPGFLTSRNF--QGSELIDGGKPT--DVTIYGPAGLQQYVFSVLRAA-------
----------------------------QVRLQYRINFIQV-R-----------------
------------------------PGIIF------EDQQFAVSAFPMNHG-IEDYAYRVV
EKDTVGQLQVEKLLKLGLKSGPL--FGKIKAGEIVK-LE-NG--LTINGKDFLGPDRPGR
IIAIVLDTK---DTP---EIIKAAE------QADVLVHEATYGAE--NSI-MAKRH-GHS
TSLQAAEHARAAHAHQLILTHISARYLG------KM---ADQLVKQAKN----V--FR--
PTYIA-HDLEIFDIPAKKSERKDK--------ID--------------------------
---------------------------------------VG
>gi|116494840|ref|YP_806574.1|	   320 residues, 50 /line  Metal-dependent hydrolase of the beta-lactamase superfamily III [Lactobacillus casei ATCC 334]
----------------------------------------------------MEIQFLGT
GAGSPS--KS----RNVSSLALKLL---------------DERNEVWLFDAGEGTQHQIL
QT------------------------------------------AIRPRKIAKVFITHLH
GDHIFGLPGFLASRSN--QGGT-------D--PLTIYGPSGIEDFVKTSLKVS-------
----------------------------QSHLSYPLKFVLLQ------------------
-----------------------HPGVAF------EDQTFKVTFDRLDHR-ITSFGFRIE
EKPHPGELLIDKVRAAKIPSGPV--YAALKAGETVT-LP-DG--RIFDGHDFIGPAQPGR
TVAIFGDTR---MCN---RALPLAA------GADVLVHESTFGPD--ESQ-LAKQY-YHA
TNVQAAALAKRAGVGRLLLNHISARYLS------PGV---AMLEKTARQ----I--FP--
NTHVV-KDFEEINIPFRSEQSEPA--------VT--------------------------
--------------------------------------VKS
>gi|121536418|ref|ZP_01668196.1|	   314 residues, 50 /line  ribonuclease Z [Anaeromyxobacter sp. Fw109-5]
---------------------------------------------------MLRLTFLGT
SAAQPT--IH----RNLTGLAVR------------------RDRELFLVDCGEGTQRQMI
RF------------------------------------------GTG-FDVDAIFFTHFH
ADHYLGAIGFLRTLSM--QGRT-------T--AMDVYGPRPAKRLLDVMLFTG-------
----------------------------TERLAFDVRIHEV-A-----------------
------------------------PGADV------RRDGCLMRPFATVHR-TPSVGWALV
EDERPGRFHPERAAALGVPKGPL--YGALQRGEAVT-LG-DG--RVVQPEQVVEPRRRGR
TVVVTGDTR---PCA---GTIAAAR------GADLLVHDCTFGDA--EQA-RARET-MHS
TAREAAGVAREAGVRELVLTHLSTRYDR----------DWQPLVDEARA----E--WA-G
SLSVA-SDGMTIEVPLPDELAGAP--------AP--------------------------
----------------------------------------G
>gi|124009422|ref|ZP_01694099.1|	   315 residues, 50 /line  ribonuclease Z [Microscilla marina ATCC 23134]
---------------------------------------------------MFQVTILGS
GAALPV--IAPDFRRYPTSQIVSLP------------------HTHLLIDCGEGTQMRLQ
EL------------------------------------------KIRINRIKHIFISHLH
GDHYLGLIGLLSSMHL--NKRN-------Q--DLYLYGPPGLAEIISVQLKYS-------
----------------------------QTRFNYKIHFKEL-KV----------------
----------------------GESEEIM------SDGMFTIRTIPLSHR-IPCNGFLIQ
ENPKKRKIIKEKIPE-EIWDWQY--AKTLQKGDDIL-DP-EG--KVLISAKDVTVQPKSR
AYAYCSDTA---YHE---PIIEHIK------GVDMLYHEATFTSE--EID-RATDT-FHS
TARQAATIATKAEVGKLLIGHFSSRYRN----------YLDPLIKEARE----V--FS--
ESYLA-VEGSTFVLEKELMPV---------------------------------------
----------------------------------------E
>gi|125564150|gb|EAZ09530.1|	   365 residues, 50 /line  hypothetical protein OsI_030762 [Oryza sativa (indica cultivar-group)]
MAAT----------------SLLSLP----------------------SLRLTHRLLVPA
SSSAPA--SR----SQFQTLAAKKAAVATGTGEGGGGGRGAGGGLLSVLDRAMADEEEYR
RARAQVQRKGVEVEGYAIEGVSVGGHETCVTVPSLNVAFDIGRGPLFAVSQDYLFITHAH
LDHIGGLPMYIATRGL--YNLK-------P--PV-VFVPPCIKDDVEDLLQIH-------
----------------------------RRMSQVDLKVELV-ALD---------------
------------------------LGETFE-----IRNDLVARPFETHHA-IPSQGYVIY
SVRRKLKKQYAHLK----------------GNQIMK-MK-QS--GAEITDTILYP-----
EVAFTGDTKSDFILD---PQNADAL------RAKVLITEATFLDDQIDVD-HAREH-GHM
HLSEIMEHSQWFRNKAIVLTHFSNRYSLEDI---------RQAVSKLQS----KLSSK--
VVALT-EGF---------------------------------------------------
------------------------------------KSDYR
>gi|126179500|ref|YP_001047465.1|	   317 residues, 50 /line  ribonuclease Z [Methanoculleus marisnigri JR1]
--------------------------------------------MVRIAGETLHVHFLGT
AGALPS--PQ----RNPSCLLIR------------------RGSDTLLFDCGEGAQQQMM
RA------------------------------------------RTG-FTVNAVFITHWH
ADHFLGVFGLVETLAF--MGRT-------D--PLPIYGPPWVGEFVDLVQRIS-------
----------------------------RHTRGFSVTAHVL-E-----------------
------------------------HGSVV------PFNGYTVRAFTTLHG-IPGLGYVLE
EDERPGRFNRERAIELGVPPGPL--FGRLQRGEEVRVVR-DGVETAVRPADVMGEPRPGR
KIVYTGDTR---PLQDQPGIAALIR------GADLLIHDATFDDQ--ESD-RARDV-LHS
TAGEAGEAATALGARMLALMHISSRYAST----------ANHIHDAKRQ-------YE-G
DVILP-ADLAVLEIPYRS------------------------------------------
-----------------------------------------
>gi|149199049|ref|ZP_01876089.1|	   352 residues, 50 /line  Metal-dependent Hydrolase of the beta-lactamase superfamily III [Lentisphaera araneosa HTCC2155]
-------------------MLMVFIVEE----------------KYTSRGFILQFHFLGT
SAGSPT--VE----RNVTALGFMP----------------RGRKNWWLFDCGEGTQQRLL
RS------------------------------------------SLSLPKLNKIFITHMH
GDHCYGLFGLLTSRGLM-SGGE-------E--AVHIFGPKGIKEMIKTVLKLS-------
----------------------------YVNLSAPLTFTEFDE-----------------
------------------------AGDLF------EDDEFIVSNVRLSHD-VPSWGYVVK
EKDRPGSFDSAKAIRDGIKPGPI--YSKLKNAEMVT-LE-DG--REVNGADYVGETQKGR
VALIGGDND---RPQ---LFGDALK------GAAVMIHEATHTEEA-MAG-LSFRS-RHS
TAKRVAEVAEENQVKNLVLTHFSPRFITKKRKG---MKCVDEIEDEAKE----F--FH-Q
DLHMA-RDYDVYELDRESKLKLID--------SRYRKDH---------------------
------------------------------------KSLNK
>gi|15669696|ref|NP_248509.1|	   324 residues, 50 /line  hypothetical protein MJ1502 [Methanocaldococcus jannaschii DSM 2661]
----------------------------------------MR--NNSKKMIIMKLIFLGT
GAAVPS--KN----RNHIGIAFKFG------------------GEVFLFDCGENIQRQML
FT------------------------------------------EVSPMKINHIFITHLH
GDHILGIPGLLQSMGF--FGRE-------K--ELKIFGPEGTKEIIENSLKLG-------
----------------------------THYIEFPIKVYEI-YT----------------
----------------------KEPITIY------KEENYEIIAYPTEHG-IPSYAYIFK
EIKKP-RLDIEKAKKLGVKIGPD--LKKLKNGEAVK-NI-YG--EIIKPEYVLLPPKKGF
CLAYSGDTL---PLE---DFGKYLK----ELGCDVLIHEATFDDS--AKD-AAKEN-MHS
TIGDAVNIAKLANVKALILTHISARYDK------EEYFNLYKMNVKQYN------ESF--
KIIIS-EDLKSYDIKKDLL-----------------------------------------
----------------------------------------G
>gi|22325471|ref|NP_178532.2|	   354 residues, 50 /line  CPZ [Arabidopsis thaliana]
>gi|51011089|ref|NP_001003503.1|	   372 residues, 50 /line  elaC homolog 1 [Danio rerio]
--------------------------------------------------MSMDVTFLGT
GSAYPS--PH----RGASALVLRT------------------EGENWLFDCGEGTQIQLM
KS------------------------------------------TLRAGKISKVFISHLH
GDHLFGLPGLLCTISL--NLNP---QPDQPPPCVDIYGPRGLRLFIRVALQLS-------
----------------------------GSQLLFPYAVHEL-QPSDEQCPEEGRLSPALT
TASETLH-PQERPGRTVHPDPDTDCYHLI------DDKQFVVKAFKLFHR-VPSFGFSVE
ERERPGRLNTDLLKELGLKPGPL--YGRLKNGQSVT-LD-SG--RVLTAGEVLEPPLKGR
KVCVFGDCSA-PLGE---GFKRACY------GADVLVHEATLENG--QQE-KAVEH-GHS
TPGMAAAVALTCEAKTLVLHHFSQRYKPENLRRDDDEDDVSELKRQAEL----VLQGSRT
DVILA-EDFLTLPVVLKRNST---------------------------------------
----------------------------------------T
>gi|72161928|ref|YP_289585.1|	   318 residues, 50 /line  ribonuclease Z [Thermobifida fusca YX]
-------------------------------------------------MSTRELIVLGT
SSAVPT--KR----RAHNGYFLRWD------------------GHGILFDPGEGTQRQMR
YA------------------------------------------GISAHDITRVCVTHFH
GDHSLGLPGVIQRIAR--DGVT-------H--PVRVAYPAAGQEYWER-LRYA-------
----------------------------TSFVDTEVIEAQPL------------------
---------------------AGDEVVVS------GEDEFTVTALPLDHS-IPTYGYRIA
EPDRVHML-ADRLAARGIR-GPA--VGRLKAEGFLI-DA-AG--NRVELADY-SVVRPGQ
VFAFVMDTG---VCD---TAVRLAE------RADLLVIEATFLNA--EAE-LAARY-RHL
TAGQAGMIAAQAGVRRLVLTHFSERYGR------EE---EDRFIAEAAA----C--FS-G
EIVLA-QDVMRVAVPSRRSEGGGT--------VA--------------------------
---------------------------------------GA
>gi|85081287|ref|XP_956690.1|	   359 residues, 50 /line  hypothetical protein [Neurospora crassa OR74A]
-----------------------------------------------MAPSPPQQPAPGS
QSQPKP--AK----TLTFATPLPQ----------------SARSDILEWSLPKPFSHYIL
TG------------------KSRAAWHTSFVIPQLNLLLDAGL-VINKSRPKHIFITHGH
NDHALSSPVFI--------KRE-------D--PPDFHCPVGMKQVLEDYLRANTMLNLGG
LIAPRPGKELPLEIRDPETGEVVRSEIRPTHVTYGLEAGDVV------------------
--------------------------PLR------RTKNISAVAFACDHT-VPCLGYLFQ
QTTHKLKPEFAK-----LPPKEL--KAIRASGQELT------------------APVTSP
IFAFLGDTT---TKT---LEEEPMRGWLTNDKLPVVITECSFLYE--EHRAQAEKT-KHT
IWADLEKVIRKYPETTFVVMHFSLRYSV------GQV---RRFFKERAE----G--LD--
NVVVW-VDGEGEDGDDVGGEGE--------------------------------------
------------------------------------MGDED
>gi|86606310|ref|YP_475073.1|	   324 residues, 50 /line  ribonuclease Z [Synechococcus sp. JA-3-3Ab]
----------------------------------------------MTDPNAIRVTFLGT
SSGMPT--RQ----RNVSGVAVQF----------------PQRSEWWLFDCGEGTQHQLL
RL------------------D-----------------------ELRPSQLRRIFITHMH
GDHIYGLPGLLASCGL--GSTP-------Q--HIDIYGPPGLEEYLKTVLRYS-------
----------------------------ESRIPYSFRVHTV-E-----------------
------------------------TGLIL------QDPEYWVFCAPLDHR-VPAFGYRVV
EQDRPGTFDVAKAQADGIPPGPL--YGQLKAGQSI--LW-QG--RWFHGRDYVGAPIPGR
KFSYCTDTI---FCR---NAVDLSR------AADLVIHEATYAEA--DRE-LAERA-KHS
TAAMAARVAAEAKAQTLILTHFSPRYTS------EGPITLEDLLAEARA----I--FP--
NTILA-RDRMTYEIPRRSPAPLPV--------G---------------------------
----------------------------------------V
>gi|88602980|ref|YP_503158.1|	   316 residues, 50 /line  Ribonuclease Z [Methanospirillum hungatei JF-1]
--------------------------------------------MDIIAGETLQIFFLGT
SGALPT--IS----RNLPCILLKWG------------------SHDLIFDCGEGAQRQMM
KA------------------------------------------RAGFSP-EVIYISHWH
ADHFLGVIGLLQTMSF--NGRE-------Q--PLMIVGPDCVHEMVNDIKGLC-------
----------------------------RTRLSFPVESQKV-R-----------------
------------------------AGDLL------IYEGYSIRVFAADHG-IPGVGYIFE
ENMRPGRFNRERAIELGIRPGPL--FGKLQRGSSVT-ITVDGEERIITPEMVMGPMRPGR
KVIYTGDTRP-V-LS---ELADIGD------DADLLIHDATFDHQ--EEE-RAIEF-MHA
TAAEAGMVAHTLKAHRLALFHFSTRYTS-----------ADNHVSDAKT----H--FS--
GDILAPDDLTVFDIPFRDE-----------------------------------------
-----------------------------------------
>gi|93279549|pdb|2FK6|A	   320 residues, 50 /line  Chain A, Crystal Structure Of Rnase ZTRNA(THR) COMPLEX
----------------------------------------------------MELLFLGT
GAGIPA--KA----RNVTSVALKLL---------------EERRSVWLFDCGEATQHQML
HT------------------------------------------TIKPRKIEKIFITHMA
GDHVYGLPGLLGSRSF--QGGE-------D--ELTVYGPKGIKAFIETSLAVT-------
----------------------------KTHLTYPLAIQEI-E-----------------
------------------------EGIVF------EDDQFIVTAVSVIHG-VEAFGYRVQ
EKDVPGSLKADVLKEMNIPPGPV--YQKIKKGETVT-LE-DG--RIINGNDFLEPPKKGR
SVVFSGDTR---VSD---KLKELAR------DCDVMVHEATFAKE--DRK-LAYDY-YHS
TTEQAAVTAKEARAKQLILTHISARYQG------DASL---ELQKEAVD----V--FP--
NSVAA-YDFLEVNVPRGKLAAALE------------------------------------
---------HHHHH--------------------------H
>gi|124541043|ref|ZP_01703923.1|	   315 residues, 50 /line  ribonuclease Z [Methanococcus vannielii SB]
----------------------------------------------------MKLTFLGT
GAAVPT--KY----RSHPSVALKFD------------------GEIFLFDCGENTQRQII
FT------------------------------------------DVSPMKINNIFISHLH
GDHILGIPGLLQSIAF--QGRK-------K--PLNIYGPPETKEMIKNMLKIG-------
----------------------------YHSIDYPINIHEA-SI----------------
----------------------ESPEMIIASSNNSNGNNYEVYTFPVKHS-VPSISYLFK
QIKKP-QMDIKKAETLGIEIGPD--LKKLKDGFSIQ-LK-NG--KVITPKDVTIPPKKGY
CIGYSGDTI---PID---EFGKFLK----YHGCNVLIHEATFDSS--MQK-NAVDT-MHS
TILDALDILEKSGARTLIATHISARYDD------IMSFERDIVKFKEKN------PEI--
EILIA-EDFLEYVLK---------------------------------------------
-----------------------------------------
>gi|134045752|ref|YP_001097238.1|	   314 residues, 50 /line  ribonuclease Z [Methanococcus maripaludis C5]
----------------------------------------------------MKLTFLGT
GAAIPT--KY----RAHPSISLKFD------------------GEIFLFDCGENTQRQII
FT------------------------------------------DVSPMKINNIFISHLH
GDHVLGIPGLLQSIAF--QGRT-------K--PLNIYGPEETAKMIKNILNVG-------
----------------------------YHSIDYPINVYEI-SS----------------
----------------------KTSEKII------STDNYDVFSFPVVHS-VPAVAYVFR
QVKKP-RMDLEKVNKLGIEIGPD--LKRLKDGYNVE-L--NG--KIITPEDVTLPPKKGI
CVGYSGDTI---PLN---EFADFLK----ELKCTILIHEATFDKT--MDK-NAKET-LHS
TVHDALNIAKRSGANTVILTHISARYDE------LSAFEKDVVEFKVEH------PDL--
HVLIA-EDLMEYSLKGKWVK----------------------------------------
----------------------------------------M
>gi|145642550|ref|ZP_01798089.1|	   322 residues, 50 /line  ribonuclease Z [Methanococcus aeolicus Nankai-3]
----------------------------------------------------MKIIFLGT
GAAIPT--KH----RNHSSVGIKYD------------------GEVFLFDCGEGTQRQMI
YT------------------------------------------DISPMKINNIFISHLH
GDHILGLAGLLQSIGF--NGRT-------E--PINIYGPPEIKNTIENILKIG-------
----------------------------YHSINFKITVHEI-NS----------------
----------------------KKPMKII------DSEKYMAYAYPVNHS-IPCYAYILK
EKKKP-QLNLKKAMELGVEVGPD--LKSLKDGNEVK-LK-NG--KIIYPNDVLLPPKDSM
CVAYSGDTM---PIE---DFGEFLN----SIGCTVLIHEATFGSS--KKN-NAVET-MHS
TIEDAVNIGKIACVDTVILTHISARYDD------NIEIYYNEIENIIKNNNEYNDNNF--
KIIVA-EDLMEYDLKNKETIK---------------------------------------
----------------------------------------K
>gi|126320779|ref|XP_001364239.1|	   368 residues, 50 /line  PREDICTED: similar to D29 [Monodelphis domestica]
--------------------------------------------------MSMDVTFLGT
GSAYPS--PT----RGASAIALRF------------------EGACWLFDCGEGTQTQFM
KS------------------------------------------QLKAGRITKIFITHLH
GDHFFGLPGLLCTISL--QNSS---SASKT--PMEIYGPVGLRNFIWKTMELS-------
----------------------------HSELTFPYIVHEL-VPTEDQCPPG-ELKDFSS
LDKMDSI-PKEIQGRTILLDSAEESYVLV------NDEQFLVKAFRLFHR-IPSFGFSVA
EKERPGRLNAQKLKDLGVPPGPA--YGKLKNGVTVV-LE-NG--VKVSPQDVLEKPIPGR
KICILGDCSG-VVGD---GGVKLCF------EADLLVHEATLDNA--HMD-KAKEY-GHS
TPQMAAEFAKMCKVKKLVLTHFSQRYKPHLLSGEGEADDIRELKKQAES----VLDFQ--
EVTLA-EDFMVIDIPKKKTISI--------------------------------------
----------------------------------------T
>gi|62859611|ref|NP_001017028.1|	   363 residues, 50 /line  elaC homolog 1 [Xenopus tropicalis]
--------------------------------------------------MSMDVTFLGT
GSAYPS--PC----RGASAVVFRT------------------EGECWLFDCGEGTQTQFM
RS------------------------------------------PLKAGRITKIFITHLH
GDHMFGLPGFLCTVSL--QCGC---TPSKQ--LVDIYGPVGLREFVQRSLEIS-------
----------------------------HSQLVFPYVVHEL-VPSPDQCPAE-EFKDFSS
RGGESCL-ATEEQGRTIYASPEDGSYELI------ADEQFTVKAFKLFHR-IPSFGFVIE
ERERPGKLNMQKLKELGIQPGPV--CGKLKLGATIT-LD-NG--QKVSPSDVLGDPIPGR
KVCILGDCSG-VIAV---GGAKLCC------DADVLIHEATLDDS--QMD-KAKEH-GHS
TPKMAADFANLCCARKLVLTHFSQRYKPPGLVTEGD-EDVTVLKQQAES----ALPGQ--
HVTLA-EDFMTITIPMKKQ-----------------------------------------
-----------------------------------------
>gi|73945502|ref|XP_849493.1|	   374 residues, 50 /line  PREDICTED: similar to Zinc phosphodiesterase ELAC protein 1 (Ribonuclease Z 1) (RNase Z 1) (tRNase Z 1) (tRNA 3 endonuclease 1) (ElaC homolog protein 1) (Deleted in Ma29) isoform 2 [Canis familiaris]
--------------------------------------------------MSMDVTFLGT
GAAYPS--PT----RGASALVLRC------------------EGECWLFDCGEGTQTQLM
KS------------------------------------------QLKAGRITKIFITHLH
GDHFFGLPGLLCTISL--QSGS---VVTKQ--PIEIYGPAGLRDFIWRTMELS-------
----------------------------HTELVFPYVVHEL-VPTADQCPTE-EQKEFTH
VNEMDSL-PKEGQGRTILLDSEENSYLLV------DDEQFVVKAFRLFHR-IPSFGFSVV
EKKRPGKLNAQKLKDLGVPPGPA--YGKLKNGISVV-LD-NG--VTISPQDVLKKPIVGR
KICILGDCSG-VVGD---GGVKLCF------EADLLIHEATLDDA--QMD-KAKEH-GHS
TPQMAAAFAKLCQAKRLVLTHFSQRYKPVALAREGEADGIVELKKQAES----VLDLQ--
EVTLA-EDFMVNKFRSRSETIFLM------------------------------------
------------------------------------RLTCL
>gi|120555084|ref|YP_959435.1|	   323 residues, 50 /line  Ribonuclease Z [Marinobacter aquaeolei VT8]
----------------------------------------------------MEFTFLGT
SAGTPT--RS----RNVTGLALCL----------------SGPKPWYLVDCGEGTQHQLM
RT------------------------------------------RYSVMQLRAMFITHIH
GDHIFGLPGLLTSASM--LGRT-------E--PLDIIAPPQVRRFIDAVIENS-------
----------------------------DSSLSYPLNFINSE------------------
-----------------------APDFYW------QDDHLGVTNVALSHR-VPCRAYVFT
ERNLERQLQKEKLVADGIEPGPQ--WGDLQKGKDVL-LD-DG--RLLRSNDYTHIPRTAR
KIIVGGDND---TPE---LLKDACQ------GTHVLIHEATYTQD--VADRVGPWP-QHS
SAQQVARFAQATKLPNLVLTHFSSRYQSAP----GGSPHINQLAAEALQ----H--YK-G
QLFLA-RDFDTYRLEKDFQLHKVD------------------------------------
---------------------------------------HN
>gi|126667041|ref|ZP_01738016.1|	   322 residues, 50 /line  Metal-dependent Hydrolase of the beta-lactamase superfamily III [Marinobacter sp. ELB17]
----------------------------------------------------MEFTFLGT
SAGTPT--RS----RNVTALALSH----------------SGHKPWYLVDCGEGTQHQLL
RA------------------------------------------HYSVMQLRAIFITHIH
GDHTFGLPGLLTSASM--LGRT-------E--PLDIVAPVQTQRFINATLENS-------
----------------------------DSSLGYTLNFINSE------------------
-----------------------APDFCW------KDQDFGVTNVALSHR-VPCRAYVFT
ERNIERQLLQDKLNEDGIEPGPN--WGELQKGNDVM-QE-DG--RLLRSADYTQTPRVAR
RLIVAGDND---DPT---LLTGACK------GSHALIHEATYTQD--VADRVGPWP-QHS
SAEQVGRFAQQAQLPNLVLTHFSSRYQSAP----GVTPNINQLAAEAMQ----H--YL-G
PLFMA-RDFDAYRLEKDLSLICLS------------------------------------
----------------------------------------A
>gi|113474494|ref|YP_720555.1|	   321 residues, 50 /line  ribonuclease Z [Trichodesmium erythraeum IMS101]
----------------------------------------------------MQITFLGT
SSGVPT--RS----RNVSSIALRL----------------PQRAELWLFDCGEGTQHQFL
RS------------------------------------------DLKVSQLSRIFITHMH
GDHVFGLMGLLASCGL--GGNV-------K--SVTLYGPPALEDYLQAGLRYS-------
----------------------------QTHLAYPIKVHKS-K-----------------
------------------------PGVIY------EDDEYVVSCAYLKHR-VTAFGYRVT
EKDRPGHFNVEKAKALGIPPGPI--YRKLKQGEFVT-LP-DG--RKINGADLCGAPHVGR
KFVYCTDTV---FCD---GAVELSQ------GADLLVHEATFSHQ--DAE-MAFQR-LHS
TSTMAAQVALAAGVKHLMMTHFSPRYAP------GNSVLLDDLLQEARA----I--FP--
NTDMA-YDFLSYEIPRWNEVSQLL--------AK--------------------------
--------------------------------------ARS
>gi|119490850|ref|ZP_01623133.1|	   315 residues, 50 /line  ribonuclease Z [Lyngbya sp. PCC 8106]
----------------------------------------------------MQITFLGT
SSGVPT--RS----RNVSSIALRL----------------SQRAELWLFDCGEGTQHQFL
RS------------------------------------------DLKISQISRIFVTHMH
GDHVFGLTGLLASCGL--AGNV-------K--RIDLYGPPGLQEYLQASLRFS-------
----------------------------QTHISYPFTVHPV-Q-----------------
------------------------PGVVY------EDDEYIVSCQPLKHR-VTAFGYRIT
EKDKPGRFNVDKAKALGIPPGPI--YAKLKQGGVVT-LA-DG--RKINGSQFCGEPIAGR
KFVYCTDTV---FCD---SAVELAK------DADVLVHEATFAHQ--DAE-LAFQR-LHS
TSTMAAQVALMAGVKKLIMTHFSPRYAP------GNAILLDDLLTEAKA----I--FP--
NTDLA-YDFFSYEIPKLEETVAA-------------------------------------
-----------------------------------------
>gi|126661173|ref|ZP_01732250.1|	   318 residues, 50 /line  ribonuclease Z [Cyanothece sp. CCY0110]
----------------------------------------------------MEITFLGT
SSGVPT--RS----RNVSSVALRL----------------PQRAEVWLFDCGEGTQHQLL
RS------------------------------------------DVKISQITRIFVTHMH
GDHIYGLTGLLASCGL--AGSG-------Q--PIEIYGPPELKDYLKACAKYS-------
----------------------------HFKLPHHIRFHPI-H-----------------
------------------------PGILY------EDKEFSVSCGQLKHR-IPAYGYRIA
ESDRPGRFNVEKAKALGIPPGPV--YGELKQGKTVT-LE-DG--RRIRGQDLCGERETGR
KVIYCTDTV---FCE---GAIALSE------DADVLIHEATFAHQ--DAQ-LAFDR-LHS
TSTMAAQVALAAQVKQLIMTHFSPRYAP------GNALQLDDLLQEAKA----I--FP--
NTILA-RDFMTYEVPRRSQIETSK--------I---------------------------
----------------------------------------G
>gi|16331469|ref|NP_442197.1|	   326 residues, 50 /line  ribonuclease Z [Synechocystis sp. PCC 6803]
----------------------------------------------------MEITFLGT
SSGVPT--RN----RNVSSIALRL----------------PQRAELWLFDCGEGTQHQFL
RS------------------------------------------EVKISQLTRIFITHLH
GDHIFGLMGLLASSGL--AGSG-------Q--GIEIYGPEGLGDYLEACCRFS-------
----------------------------STHLGKRLKVHTV-RE----------------
------------------------NGLIY------EDKDFQVHCGLLKHR-IPAYGYRVE
EKQRPGRFNVEQAEALGIPFGPI--YGQLKQGKTVT-LE-DG--RRIRGQDLCEPPEPGR
KFVYCTDTV---FCE---EAIALAQ------EADLLVHEATFAHQ--DAQ-LAFDR-LHS
TSTMAAQVALLANVKQLIMTHFSPRYAP------GNPLQLENLLAEAQA----I--FP--
NTRLA-RDFLTVEIPRRTADPAIA--------MSTPQA----------------------
--------------------------------------SPA
>gi|75908619|ref|YP_322915.1|	   345 residues, 50 /line  ribonuclease Z [Anabaena variabilis ATCC 29413]
-------------------------MPSNHATI---EDI-ALNIARKRLENAVQITFLGT
SSGVPT--RA----RNVSSVALRL----------------PQRAELWLFDCGEGTQHQIL
RS------------------------------------------DLKVSQLSRIFITHLH
GDHIFGLMGLLASCGL--AGNV-------Q--RVDIYGPSGLNEYIQSASRYS-------
----------------------------HTHFSYPIKIHTV-R-----------------
------------------------PGVIY------EDDEFTVTCGLLHHR-ITAFGYRVA
EKDRAGRFDIEKAKELQIPPGRV--YGQLKRGETVT-LE-DG--RVINGAELCGPTEIGR
KMAYCTDTI---YCD---GAVELAQ------DADVLIHEATFAHQ--DSE-MAFQR-LHS
TTTMAAQTALAAGVRRLLMTHFSPRYAP------GNTIELKDLLQEARA----I--FP--
RTDMA-YDFMTYEVPRRREPILSS--------V---SS----------------------
--------------------------------------SSV
>gi|113955240|ref|YP_731447.1|	   315 residues, 50 /line  Ribonuclease Z (RNase Z) (tRNA 3 endonuclease) [Synechococcus sp. CC9311]
----------------------------------------------------MQVTFLGT
SSGVPT--RG----RNVSSVALRL----------------PQRSELWLFDCGEGTQHQFL
RC------------------------------------------DLRLSQLRRVFITHMH
GDHVFGLPGLLASLGL--GSTS-------N--GVDLYGPDPLDAYLQGVLRTS-------
----------------------------STRIGYPLAIHRV-REA---------------
---------------------AEQNTVVF------EDDDLIVTAAPLNHR-VPAYAYRAE
QKPRAGRFDIDKARELQIPPGPV--YAALKRGESVT-LD-DG--RTIDGRTLCGPEQPGV
SVVYCTDTV---FCE---AAVQLAQ------GADLLIHESTFSHA--EAD-MAFKR-QHS
TSTMAAQTAAEAGVKQLALTHLSPRYAP------GNAVTADDLVAEASA----I--FP--
NTILA-RDFLNVDVNPSK------------------------------------------
-----------------------------------------
>gi|116071259|ref|ZP_01468528.1|	   327 residues, 50 /line  Ribonuclease Z [Synechococcus sp. BL107]
--------------------------------------------MKDRELTTLQVTFLGT
SSGVPT--RA----RNVSAVALRL----------------PQRSEMWLFDCGEGTQHQFL
RS------------------------------------------ELRLSQLRRVFVTHMH
GDHVFGLPGLLASLGL--AGNS------NE--GVDLYGPDPLESYLNGVLRTS-------
----------------------------STRIGYPLKVHRV-HDC---------------
---------------------AENGTLVY------EDDDLMVRCTPLTHR-VPAYAYRVD
QKPLAGRFDIAKAKDLQIPPGPI--YAQLKQGDTVT-LE-DG--RIIDGTTLCGPERPGV
SVVYCTDTV---FCE---AAVDLAQ------GADLLIHESTFAHQ--ESE-MAYQK-MHS
TSTMAAQTAAEANVGQLVLTHLSPRYAH------GNAVTPEDLLKEAQA----I--FP--
NTCLA-KDFLTLEVKPRCNS----------------------------------------
----------------------------------------L
>gi|56752093|ref|YP_172794.1|	   393 residues, 50 /line  ribonuclease Z [Synechococcus elongatus PCC 6301]
----------------------------------------------------MQVTFLGT
SSGVPT--RS----RNVSAVALRL----------------PQRAEVWLFDCGEGTQHQFL
RS------------------------------------------ELRISQLRRIFVTHMH
GDHVFGLMGLLASVGL--AGNP-------E--RIDLYGPKPLRDYLQACAQHS-------
----------------------------RTHINYPLQIATV-Q-----------------
------------------------PGVIY------EDAEIVVSCAPLHHR-VPAFGYRIQ
ERDRPGRFDVEKARSLGIPPGPI--YKQLKDGETVT-LE-DG--RQIDGRQLCGPTERGR
SMVYCTDTI---FCE---SAIALAQ------DADVLIHESTFSDR--DRE-MAEQR-LHA
TATMAAEVAKQAGVRQLILTHFSPRYAP------GNEQTLDDLLAEAQA----I--FP--
QTMLA-KDFLSYDVPRRLAADADEPTEVPAVAKSPSQPEPSAIVPDSRRKPQITKEVLVA
RFSGEGEPAHRAAYRYLRETCGVTPKGRSWEAVLAAFNSLD
>gi|124026481|ref|YP_001015596.1|	   314 residues, 50 /line  Metallo-beta-lactamase superfamily enzyme [Prochlorococcus marinus str. NATL1A]
----------------------------------------------------MQVTFLGT
SSGVPT--LN----RNVSAMVLKP----------------PQRSELWLFDCGEGTQHQFI
RS------------------------------------------NLKLSQIKKIFITHMH
GDHIYGLPGLLASIGL--AGSS-------S--GIELYGPAPLKNFIDSCLYNS-------
----------------------------SSRLAYSLKFHRV-ENA---------------
---------------------ANNKEILF------EDSELEVKTAPLKHR-IPSFAYRVN
QKTRPGRFDIEKAKLKGIPPGPV--YADLQRGEEVR-LE-DG--RIFSGKEFCGPPRPGV
SMVYCTDTV---YTE---SAIEISR------KADLLIHESTYSYK--ETE-MAYER-GHS
TATMAAQIAAKANVDQLILTHLSPRYTP------GNQTCPNDLLNEAKA----I--FP--
NTQLA-KDFLQIDLNKS-------------------------------------------
-----------------------------------------
>gi|84517526|ref|ZP_01004875.1|	   327 residues, 50 /line  Metallo-beta-lactamase superfamily protein enzyme [Prochlorococcus marinus str. MIT 9211]
---------------------------------------------MIDHLRKLQITFLGT
SSGVPT--RS----RNVSALALRL----------------PQRSELWLFDCGEGTQHQFL
RS------------------------------------------DLRTSQLRRIFITHMH
GDHIYGLPGLLASLGL--AGNS-------S--GIDLYGPNPLSNYLNGVLKSS-------
----------------------------SSRISYPFQIHSV-EKV---------------
---------------------AEDNQIVF------EDKDFIVRCKPLIHR-IPAFAYRVD
QKPRPGRFNLEKAKAFNIPPGPV--FAKLKLGQQVR-LE-DG--RIINGKDFCGPQKAGK
SIVYCTDTI---FSK---AAIQLAK------GADLLIHESTFADK--DTD-MAFQR-KHS
TSRMAAQTAKEAGVGKLVLTHLSPRYAP------GNAFSPNDLLKEAKE----I--FP--
NTLLA-KDFMQIDIEKPETVRD--------------------------------------
----------------------------------------T
>gi|148242938|ref|YP_001228095.1|	   333 residues, 50 /line  Ribonuclease Z [Synechococcus sp. RCC307]
-------------------------MPWHHQ-------------SWGSQPAPLQVTFLGT
SSGVPS--RS----RNVSAVALRL----------------PQRADLWLFDCGEATQHQFL
RS------------------------------------------ELRVSQLRRIFITHMH
GDHVFGLPGLLASLGM--AGTC-------D--GVDLYGPEPLEAFVLSALQHS-------
----------------------------ATRIGYPLRFHPV-ESA---------------
---------------------ANSGEPLL------IDGEFSVCCAPLKHR-VPAFGYRVQ
QSERPGRFDIAKAKAMRLPPGPE--FARLKAGETVT-FA-DG--RRIDGRELCGPRQPGC
SVVYCTDTV---FSE---RAVALAQ------GADLLIHEATFSHR--DAA-MAYQR-QHS
TSTMAAQTAAEAGVQQLALTHLSPRYVP------GATESPDDLLQEAKA----I--FP--
NTVLA-KDFLSIEVSTMACNS---------------------------------------
----------------------------------------L
>gi|33240879|ref|NP_875821.1|	   320 residues, 50 /line  Metallo-beta-lactamase superfamily enzyme [Prochlorococcus marinus subsp. marinus str. CCMP1375]
----------------------------------------------------MQITFLGT
SSGVPT--RS----RNVSALALRL----------------PQRSELWLFDCGEGTQHQFL
RS------------------------------------------DLRTSQLKKIFITHMH
GDHIYGLPGLMASLGL--AGNS-------L--GLDLYGPSALKGFLDGILKSS-------
----------------------------SSRISYPMKIHGL-ELE---------------
---------------------SAENKIIF------EDNDFLVTCTPLIHR-VPAFAYRVD
EKAKPGRFDVEKAKALRIPPGPI--YSQLQKGQIVK-LK-DG--RIFNGNDFCGPQRKGA
SFVYCTDTM---FAQ---TALKLAN------GADLLIHEATFSHE--DSD-LAYQR-QHS
TSTMAAQIASEANVGQLVLTHLSPRYAP------GNRISPNDLLSEAKS----I--FP--
NTLLA-KDFLQIEIQKHATVRD--------------------------------------
----------------------------------------T
>gi|37523688|ref|NP_927065.1|	   317 residues, 50 /line  hypothetical protein gvip548 [Gloeobacter violaceus PCC 7421]
----------------------------------------------------MLLTFLGT
SSGTPT--RS----RNVTSIALQL----------------PQRSSLWLFDCGEGTQHQVL
RT------------------------------------------PLRLSQLEKVFFTHLH
GDHLFGLVGLLASRALG-SAGT-------T--PVKLYGPPGLQEYVRATLRYS-------
----------------------------DTHINYPIHFQTV-E-----------------
------------------------PGLVL------SEEGFTVLANALKHR-ISAFGYSVI
EHDQPGRFDAERAAQLGIPFGPL--YGQLKAGRTVA-LP-DG--RTVDGRTLVGPERKGR
KLTYCSDTI---YTP---SAIELAL------GADVLIHEATYCEA--DLN-LAERG-LHS
TAAMAARVAREAKVRQLILTHFSPRYEA------G----LAALRTEAEA----I--FP--
NVRMA-EDFWRYEIKAVEAQLPKA--------LV--------------------------
---------------------------------------EQ
>gi|52549192|gb|AAU83041.1|	   335 residues, 50 /line  metallo-beta-lactamase [uncultured archaeon GZfos26D6]
--------MENTRCSRCTRWQKISLSYIRYNHL---------------LFCMLRITFLGT
GGSTPT--PN----RNPSAIAVN------------------REGELILFDCGEGAQQQMM
RA------------------------------------------K-SGMKITSIFISHFH
ADHVLGIPGLLQTMAL--QDRQ-------E--PLEIYGPKQVDKFLYHLLALG-------
----------------------------YAGRNFEVKAIEL-R-----------------
------------------------PGDVV------RRAGYEIRVIKTVHN-IPSIGYVLE
EDMRPGRFNREKAIELGIKPGPF--FSKLQSGRSIL-L--DG--KEIRPEQVVGPPRPGR
KIVYTGDTR---PCD---SVIEASE------NADLLIHDSTLSEE--TKE-YAINY-MHS
TALEAAEVAKKASVRKLILTHISARYSD------PGG--ASKLEEEARS----M--FE--
NTEVA-KDLMTEEVGYRDG-----------------------------------------
----------------------------------------E
>gi|57641049|ref|YP_183527.1|	   314 residues, 50 /line  ribonuclease Z [Thermococcus kodakarensis KOD1]
---------------------------------------------------MLEVFFLGT
GGIMPT--RE----RNVPAIALR------------------YKGEIILFDAGEGTIRQMN
TA------------------------------------------KLSPMKVDKIFITHFH
GDHYLGIPALIQTMNL--WDRQ-------K--PLHIYGPKYTFQFVQNLLNSG-------
----------------------------FFRPGFDIHVHELGE-----------------
------------------------T--RL------KFGDYEIWSFKVEHG-IPALGYVFK
EKDRRGKFLKEKLREYGLEEGPI--LGKLEREGKIE-W--NG--RIIRLEDVTGPRRKGL
KIVYTGDTE---PCE---RVKLFSE------RADLLIHEATYLNP--GDR---GDS-YHS
TVEEACDTARRAKVKLLALFHRAFRYSY------EDY--VEEALKICES----L--GV--
RAVVP-RDFDVITFKSGTWELRNL--------LE--------------------------
--------------------------------------ERE
>gi|62180883|ref|YP_217300.1|	   334 residues, 50 /line  ribonuclease Z [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67]
---------------------MVEILPVNHDALLCCGNLGLNDN--QTCMDKMELIFLGT
SAGVPT--RS----RNVTAILLHLQ--------------HPTQPGVWLFDCGEGTQHQML
NT------------------------------------------AFHPGKLERIFISHLH
GDHLFGLPGLLCSRSM--AGNP-------H--PLTVYGPQGVREFIATTLRLS-------
----------------------------GSWTDFPLQIEEI-S-----------------
------------------------AGDIL------DDGLRKVTAFRLEHP-LECYGYRVV
EHDKPGALNARALKAAGVTPGPL--FQALKAGKTVT-LA-DG--RQINGADYLAPAVAGK
SVAIFGDTA---PCE---AALALAQ------GVDVMVHETTLDAS--MEE-KANAR-GHS
STRQTATLAREAAVGRLIMTHISSRYDD------KG---CQRLLAECRA----I--FP--
ATELA-YDFSVFPV----------------------------------------------
-----------------------------------------
>gi|75759266|ref|ZP_00739366.1|	   318 residues, 50 /line  Ribonuclease Z [Bacillus thuringiensis serovar israelensis ATCC 35646]
----------------------------------------MRDRVLELEERKWNCIFRNW
CRCSFK--RK----ERFSNALQLL----------------EERGQTWLFDCGEATQHQIL
HT------------------------------------------SVRPRRIEKIFITHLH
GDHIFGLPGLLGSRSF--QGGT-------T--PLTVYGPKGIKQFIEVALSVS-------
----------------------------TTHVKYPLEVVEITE-----------------
------------------------EGTVF------EDNEFYVETKRLSHG-IECFGYRIV
EKDIQGALLVDKLLEMGVKPGPI--FKRLKDGEVVE-LE-DG--TILNGNEFIGPPQKGR
IITILGDTR---YCE---ASRELAQ------DADVLVHEATFAAE--DEQ-QAHDY-FHS
TSKQAASIALQANAKRLILTHISSRYQG------DT---YKELLKEARE----L--FS--
NTEIA-TDLKSFPVEK--------------------------------------------
-----------------------------------------
>gi|124005252|ref|ZP_01690093.1|	   314 residues, 50 /line  hypothetical protein M23134_07750 [Microscilla marina ATCC 23134]
-MVEGHP-----------------------------------------FRQWRKWTIPNT
TFTIEG--YS----RSGDKTFFYI----------------PQLKLCLDAALAEG------
------------------------------------------------RQGDYVLVTHTH
NDHIADIEYLASRNG------------------VQIYLPKASQNYLEEYIIARRCLNHSA
PYNP------------------------RLRGSYSI--TGV-------------------
--------------------AGGDTFYIG------KNDRYQVKVVNCEHS-IVCVGYAFA
EKKQRLKPEYEALKQQKMAEGKMQEFGQLMAQK-------KQ--EAKQKGETVEETYYQP
LFVFMGDTHASVF-----DNNAWLF------DYPTIITECTFLKP--VNEAYANER-CHT
HWKHLKPHINQHPKCQFVLTHFSFRYTSQEIVNF--------FEQELTQSQ--------T
NNVLI-WLSSDTLLPQQHESK---------------------------------------
----------------------------------------K

Ad blocker interference detected!


Wikia is a free-to-use site that makes money from advertising. We have a modified experience for viewers using ad blockers

Wikia is not accessible if you’ve made further modifications. Remove the custom ad blocker rule(s) and the page will load as expected.