Fandom

Proteins Wiki

At2g04400.1/MSA

< At2g04400.1

47,923pages on
this wiki
Add New Page
Talk0 Share
>gi|15228142|ref|NP_178521.1|	   402 residues, 50 /line  indole-3-glycerol phosphate synthase (IGPS) [Arabidopsis thaliana]
MEGLV-PVQRLPIKVASPSLYRCNN---SVSIRRSISGFAMDRKINFRAPSQFSIRAQQS
DLKES--LAVSSSSVEDKGNVLRIKEWEVEMYQEELAISQG--------IRIRRKPPS--
------------KAPLGY--------------SGPFEL------------------RLH-
--NNDADSPRNILEEITWYKDVEVSRMKELNPL-------DVLKKAVEDAP-P-TRDFVG
ALRMAHKRTGFPGLIAEVKKASPSRGILKENFDPVEIAQAYEKGGAACLSVLTDQKYFQ-
--------------GGFENLEAIRS-----AGVKCPLLCKEFVVDPWQIYYARTKGADAV
LLIAAVLADLEITFLLKICKKLSLAALVEVHDEREMGRVLGIE------GIELVGINNRS
LETFEVDISNTKKLLEGEHGRQIRERDMIVVGESGLFTPDDIAYVQAAGVKAVLVGESIV
KQN----------DPEKGIAGLFGRNISH-------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------------------T
>gi|108563658|ref|YP_627974.1|	   452 residues, 50 /line  N-(5'-phospho- ribosyl)anthranilate isomerase [Helicobacter pylori HPAG1]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------MPSVLENILKDKLLEVSMLKKNHAL-------AA-----NINP-S-DRDFKK
ALLEK-----KTSFILECKKASPSKGLIRKDFDLLEIAKTYEK-FASCISVLADSKYFL-
--------------GSYENIKIVSQ-----H-STKPILCKDFIIDAFQIKLARMMGANAV
LLMLSVLDDKNYLELFNLAKSLNMSVLTEVSNQQEIKRLLKLQ-------YDIIGINNRD
LHTLTTDINNTLKLRS------LLPKDALVVSESGIYSHTQIKALA-PHVNGFLVGSSLM
KEK----------DLKKACIKLILGENKVCGLTKIKDAKAVYKNHFIYGGLIFEKSSPRY
IKPKKALKITKAVKKLDFVGVFVKDKIKKIQKIAKKLDLKAVQLYGYSQ-KEIAQLKKSL
PKTCAIWQVVSVMDANDLAPKIKEASLILYDTKGDKM-GGNGVSFDWGILENVKTPFMLA
GGLNLDNIQKALKVKALGLDFNSGLEISPGIKNKDKIKRLARILREY
>gi|113954213|ref|YP_729965.1|	   294 residues, 50 /line  indole-3-glycerol phosphate synthase [Synechococcus sp. CC9311]
------------------------------------------------------------
-------------------------------------------------MEIRRRPPN--
--------------PKVQ--------------VAHLEY------------------AVP-
--D-QDSEPRNILEKIVWEKDREIAVARERMPL-------EQLRRKVADLP-P-ARDFLG
ALSAA---AVRPAVIAEVKKASPSKGVIREDFDPVAIAKAYASGGASCLSVLTDKAFFQ-
--------------GGFNVLIEVRE-----A-VDLPLLCKDFILSPYQLYQARAAGADAA
LLIAAILTDQDLAYFAKVAAALGLTVLVEVHDAEELQRVLALG------GFPLIGINNRD
LTSFETDLATTETLTA-QFAEQLLEQQILLVSESGLFHRADLDRVQAAGAQAVLVGEALM
RQA----------DVEAALQSLIH------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------------------G
>gi|33240820|ref|NP_875762.1|	   293 residues, 50 /line  indole-3-glycerol-phosphate synthase [Prochlorococcus marinus subsp. marinus str. CCMP1375]
------------------------------------------------------------
-------------------------------------------------MEIRRRPPN--
--------------PKVK--------------VANLEY------------------AIP-
--H-EESEPRNILEKIVWEKDREVELARHRLPL-------PKLIAKIEKLS-D-TKNFLQ
TLKDS---VTSPAVIAEIKKASPSRGLIREDFKPGDIAIAYQKGGATCLSVLTDKTFFQ-
--------------GGFDVLADVRK-----I-IDIPLLCKDFILHPYQIYQARASGADAI
LLIAAILSDQDLMYLNKIALSLGLSILVEVHDAAELNRVLRLG------GFPLIGINNRD
LKTFETDLTTTCKVAT-ECSNLLKEQDVLLVSESGIFTREDLQKVASFGASAVLIGESLM
RQK----------DLTNALKELIG------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------------------
>gi|116072330|ref|ZP_01469597.1|	   294 residues, 50 /line  indole-3-glycerol-phosphate synthase [Synechococcus sp. BL107]
------------------------------------------------------------
-------------------------------------------------MEIRRRSPS--
--------------PKIR--------------VSYLEY------------------GVP-
--H-DDEKPRNILEKIVWEKDREVDLARQKVPL-------DQLKKKISLLP-P-ARDFIA
ALKRA---QIKPAVIAEVKKASPSKGVIRDDFDPVAIAKAYAAGGASCLSVLTDKQFFQ-
--------------GGFDVLVQVRE-----T-VDLPLLCKEFVLSPYQLFQARAAGADAV
LLIAAILTDQDLRYLNKVAQSLGLDVLVEVHDAKELERVLAIG------GFSLIGINNRD
LATFETDLATTELLVN-QFRDRLHLDTTVLVSESGLFTRSDLDRVQAAGAEAVLVGEALM
RQE----------DVEQALHSLVG------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------------------A
>gi|116073362|ref|ZP_01470624.1|	   283 residues, 50 /line  indole-3-glycerol-phosphate synthase [Synechococcus sp. RS9916]
------------------------------------------------------------
------------------------------------------------------------
----------------MQ--------------VAHLEY------------------GIP-
--H-EDAEPRHILEKIVWEKDREVATARERMPL-------HQLKSKVAQLP-A-PRDFLA
ALRQA---AIKPAVIAEVKKASPSKGVIRENFDPVAIAKAYAAGGASCLSVLTDKQFFQ-
--------------GGFDVLVDVRD-----A-VDLPLLCKDFILTPYQLYQARAAGADAA
LLIAAILTDQDLRYLAKVAATLGLTVLVEVHDSEELERILSLG------GFPLIGINNRD
LTSFETDLATTETLTA-QFGARLQDQGALLVSESGLFLRSDLDRVQRAGAGAVLVGEALM
RQD----------DVEAGLHTLIA------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------------------G
>gi|87125510|ref|ZP_01081355.1|	   294 residues, 50 /line  Indole-3-glycerol-phosphate synthase [Synechococcus sp. RS9917]
------------------------------------------------------------
-------------------------------------------------MEIRRRPPN--
--------------PRIQ--------------VAHLEY------------------AIP-
--H-EESEPRHILEKIVWEKDREIATARERMPL-------EQLKSKVAQLP-P-AKDFLA
ALRSA---PVAPAVIAEVKKASPSKGVIRDDFDPVAIARAYAAGGASCLSVLTDKTFFQ-
--------------GGFDVLVEVRD-----S-VDLPLLCKDFILSPYQLYQARAAGADAA
LLIAAILNDQDLRYLRKVAAALGLTVLVEVHDAKEMERVLQLG------GFPLIGINNRD
LTTFETNLATTERLTT-EFGDRLKEQGVLLVSESGLFERSDLDRVQSAGAAAVLVGEALM
RQA----------DVEAGLRTLLQ------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------------------G
>gi|148240079|ref|YP_001225466.1|	   294 residues, 50 /line  Indole-3-glycerol phosphate synthase [Synechococcus sp. WH 7803]
------------------------------------------------------------
-------------------------------------------------MEIRRRPPN--
--------------PKVQ--------------VAHLEY------------------AIP-
--H-QDGEPRNILEKIVWEKDREIETARQRMPL-------VQLKARVAELP-P-ALDFLG
ALRQA---PVAPAVIAEVKKASPSKGVIREDFDPVAIAKAYAAGGASCLSVLTDRTFFQ-
--------------GGFDVLVAVRE-----A-VDLPLLCKDFILSPHQLYQARAAGADAA
LLIAAILTDQDLAYLQKVAATLGLTVLVEVHDAAEMERILTLG------GFPLIGINNRD
LTSFETDLATTEALTQ-QFADRLRAQDAFLVSESGLFARADLNRVQRSGAGAVLVGEALM
RQD----------NVEQGLRDLIA------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------------------P
>gi|148241715|ref|YP_001226872.1|	   294 residues, 50 /line  Indole-3-glycerol phosphate synthase [Synechococcus sp. RCC307]
------------------------------------------------------------
-------------------------------------------------MEIRRRPPN--
--------------PKVR--------------VAHLEY------------------AVP-
--H-DDEAPRHILEEIVWEKDREVAQARERVPL-------EKLKSQVAALP-A-PRDFVA
ALKAS---CRKPAVIAEVKKASPSKGVIREDFDPEAIAKAYAEGGASCLSVLTDKRFFQ-
--------------GGFEVLVQVRQ-----V-VDLPLLCKEFILSPYQLYQARAAGADAV
LLIAAILTDQDISYLLKVARSLGLQVLLEVHDAAELERALGFE------GVQLIGINNRD
LTSFDTDLATTETLTA-TYGEQLRQSGALLVSESGLFSRDDLDRVQSAGADAVLVGEALM
RQS----------DVQQALETLIS------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------------------G
>gi|33866163|ref|NP_897722.1|	   294 residues, 50 /line  indole-3-glycerol-phosphate synthase [Synechococcus sp. WH 8102]
------------------------------------------------------------
-------------------------------------------------MEIRRRPPN--
--------------PKVR--------------VAHLEY------------------AVP-
--H-DEEEPKNILEKIVWAKDREVDAARERVPL-------QTLKRQIEDLP-P-TRDFLA
ALREA---PVQPAVIAEVKKASPSKGVIREDFDPVAIAEAYAAGGARCLSVLTDKTFFQ-
--------------GGFDVLVEVRQ-----A-VDLPLLCKEFVLSPYQLFQARAAGADAV
LLIAAILTDQDLQYLKKAAAALGLDVLVEVHDAAELERVLNLG------GFPLIGINNRD
LTSFETDLSTTEQLME-RFGDRLQDQGSLLVSESGLFDRSDLDRVKAAGADAVLVGEALM
RQQ----------DVQSALTNLIH------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------------------G
>gi|78212414|ref|YP_381193.1|	   295 residues, 50 /line  indole-3-glycerol-phosphate synthase [Synechococcus sp. CC9605]
------------------------------------------------------------
-------------------------------------------------MEIRRRPPN--
--------------PKVR--------------VAHLEY------------------AVP-
--H-DDEEPRHILEKIVWEKDREIDAARDKVPL-------DNLKQQIAKLP-P-TKDFLG
ALQAA---ATKPAVIAEVKKASPSKGVIREDFDPVAIAKAYASGGASCLSVLTDKTFFQ-
--------------GGFDVLVEVRQ-----A-VDLPLLCKEFVLSPYQLFQARAAGADAV
LLIAAILSDQDLRYLNKAAAALGLTVLVEVHDATEMDRVLSIG------GFPLIGINNRD
LTSFETDLATTERLLV-DFNDRLKQQGVLLVSESGLFSRADLDRVQAAGAGAVLVGEALM
RQQ----------DVEAGLVQLIQA-----------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------------------G
>gi|84517588|ref|ZP_01004937.1|	   295 residues, 50 /line  indole-3-glycerol-phosphate synthase [Prochlorococcus marinus str. MIT 9211]
------------------------------------------------------------
-------------------------------------------------MEIRRRPPN--
--------------PKVK--------------VANLEY------------------AIP-
--H-EDGEPRNILEKILWEKDREVKVSRERVPL-------SELKAQINNLP-Q-TKDFLG
ALRQS---STSPAVIAEIKKASPSKGVIRENFDPIEIALAYKLGGATCLSVLTDKSFFQ-
--------------GGFEVLVQVRK-----T-VDLPLLCKEFIIQPYQIYQARVAGADAV
LLIAAILSDQDLLYLRKVAISLGLTILVEVHDSNELKRVLDLE------GFPLVGINNRD
LKTFNTDLRTTKEVVK-EHKKRISEQEVLLVSESGLFNSADLEEVSSYGAKAVLVGESLM
RQP----------DIGLALKNLQGF-----------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------------------K
>gi|87302987|ref|ZP_01085791.1|	   283 residues, 50 /line  indole-3-glycerol-phosphate synthase [Synechococcus sp. WH 5701]
------------------------------------------------------------
------------------------------------------------------------
----------------MR--------------VAHMQF------------------GIP-
--H-EEAAPRHILEEIVWEKDREVTASRERVPL-------EKLKQQVAELP-S-CRDFVA
SLRAS---CRKPAVIAEVKKASPSKGVIREDFDPVAIALGYQTGGASCLSVLTDKAFFQ-
--------------GGFEVLVDVRQ-----A-VELPLLCKDFILTPYQLYQARAAGADAA
LLIAAILSDQDLIYLLRVAHALGLAVLLEVHDAAEMERALALE------GVEMIGINNRD
LTSFHTDLATTAELMA-RYGDRLRQKGALLVSESGLSSRDDLDRVMGAGADAVLVGEALM
REA----------DVTAALEALIG------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------------------G
>gi|33862609|ref|NP_894169.1|	   301 residues, 50 /line  indole-3-glycerol-phosphate synthase [Prochlorococcus marinus str. MIT 9313]
------------------------------------------------------------
-------------------------------------------------MEIRRRPPN--
--------------PSVK--------------VAHLQY------------------AIP-
--H-ADAEPRHILEKIVWEKDREVETARQRVPL-------ETLKSQIADLP-I-PRDFIA
ALRQA---SRAPAVIAEVKKASPSQGVIRADFDPVLIANAYAEGGASCLSVLTDKSFFQ-
--------------GGFEVLVEVRQ-----T-VGLPLLCKDFILTPYQLYQARAAGADAA
LLIVAILSDQDLTYLSKVANSLGLNVLVEVHDAEELERVLNLG------GFPLIGINNRD
LTTFETDLETTETLSQ-QFATRLQQQGVLLVSESGLFNRADLDRVQAVGAEAVLVGEALM
RQS----------DVCAGLQQLMIGDEGT-------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------------------------------SNS
>gi|114327483|ref|YP_744640.1|	   305 residues, 50 /line  indole-3-glycerol phosphate synthase [Granulibacter bethesdensis CGDNIH1]
------------MPVTTFG-----------------------------------------
-------------------------------------------------AMMTTLPAS--
--------------------------------------------------QPDQTTPA-E
TGA-ATPTGYDVLARICADTRKEVAQRKALLSK-------ETLINRIRDLP-A-PRGFGQ
ALKDAVL-QGGYGLITEIKKASPSGGLIRPNFNPAELAKAYQVGGATCLSVLTDGPYFQ-
--------------GDPDHLVAARA-----A-VSLPVLRKDFILDPWQIYESRAMGADCI
LLIMAALTDDEARELEETARHLDLDVLAEVHDEAELDRALALQ-------TGLIGINNRN
LKTLKTDLSTTLNIAP------LLPPDRFLVAESGIRTHEDIQRLAATGVRSFLVGESLM
RQQ----------DVTKAVRELIGIDASS-------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------SVPPI------------------A
>gi|115475864|ref|NP_001061528.1|	   399 residues, 50 /line  Os08g0320400 [Oryza sativa (japonica cultivar-group)]
MESLLA-SP---------SVYRASFPCA---SSASRSPSRARLAVT-PAGAGARARARSL
LRCGAKDSILEELAQDDMVNAVELAQWENGKSINDIAASQG--------IRIRRHCRP--
------------NVPLK---------------------------------------EIE-
--E-ELGAPRNILEKIIWDKEVEVAEGHAKKPL-------KEVIEAAGQAP-P-ARDFYG
ALASAFKRNGMPALIAEVKKASPSRGVLRENFNPVEIAQAYEKNGAACLSILTDEKYFQV
ALELDVLMDLELEHGSFENLAKVRK-----SGVKCPLLCKEFVIDKWQIYYARSQGADAI
LLIAAVLPDLDIKYFLRICKELGMTALIEVHDEREMERVLNIS------GVQLIGINNRS
LETFVVDTSNTKMLLD-MHGDTIREKGILVVGESGLFNPDDVAYVQNAGVSAVLVGESLV
KQD----------DPGRAIAGLFGKELL--------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------------------H
>gi|115478196|ref|NP_001062693.1|	   381 residues, 50 /line  Os09g0255400 [Oryza sativa (japonica cultivar-group)]
MESLLAASS---------SLPAAAFSPPSSLSSTSSSPHALRSAVA-GAARAVRCSA---
----AKDSILYALEHDEMFNSAEVIQWESGKSINSIAAAQG--------IRIRRRCRP--
------------RYPSE---------------------------------------GSG-
--A-DKAVPRNMLEQIIWDKEVEVSQRKAKKPL-------QKVIESSQHAP-P-ARDFVG
ALTAAYSRNVAPALIAEVKKASPSRGVLREDFNPVEIAQSYEKNGAACLSILTDEKHFQ-
--------------GSFENLETVRN-----SGVKCPLLCKEFVIDIWQIYYARSKGADAI
LLIAAVLPDLDIKYMLRICKNLGMTALIEVHDERELDRVLKID------GVQLIGINNRS
LETFKVDTSNTKTLLE-KRGDLIRDKGILVVGESGLFTPDDVAYVQNAGVSAILVGESLV
KQE----------NPGQAIAGLYGKDLL--------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------------------H
>gi|116309729|emb|CAH66774.1|	   374 residues, 50 /line  OSIGBa0115M15.12 [Oryza sativa (indica cultivar-group)]
MDAAAAAAGRGG---PAPPRCARAETDSEDAVATTSSPHSAEAA------------GAAE
QGNGAPAPVADAA---------------------DVEGVDG--------IRIRRRPVT--
------------GPPVHY--------------VGPFQF------------------RLE-
--N-EGNTPRNILERIVWDKEAEVSQMKERRPL-------YMLKGPLENAP-P-VRDFVG
VLKASFDRTGLPALIAEVKKASPSRGVLREDFEPVQIAQTYEKNGAACLSVLTDAKYFQ-
--------------GSFDYLDAIRN-----AGVQCPLLCKEFIVDAWQLYYARLKGADAV
LLIAAVLPDLDIKYMLKICKILGMAALVEVHDEREMDRVLGID------GVQLIGINNRN
LETFQVDISNTKNLLEGERGQTIAQKGIIVVGESGLFTPDHISFVQNAGVKAVLVGESLI
KQE----------DPGKAIAGLFGKDISP-------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------------------------------------------VSAA
>gi|15238914|ref|NP_199633.1|	   379 residues, 50 /line  indole-3-glycerol phosphate synthase, putative [Arabidopsis thaliana]
MEAALLSLQPFP----------------SSATQRRLSPFNLHNTLT-RPSSYAPLRAQKS
GITEG-----SDSAL-----EAKVSEQEVGMYQNEVVESQG--------IRIRRRPPT--
------------GPPLHY--------------VGPFEF------------------RLQ-
--N-EGNTPRNILEEIVWHKDKEVAQMKERKPL-------YSLKKALDNVP-P-AKDFIG
ALRSAHQRTGLPGLIAEVKKASPSRGILREDFNPVEIAQAYEKGGAACLSVLTDDKYFK-
--------------GSYENLQAIME-----AGVKCPLLLKEFIVEAWQIYYGRSKGADAV
LLIASVLPDLDIKYMIKICKILGMATLVEVHDEREMDRVLAIE------GVELIGINNRN
LETFEVDLGITKKLLEGERGELIRQKDILVVGESGLFTPEDIAFVQEAGVKAVLVGESLI
KQS----------DPGKAISTLFGRDVS--------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------------------E
>gi|116061658|emb|CAL52376.1|	   356 residues, 50 /line  Anthranilate synthase component II (ISS) [Ostreococcus tauri]
-----------AMTT-----------------ATRTTHAGARAR------------GTGG
RRARARVNVARAA---------------------NATDDGA--------VSIRRRPPS--
--------------GPSKHALGVGQFEFMIEEVNDKGE------------------RVT-
--N-EENRPRNILEEIVWYKDVELAERKEKFPL-------QLVRTALVNAP-P-TRDFVK
AITDQLEATKQPGLIAEVKKASPSKGVIQPNFDPVKIAKAYEAGGAACLSVLTDEKFFQ-
--------------GGFENLQLIRE-----AGVTCPLLCKEFIVDAYQIYLARKYGADAI
LLIAAVLPNQDLKYFIKIAHSLGMKCLIEVHTYGEMKRVLDGDF-----PIDLLGINNRD
LGTFEVSLSVTTDLMNGPLGEEVKERGITMVGESGIFTIDDVNLLQDSGVGAVLVGESLV
KQD----------TPDVGIKKLFGRP----------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------------------L
>gi|145348239|ref|XP_001418562.1|	   355 residues, 50 /line  predicted protein [Ostreococcus lucimarinus CCE9901]
------------MSA-----------------ATGRATLATGAR------------RDAR
RARRATRPRASAP---------------------SGVDDGA--------VSIRRRPPN--
--------------GPSKHDLGVGQFEFVIEEVAPTGE------------------RVT-
--N-ENNKPKNILEEIVWYKDVELAERKEKFPL-------QLVRTALVNAP-P-TRDFVK
AITDQLAATKQPGLIAEVKKASPSKGVIQPNFDPVKIAKAYEEGGAACLSVLTDEKFFQ-
--------------GGFENLALIRE-----AGVTCPLLCKEFIVDAYQIYLARKYGADAI
LLIAAVLPNQDLKYFIKIAHSLGMKCLIEVHTYGEMKRVLDGDF-----PIDLLGINNRD
LGTFEVSLSVTTDLMNGPLGEEVKRRGITMVGESGIFTIDDVNLLQDSGVGAVLVGESLV
KQD----------TPDVGIKKLFGRP----------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------------------V
>gi|118720781|ref|ZP_01573303.1|	   344 residues, 50 /line  Indole-3-glycerol-phosphate synthase [Burkholderia multivorans ATCC 17616]
-----MPRNRARCCS-----------------ARSTISRASRAK------------SSRS
M-------------------------------------------RAP--RFMRRTSPA--
---------RSPTASSSR--------------AKRSRAARPVRKSTNSCASRSSSSADPV
TNQ-AGTHMSDILDRIIAVKREEVAAAMRSTPL-------EALKLE-ASAR-D-RRDFVG
ALRAKH-AAGQPAVIAEIKKASPSKGVLREHFVPADIARSYAAHGAACLSVLTDEQFFQ-
--------------GSVRYLEEARA-----A-CDLPVLRKDFIVDAYQILEARAMGADAI
LLIAAALDTPLMQELEAYAHSLDLAVLVEVHDRNEMEQALTLK-------TPLLGINNRN
LRTFETSIRATLDMLD------MIPQDRIVVTESGILSRADVDTMRAANVNTFLVGEAFM
RAD----------QPGEELARMFF------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------------------
>gi|119469327|ref|ZP_01612266.1|	   454 residues, 50 /line  bifunctional indole-3-glycerol phosphate synthase/phosphoribosylanthranilate isomerase [Alteromonadales bacterium TW-7]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------MANVLDKIVADKKLELIERKAARPL-------ESFKDQA--VP-T-SRDFYK
ALAAP---GT--QFILECKKASPSKGLIREPFDLTEITAAYKKY-ASCMSVLTDTKYFQ-
--------------GSFDYLEFVRS-----Q-VDQPLICKDFFIDEYQVYMARIYGGDAI
LLMLSVLNDEEYTALHKVADSLNMAVLTEVSNEEEVHRALNLNA-------KIIGINNRD
LRDLSTDLATTEKLR------KLIPEDKVVISESGIYTHQDVKRLAPL-CDGFLIGSSLM
AEA----------DLEQACRRVIFGENKVCGLTRSQDAQAAYNAGAVYGGLIFHPKSPRC
VDLDCAQAITQSA-PLKFVGVFVDEPSEKVAHAASVLKLAAVQLHGQESDDYIKALRTQL
PSNCEIWKAQAIKD--ELPTPVNGVDRHLYDTHSDKQAGGTGKVFDWSLLRDATTPFMLA
GGLNPDNIKDALYQGALGLDLNSGVEDAPGKKCQNKLHHAFTSIRNY
>gi|119485318|ref|ZP_01619646.1|	   303 residues, 50 /line  indole-3-glycerol-phosphate synthase [Lyngbya sp. PCC 8106]
------------------------------------------------------------
-------------------------------------------------MKIRR------
----------------LT--------------ELNTGY------------------EIA-
--P-QHSIPDNILEKIIWQKEDEVLQMKQAMSSLKSGSDYETLLKPSSAFS-K-RRDFAK
ALKKG-----SPALIAEVKKASPSKGIICPDFDPVKIAQAYERGGAACLSVLTDKTFFQ-
--------------GSFENLQRVRD-----S-VSLPLLCKEFIIDPCQVLMARSAGADAV
LLIAAVLSDADLSAFSILADRLGMDSLVEVHTLAELDRVLALPE--TGKSIRLVGINNRN
LENFTVDLATTEQLLA-SRGEELTAKNIVVVSESGLKTSDDLVRVHQAGANAVLVGESLV
QQT----------EISQAVRAIIPKQLEL-------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------------------------------QK
>gi|149125081|ref|ZP_01850151.1|	   285 residues, 50 /line  Indole-3-glycerol-phosphate synthase [Methylobacterium sp. 4-46]
------------------------------------------------------------
----------------------------------------------------MFEPKS--
----------PAPAD-------------------------------------------R-
--P-ASAARPDVLAHIEAYKRREIAEAKLRVPL-------AELERRAEKAD-P-PRGFAE
AIRADL-AAGRPALIAEIKKASPSRGLIRADFDPPALARAYAEGGATCLSVLTDEPSFK-
--------------GRPEYLTAARQ-----A-CPLPVLRKDFLFEPYQVVEARAWGADCI
LVIMASLDDEEAAALVATAHDLGMDVLVEVHDRAELERALPLGT-------RMIGINNRD
LRTFEVSLETALALRP------LVPEDRIVVGESGIAGHADAQRLARAGIRTLLVGESLM
REA----------DVTAATRRLLFGEPAG-------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------------------S
>gi|17987126|ref|NP_539760.1|	   303 residues, 50 /line  indole-3-glycerol-phosphate synthase [Brucella melitensis 16M]
------------------------------------------------------------
----------------------------------------------------MRKPYS--
----------PSTAAQPL--------------RFCKRS----------LPFPTTSRPDR-
--K-DRAMSTDILRKIEAYKREEIAAAKARLAL-------DELKARTRDQS-A-PRGFLK
ALEAKR-AAGQFALIAEIKKASPSKGLIRPDFDPPALAKAYEEGGAACLSVLTDTPSFQ-
--------------GAPEFLTAARQ-----A-CSLPALRKDFLFDPYQVYEARSWGADCI
LIIMASVDDDLAKELEDTAFALGMDALIEVHDEAEMERALKLSS-------RLLGVNNRN
LRSFEVNLAVSERLAK------MAPSDRLLVGESGIFTHEDCLRLEKSGIGTFLIGESLM
RQH----------DVAAATRALLTGAEK--------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------------------L
>gi|39935956|ref|NP_948232.1|	   287 residues, 50 /line  indole-3-glycerol phosphate synthase [Rhodopseudomonas palustris CGA009]
------------------------------------------------------------
------------------------------------------------------------
----------MAGTSSAM--------------TEYKRS------------------FTR-
--T-GRAIVSDILTKIEAYKREEIAAAKRERPL-------AAIEAIAREAS-P-PRGFVK
ALRAKH-AAGDYGLIAEIKKASPSKGLIRADFDPPALARAYEAGGAACLSVLTDTPSFQ-
--------------GSLDYLVAARA-----A-VSLPALRKDFMYDTYQVVEARAHGADCI
LIIMAALDDAEAKDIEDAAFDLGMDVLLEVHDAPELERALKLRS-------PMVGVNNRN
LRSFEVTLATSEALAP------LIPKDRLMVGESGIFTPADLARLARVGMSTFLVGESLM
RQQ----------DVTAATRALLARAA---------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------------------
>gi|17227909|ref|NP_484457.1|	   290 residues, 50 /line  indole-3-glycerol-phosphate synthase [Nostoc sp. PCC 7120]
------------------------------------------------------------
-------------------------------------------------MWCKNIHK---
-----------------V--------------NSQQFP------------------SMT-
--N-QIAPPRHILQEIVLHKQQEVTQLQQELPL-------VTLQQQLTIAP-P-VRDFLK
ALQDN---SHKPSLIAEVKKASPSRGIIRLDFDPVAIAQSYQKGGAACLSVLTDEKFFQ-
--------------GSFDNLRLVRQ-----Q-VSLPLLCKEFIIDSYQIYLARTFGADAV
LLIAAILSDEELQEFLKLIHELGMTALVEVHTLAELDRVLKLK------DLRLLGINNRN
LEDFTVDLKITQQLLS-QRQQEIENLNLTIASESGIYTPADLSFVAGVGARAVLVGESLV
KQT----------DVEEATRSLLVA-----------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------------------
>gi|23129542|ref|ZP_00111368.1|	   283 residues, 50 /line  COG0134: Indole-3-glycerol phosphate synthase [Nostoc punctiforme PCC 73102]
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------MTY------------------PFT-
--T-PNTYLQPTLTEIIWQKKHEVAQIQQEMSL-------ASLQRQLAAAP-T-VRDFIS
ALQQS---HYRPCIIAEVKKASLIHGIIKADLDSVAIAKAYERGGATCISVFTDQKFFY-
--------------GSFENLRTIRY-----R-VGLPLLCKEFILDPCQIYLARAAGADAV
LLIAGILSDKELQNFLRVIHYLGMNALIEVHTLAELDRVLKLD------DVRLIGINNQS
LEDFSVNIDTTEQLLA-ARRSQLQSLGIIVVSESGLYTPADLSLVAEAGTHAVILGESLV
KQE----------DIQQSVRNLLKPTAIF-------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------------------R
>gi|33861853|ref|NP_893414.1|	   295 residues, 50 /line  indole-3-glycerol-phosphate synthase [Prochlorococcus marinus subsp. pastoris str. CCMP1986]
------------------------------------------------------------
-------------------------------------------------MEIRRRPPN--
--------------PTVR--------------VENLEY------------------AVP-
--H-REAKAKNILEEIVWYKDTEIKNFKKIVSL-------EDLIKKLDKLS-P-PKDFFQ
SILHS---KIKPGVIAEIKKASPSKGVIREDFKPKEIASCYEKSGASCISVLTDKRFFQ-
--------------GSYEILQDVRT-----A-TNLPLLCKDFIISAYQIYKARVSGADAI
LLIAAILSDDDLFYLKKIADNLKMSVLVEVHDGQELERILSLK------SFNLIGINNRN
LKTFKTDLKTSIRIMS-KYSDIFSKHNIVPISESGINNSDDLKTLNSIGIKGVLIGERFM
RES----------DIENSFKKLFNS-----------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------------------I
>gi|78779777|ref|YP_397889.1|	   295 residues, 50 /line  Indole-3-glycerol-phosphate synthase [Prochlorococcus marinus str. MIT 9312]
------------------------------------------------------------
-------------------------------------------------MEIRRRPPN--
--------------PTVR--------------VENLEY------------------AVP-
--H-REAQAKNILEEIVWHKDIEIKNFKKIVSL-------EDLIKKIENLP-D-PKDFYK
NILES---KIKPGLIAEIKKASPSKGVIRKDFNPEDIAICYEELGASCISVLTDKRFFQ-
--------------GSYEILETVRK-----S-TNLPLLCKDFIISAYQIYKARVSGADAI
LLIAAILSDDDLIYLKKIADNLKMSVLVEVHNDNELERILKLK------SFNLIGINNRD
LKTFKTDLKTSIELMH-IYADIFLKQNILPISESGINCAQDLESLRSIGIKGVLIGETFM
RES----------DIEKSFKKLFNS-----------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------------------I
>gi|37522125|ref|NP_925502.1|	   295 residues, 50 /line  indole-3-glycerol-phosphate synthase [Gloeobacter violaceus PCC 7421]
------------------------------------------------------------
-------------------------------------------------MKIRRRPEQ--
--------------PPVA--------------VGPLQF------------------QLQ-
--G-ADVEPGNILEKIVWAKEQELDRWRERLPL-------AKLRARTASAP-E-VRNFLG
ALRRS---PHPVAVIAEVKKASPSRGVLRSDFDPVALAQAYTRGGADAISVLTDEAFFQ-
--------------GSFTNLSRIRE-----Q-VPLPLLCKEFILGPYQIYLARAHGADAV
LLIAAILSDTDLAYLMRVADQLGMAALVEVHDLEELDRVLALE------GVALVGINNRN
LLDFEVHLETTETLLT-ERGERLAEWGITVVSESGIYQGADLARVRKAGARAVLVGESLL
REA----------DPAQAVGRLVEG-----------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------------------V
>gi|50085545|ref|YP_047055.1|	   285 residues, 50 /line  indole-3-glycerol phosphate synthase (IGPS) [Acinetobacter sp. ADP1]
------------------------------------------------------------
-------------------------------------------------MNLLKRLKN--
--------------TQTT--------------EVIQMI----------------------
------QIQNTILGKIVDRKHEELADRLKQRNL-------KDVEQWVKEAP-P-VRGFAQ
SLRS-----KRPGVIAEIKKASPSKGVIRADFNPAEIAQQYEQAGAACLSVLTDVDFFQ-
--------------GADENIAIARQ-----H-CSLPALRKDFLIDPYNVVEARALQADCI
LLIVACLSDQQLEEMSKTAFEYDLDVLVEVHDEQELERALKLS------EQCLLGVNNRN
LKTFDVDLNTSLRL------KKLLDPSRLLVTESGIATPQDVQLMQEHDIHSFLVGESFM
KQP----------RPDQAFTELFGVPKL--------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------------------V
>gi|58040713|ref|YP_192677.1|	   308 residues, 50 /line  Indole-3-glycerol phosphate synthase [Gluconobacter oxydans 621H]
------------------------------------------------------------
-------------------------------------------------MTFMYHRPAMT
YSPEGTEQFPDPEIPETT--------------TPPIKD------------------PEA-
--E-TAADRSDVLARICARTRVDIEQRSQIMSL-------KEITARAREVTVP-TRGFGQ
ALQHLT-ADRQVGLIAEIKKASPSAGILRPDYNPVEIAQEYQAAGATCLSVLTEGSCFH-
--------------GSTDDIRAVRE-----A-CSLPILRKDFILDPWQVHESRLIGADCI
LLIMAILTETQAAELIAIARGLDMDVLLEVHDEAELNRALALDT-------FLIGINNRN
LRTLKTDIQTTIDLAP------LVPPDRLVVSESGIRTQDDMMKVGAVGASAVLVGESLL
REP----------DPGVAARRLLGF-----------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------------------V
>gi|58583783|ref|YP_202799.1|	   344 residues, 50 /line  indole-3-glycerol-phosphate synthase [Xanthomonas oryzae pv. oryzae KACC10331]
----------MACCA-----------------HARYSPTARRAR------------GWTP
M--------SPTP---------------------TSSPGSPESCRRRNAASITRRHPHSD
AGMLRGMQ-----LPSSA--------------VILTDN------------------ARP-
--P-GPNTMSDILNTILARKADEVAERSARVPL-------AELIARSADLP-L-TRGFAA
AMQASI-AAGDPAVIAEVKKASPSKGVIRPDFHPADIAVSYEFGGATCLSVLTDVDFFQ-
--------------GSDAYLRQARD-----A-CTLPVLRKDFTVDPYQVYEARVLGADCI
LLIVSALKDAQLADLSGLAMQLGLDVLVEVHDVDELERAVQVP-------VPLIGINNRN
LRTFEVTLQTTLDMRA-AV-----PRDRVLVTESGIVTQADVQLMRSNDVNAFLVGETFM
RAA----------EPGESLRQLFFAH----------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------------------D
>gi|72382702|ref|YP_292057.1|	   295 residues, 50 /line  indole-3-glycerol-phosphate synthase [Prochlorococcus marinus str. NATL2A]
------------------------------------------------------------
-------------------------------------------------MEIRRRPPN--
--------------PSIK--------------VANLEY------------------AIP-
--H-PDSKPKNILEEIVWEKHLEVEIARKKVSL-------EDLKKKIKDLP-K-TKNFID
ALRNS---NSKPALISEIKKASPSRGIIREDFDAKMIGKMYQEGGANCISVLTDKKFFQ-
--------------GGFDVLVEVRK-----E-IIIPILCKDFILYPYQLYQARAAGADAA
LLIAAILTDSDLKYLSKVAEHLGLTILVEVHDSEELERVLNIN------VFNLIGINNRN
LKSFKTDLEVTKKLAE-NYANQIKENSITLVSESGLFNREDLDLVKSYGADAVLVGESLM
SQE----------DILGGVKKLIGN-----------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------------------L
>gi|76260989|ref|ZP_00768613.1|	   285 residues, 50 /line  Indole-3-glycerol phosphate synthase [Chloroflexus aurantiacus J-10-fl]
------------------------------------------------------------
------------------------------------------------------------
--------------MRVE--------------ATDG-T------------------CYQ-
--G-QLMSEPTILEQILAHKRVEVRRQQAKIPL-------AALHDRIRHAP-P-IRDFAA
ALRRG---P-ATALIAEVKKASPSRGVLLANFDHLALARTYVANGAAALSVLTDQRFFQ-
--------------GSLTYLAGIRALPDIQA-AGTPLLRKDFIIDPYQVYEARAYGADAI
LLIVAALDDQTLAELFTLTYELGMHALVEVHTVAELERALRIQP-------PIIGVNNRD
LHRFVTDRTTTRNIAD-HLPSGTQ--RPLLVSESGIFTPDHVAEVRGYGADAILVGEALV
TAP----------DIGLQVRTLAT------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------------------A
>gi|86606995|ref|YP_475758.1|	   306 residues, 50 /line  indole-3-glycerol phosphate synthase [Synechococcus sp. JA-3-3Ab]
------------------------------------------------------------
----------------------------------MELEGEL--------LAVRRRSPA--
--------------PPVV--------------VASQVY------------------RTK-
--A-PEAEPRHILEEIVWHKEQEVERQREQLPL-------KQLQQQLEQAP-P-VRDFVA
ALTQS---PHPVSLIAEVKKASPSRGVLRDPFDPVAIAQSYEAAGASCLSVLTDERFFQ-
--------------GSGEYLRQIRQ-----A-VGIPILCKEFILYPYQILWARTLGADAV
LLIAAILSDADLGYFLKLIQQLGMAALLEVHTCQELQRVLALPHLQQAKGRVLIGINNRD
LKTFAVDLNTTRDLLV-AHRERLG--DLPVVSESGIHTPADLQQLRSWGVRAVLVGEALV
TQP----------DPGQAVRSLLSS-----------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------------------Q
>gi|86609783|ref|YP_478545.1|	   306 residues, 50 /line  indole-3-glycerol phosphate synthase [Synechococcus sp. JA-2-3B'a(2-13)]
------------------------------------------------------------
----------------------------------MELQGEP--------LSIRRRSPA--
--------------PPVV--------------VASQVY------------------QTT-
--A-PEAKPRHILEAIVWHKEQEVERQREQLPL-------KELQRQLDQAP-P-VRDFVA
ALTQS---PHPISVIAEVKKASPSRGVLRDPFDPVAIAQSYEAGGASCLSVLTDERFFQ-
--------------GSGEYLRRIRQ-----A-VGIPILCKEFILYPYQILWARSLGADAV
LLIAAILSDADLGYFLKLIRQLGMAALLEVHTSQELQRVLRLPQLQDSRGQVLIGINNRD
LRTFAVDLNTTRNLLA-AHSELLG--DLPVVSESGIHTPADLQQLRAWGVRSVLVGEALV
TQP----------DPGQAVRHLLSS-----------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------------------Q
>gi|113476709|ref|YP_722770.1|	   297 residues, 50 /line  Indole-3-glycerol-phosphate synthase [Trichodesmium erythraeum IMS101]
------------------------------------------------------------
-------------------------------------------------MQIRRRPPN--
--------------PAVE--------------MGTLRY------------------EVS-
--V-PESKPKNILEEIVWHKEKEVDYLRDKEPL-------VELRKKINLMP-P-PLDFLT
TLSTG---KTQLAVIAEVKKASPSKGVIRQDFEPVAIAKLYQENAATCISVLTDRKFFQ-
--------------GSFENLANIRE-----N-VDLPLLCKDFLIYPYQIYFARLYGADAV
LLIAAILSDQDLKYFIKIVNSLGMTALVEVHTLKELDRVLGIE------GVKLIGINNRN
LEDFSVDLQTTFQLME-ARKKELEKLGILVVSESGIHSYEDINFMINAGVNAVLVGESLV
KKT----------NPGTALLQLFNENK---------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------------------S
>gi|119493850|ref|ZP_01624416.1|	   295 residues, 50 /line  indole-3-glycerol-phosphate synthase [Lyngbya sp. PCC 8106]
------------------------------------------------------------
-------------------------------------------------MQIRRRRPN--
--------------PSVN--------------VASLLY------------------TVA-
--V-PDDQPQNILEEIVWEKEKEVDRRRESLPL-------LQLRSQLENLS-P-AKDFLA
ALKAS---PTQPAIIAEVKKASPSKGVIREDFDPVKIAQAYQENGACCLSVLTDEKFFQ-
--------------GSFENLGKIRA-----A-VEIPLLCKEFVIYPYQIYQARIYGADAI
LLIAAILSKQDLQYFVKIVKTLGMTPLIEVHTLEELEQVLCLQ------GVSLIGINNRN
LEDFSVDLDTTRQLLD-AKKEQIQSQDILVVSESGLYTQDDLNFVKNAGANAVLIGESLI
KQP----------DPGKALQQLIGRD----------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------------------
>gi|119511334|ref|ZP_01630448.1|	   293 residues, 50 /line  indole-3-glycerol phosphate synthase [Nodularia spumigena CCY9414]
------------------------------------------------------------
-------------------------------------------------MQIRRRSTN--
--------------TTIN--------------VSFLRY------------------QST-
--L-PDIVPNNILEEIVWHKEIEIDKMRERRPL-------AQLQKQALSAP-P-TRDFIA
ALREG---KTKPALIAEVKKASPSKGVLREDFDPVAIASAYEKGGASCISVLTDTKFFQ-
--------------GSFENLTKVRE-----T-VDLPLLCKDFIIYPYQMYLARIHGADAV
LLIAAILSDQDLQYFLKIANAMKMKALIEVHSLAELDRVLVLT------GEFIVGINNRN
LEDFSVDLQTTCELLA-ARASQLQERNLLVVSESGLHTPADLQIVQQAGAAAVLIGESLV
KQP----------DPGLAITHLFA------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------------------
>gi|126659639|ref|ZP_01730769.1|	   294 residues, 50 /line  indole-3-glycerol-phosphate synthase [Cyanothece sp. CCY0110]
------------------------------------------------------------
-------------------------------------------------MQIRRRPPN--
--------------PAVE--------------VDILRY------------------QVP-
--D-PNGQAQHILEEIVWHKEKEIERMRDRLSL-------LDLRKQERNAS-P-AKDFLG
AIAQG---KTQPALIAEVKKASPSKGVIREDFDPVAIAQAYVNGGASCLSVLTDSKFFQ-
--------------GSFDNLALVRQ-----A-VDIPLLCKEFIIYPYQVYLARVKGADAI
LLIAAILKDSDLQYFIKIIRALGMTPLVEVHSLEEMDRVLAIE------GVSLIGINNRN
LETFEVSLKTTQQLLE-AREDKIKELGIHVVSESGIHTPQDLQTVKDAGANAVLIGESLV
KQP----------DPQQAISQLFGV-----------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------------------
>gi|67920093|ref|ZP_00513613.1|	   295 residues, 50 /line  Indole-3-glycerol-phosphate synthase [Crocosphaera watsonii WH 8501]
------------------------------------------------------------
-------------------------------------------------MQIRRRPPN--
--------------PAIE--------------VDILRY------------------QVP-
--D-PNGEANHILEEIVWHKEKEVERMRESLSL-------LELRKQERNAP-P-AKDFLG
AISQG---KTQPALIAEVKKASPSKGVIRKDFDPVAIAQAYVKGGASCLSVLTDSKFFQ-
--------------GSFDNLALVRQ-----A-VDIPLLCKEFIIYPYQIYLARVKGADAI
LLIAAILKDSDLQYFIKIILSLGMTPLVEVHSLHEMDRVLAIE------GVSLLGINNRN
LETFEVSLDTTKELLT-ARQDQIKEKGIYIVSESGIHSPQDLQQVKQAGANAVLIGESLV
KQA----------DPSQVIVKLFSES----------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------------------
>gi|17232238|ref|NP_488786.1|	   296 residues, 50 /line  indole-3-glycerol-phosphate synthase [Nostoc sp. PCC 7120]
------------------------------------------------------------
-------------------------------------------------MQIRRRQPN--
--------------PAIN--------------VSILRY------------------QVA-
--V-PDAKPQHILEEIVWQKEVEVDQMREKLPL-------LELQKKARIAP-P-TRDFVA
ALKQG---RTTPALIAEVKKASPSKGVFREDFDPVAIALSYQQGGASCISVLTDEKFFQ-
--------------GSFDNLTKVRA-----A-VDLPLLCKDFVIYPYQMYLARIQGADAV
LLIAAILSDQDLQYFIKIAKALNMAALVEVHNLEELDRVLALD------GVSLVGINNRN
LEDFSVDLQTTCQLLA-ARGSQLQERNILVVSESGLHNPADLSLVSQAGASAVLIGESLV
KQP----------DPELAIANLYSSDV---------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------------------
>gi|16332064|ref|NP_442792.1|	   295 residues, 50 /line  indole-3-glycerol-phosphate synthase [Synechocystis sp. PCC 6803]
------------------------------------------------------------
-------------------------------------------------MEIRRRPPN--
--------------PPIK--------------VDILQY------------------QIK-
--H-PEAAPRHILEEIVWHKEKEVAQRRELVPL-------VKLQSLVKDMT-P-PLDFVG
ALRQS---PRQPALIAEVKKASPSKGIIRADFDPVAIAKAYEAGGANCLSVLTDEKFFQ-
--------------GSFENLQLVRS-----A-VQLPLLCKEFIIYPYQIYLARSRGADAV
LLIAAILSDKDLRYFLKIIEGLGMAALVEVHTLEEMDRVLALD------GVQLIGVNNRN
LQTFTVDLQTTEDLFA-QRREQLTQGDITLVSESGIYELADLQRLQQAGARAVLVGESLV
KQP----------DPQQAIAALYGEV----------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------------------
>gi|22298240|ref|NP_681487.1|	   305 residues, 50 /line  indole-3-glycerol-phosphate synthase [Thermosynechococcus elongatus BP-1]
------------------------------------------------------------
---------------------------------------------------MRRRPPN--
--------------PAVT--------------VRNLHY------------------QVP-
--V-ADDAPRNILEKIVWHKEQEVEQLREVLPL-------ADLQRQVLEAP-P-VRSFLA
AVQNP---VTQPALIAEVKKASPSKGIIRPNFDPVAIAQAYVAAGATCLSVLTDSEFFQ-
--------------GSFEYLAQIRQ-----E-VAVPLLCKDFILYPYQMFLARVRGADAV
LLIAAILSDKDLRYFLRIAHGLGLTALVEVHTAEEMERVLALE------DVQLVGINNRN
LMDFSVDLATTEKLLA-NYGAQLRDRNILVVSESGIHQRADVERMAQAGAQAILVGESLM
RPPAAMAHFSEAEELRARIQQLFPELA---------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------------------H
>gi|56750362|ref|YP_171063.1|	   295 residues, 50 /line  indole-3-glycerol-phosphate synthase [Synechococcus elongatus PCC 6301]
------------------------------------------------------------
-------------------------------------------------MEVRRRPPN--
--------------PAVH--------------VASLTY------------------QVK-
--V-PGSSPSNILEEIVWYKEREVNAWREQLPL-------QQLQNQVRGLT-QTPRDFLA
ALRQA---PTRPAVIAEVKKASPSKGVLREDFDPVAIAQAYAANGAACISVLTDEKFFQ-
--------------GGFENLQRVRA-----A-VDVPLLCKDFVIYPYQIYKARLLGADAV
LLIAAILSDADLRYFLKIAHSLGLNALVEVHSLPELERVLALD------DLRLVGINNRN
LKTFVTDLAVTEHLAA-Q----CRDRDLLLVSESGLFTGADLDRVTQAGAQAVLIGESLV
KQP----------DPGLALQQLVGDRPS--------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------------------A
>gi|23130018|ref|ZP_00111839.1|	   296 residues, 50 /line  COG0134: Indole-3-glycerol phosphate synthase [Nostoc punctiforme PCC 73102]
------------------------------------------------------------
-------------------------------------------------MQIRRRSPN--
--------------PAIA--------------VSMLRY------------------QAA-
--V-PDSAPNNILEEIVWQKEVEYDLMREKVPL-------QELRKQVLTAP-P-TRDFVA
ALRQG---KTKPALIAEVKKASPSKGVFREDFDPVAIAQSYQQGGASCLSVLTDVKFFQ-
--------------GSFENLAKIRA-----A-VDLPLLCKEFIIYAYQIYLARIHGADAI
LLIAAILGDQDLKYFLKIANNLKMAALIEVHSLAELDRVLALD------GVSLVGINNRN
LEDFSVDLQTTCQLLA-ARGSQLQEKNILVVSESGLHNPDNLSLVLTAGASAVLIGESLV
KQP----------DPGAAIASILPKN----------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------------------F

Ad blocker interference detected!


Wikia is a free-to-use site that makes money from advertising. We have a modified experience for viewers using ad blockers

Wikia is not accessible if you’ve made further modifications. Remove the custom ad blocker rule(s) and the page will load as expected.