FANDOM


>gi|42568932|ref|NP_178517.2|	   320 residues, 50 /line  unknown protein [Arabidopsis thaliana]
-------------------MLGSISLISCNFSRLPRLL----------------------
----------------------------------KPST-RPQTLTQSSSLLLLLQSRASS
SPH----------RIALFPKYEKKVTFFHIC---KSSS-NNPEEP--EKTQIQDEGR---
-------------------------------------------DWSSSILLFALWG--AL
LYYCFNL----APDQTPTQ----------------------DLYFLKKLLNLKGD-----
------------------DGFR-MNQILVGLWYIMGLWPLVYAMLLLPTGT---SKTPAW
---PFVVLSFFGGVYALLPYFALWN-PPSPPV---SETELR--------QWPLN---VLE
SK---VTAGVTLVAGLGIILYSVVGN-AGDWTEFY-------QYFRESKF-IHVTSLDFC
LLSAFAPFWVYNDMTTRKWFDKGSW-LLPVSVIPFLGPSLYLLLRPAVSETIAPKDTASS
DP---NQ--
>gi|115458802|ref|NP_001053001.1|	   340 residues, 50 /line  Os04g0462300 [Oryza sativa (japonica cultivar-group)]
-MAMAARTLALAFP------------------------LPLCAVSSPRRATPLALPRRGA
ARPLASLAQCPARG----------------------HSPSPRRAAGR-------------
------------------------------------------------------------
----------------ALAPCAAMRGSGGGGGGGEFA--SDDGGGARALLRATLWGAE--
AAYILWLFLLPYAP-----G----------DPVWGISQ---ATISDLI--GLSLNFFLIL
P------LLNSAGVHLL-ESPV-LHPVAEGLFNFVIAWTLLFAPLLFTDSRRDR--FKGS
LDLLWGFQMFLTNT-FLIPYMAIRL-NDPDK-DKSPPQTS-----------KLGSVMVRG
APIVGLTGGLVCILSIAWALFGRA---DASFGGIAERWQYVQSYVFSERL-AYAFLWDIL
LYSIFQPWLIADNIQNVKA-SATE-FVNSVRFLPVIGLVAYLFCLEDRD-----------
------D--
>gi|115476010|ref|NP_001061601.1|	   357 residues, 50 /line  Os08g0345400 [Oryza sativa (japonica cultivar-group)]
-------MLSSSSSAAAAAV-----VLTTTSGRAPLLH----------------------
----------------------------------LPRTPRPTTAARIAAAPDSSRARAGG
AP------------LLLGSAVPRRRGWALVC---RDSSLPGPPGV--DPVAEEEENRKKT
EAVAAA----------AAARIASSGG-GGGGGGGSLS------DWTTSVLIFGIWA--GL
MYYIFQL----APNQTPYR----------------------DTYFLQKLCNLKGD-----
------------------DGFR-MNDVLVPLWYIMGLWPLVYSMLLLPTGRSSKSKIPVW
---PFLILSCIGGAYALIPYFVLWK-PPPPPI---DEEEIG--------QWPLK---FLE
SK---LTAGVTFAVGLGLIVYAAKAG-GEDWQEFI-------RYFRESKL-IHITCLDFC
LLSAFSPFWVYNDLTARRW-KNGSW-LLPLALIPFVGPSLYLLLRPSLSSLLAATG-PSD
DK---TQ--
>gi|125561201|gb|EAZ06649.1|	   245 residues, 50 /line  hypothetical protein OsI_027881 [Oryza sativa (indica cultivar-group)]
-------MLSSSSSAAAAAV-----VLTTTSGRAPLLH----------------------
----------------------------------LPRTPRPTTAARIAAAPDSSRARAGG
AP------------LLLGSAVPRRRGWAL-------------------------------
------------------------------------------------------------
-----------------YR----------------------DTYFLQKLCNLKGD-----
------------------DGFR-MNDVLVPLWYIMGLWPLVYSMLLLPTGRSSKSKIPVW
---PFLILSCIGGAYALIPYFVLWK-PPPPPI---DEEEIG--------QWPLK---FLE
SK---LTAGVTFAVGLGLIVYAAKAG-GEDWQEFI-------RYFRESKL----------
----------------------EKW-LLASALGTYPFCGTFIVSFAEAITLFSA---SSN
RS---IR--
>gi|125603086|gb|EAZ42411.1|	   325 residues, 50 /line  hypothetical protein OsJ_025894 [Oryza sativa (japonica cultivar-group)]
-------MLSSSSSAAAAAV-----VLTTTSGRAPLLH----------------------
----------------------------------LPRTPRPTTAARIAAAPDSSRARAGG
AP------------LLLGSAVPRRRGWALVC---RDSSLPGPPGV--DPVAEEEENRKKT
EAVAAA----------AAARIASSGG-GGGGGGGSLS------DWTTSVLIFGIWA--GL
MYYIFQL----APNQTPYR----------------------DTYFLQKLCNLKGD-----
------------------DGFR-MNDVLVPLWYIMGLWPLVYSMLLLPTGRSSKSKIPVW
---PFLILSCIGGAYALIPYFVLWK-PPPPPI---DEEEIG--------QWPLK---FLE
SK---LTAGVTFAVGLGLIVYAAKAG-GEDWQEFI-------RYFRESKL----------
----------------------EKW-LLASALGTYPFCGTFIVSFAEAITLFSA---SSN
RS---IR--
>gi|4587614|gb|AAD25842.1|	   295 residues, 50 /line  hypothetical protein [Arabidopsis thaliana]
----MDRLMEATPKLESYKIRVQNVIFQAGHNVRIRAS----------------------
----------------------------------DPNP-KPKSQNIRIGFYTFKPEKSVS
DPNRTNKCVQFQPRIALFPKYEKKVTFFHIC---KSSS-NNPEEP--EKTQIQDEGR---
-------------------------------------------DWSSSILLFALWD--T-
-----------------------------------------RLVLFEKAFEF--------
--------------------------------------------------E---SKTPAW
---PFVVLSFFGGVYALLPYFALWN-PPSPPV---SETELR--------QWPLN---VLE
SK---VTAGVTLVAGLGIILYSVVGN-AGDWTEFY-------QYFRESKF-IHVTSLDFC
LLSAFAPFWVYNDMTTRKWFDKGSW-LLPVSVIPFLGPSLYLLLRPAVSETIAPKDTASS
DP---NQ--
>gi|116058021|emb|CAL54224.1|	   454 residues, 50 /line  unnamed protein product [Ostreococcus tauri]
MRAVDAPARAFTSPTRACARR----RDRARGRVAPKRSLKVTAVDVDARATIATMYDRIN
ARDVAGALECVAEDVVYEDFNFPEPFVGKAAVRALFEESCSGIPDDLAFVVDEWTSG---
SGASVGCTWHVE---IMGEAFPNARGCSLYRVN-GDGKLTYARDVVESPAKLGEASFSII
RAVAPLVKKRIAAKKGVKLEEPAATG-GGGGGE------------GNVAASVAFALGAAA
YWYVLLL----SPSDNPIPG----------DPAYAIKP---ETLQEVI--ASSTDFFYVL
P------LLNKFGIDLLGGAPY-VNPVSLGLFNFAEAFIFMLYPLYCMDKRGRD--LPAL
--KLWSIGMF-LTNAVLLPYMSIRA-KTPVSANWAPDETASGWGETETQGGRKGLM----
SKVFGGTGLGVGFLSIYWLLLEDST--AGGLA---ERLAYFDELMKSSRL-SIAFMVDIA
LAAAWQAYFMKSIS----Q-SSG-KDCGSLAYIPYWGLCVWLLQDD--------------
---------
>gi|145346791|ref|XP_001417866.1|	   429 residues, 50 /line  predicted protein [Ostreococcus lucimarinus CCE9901]
-----------MKLSRAATP---------------RRVAATPRAAVDAERTVREMYERIN
ARDVDGALACVDENVVYEDFNFPAPFRGKAAVKKLFEESCEGIPDDLTFVIDASTCG---
-GDAVGLTWHVE---LMGEAFPNARGCSFYRVDETNGKLVYARDCVESPLKPGEASFGII
RLVAPLVKKQIAAKRG--------EG-GGGDGAVETAKSSSSDAGGNALVSAAFWLAGAA
YWYVLLL----SPSDNPIPG----------DPAYAIKP---ETLQEVI--AESTDFFFVL
P------VLNKFGIDALGTAPA-VHPVSLGVFNFAEAFIFMLLPLYFMDKRGRD--LPTT
--KMWSIGMF-LTNAVLLPYMAIRA-ATPVR-DWNPESNANVDGWRETRLGEKGVM----
SKLFGGFGLAVGLLSVYWTLFEDPS--AGGLS---ERAAYFNNLMHTDRV-SVAFVVDIA
LVCCWQAYFMKSLD----------KDSGALAYIPYWGLCIWLLM----------------
---------
>gi|119485964|ref|ZP_01620026.1|	   216 residues, 50 /line  hypothetical protein L8106_05570 [Lyngbya sp. PCC 8106]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------------------------MWI--GF
VTYAFTL----APPDQP------------------------DTLVLIK--DLSTG-----
------------------NWQG-INPLIVALFNLMGIWPLIYSSLLFFDGQGQK--ISAW
---PFAMASFAVGAFAILPYLVFRQ-PNPNYS---GSLNF-----------VLK---LFD
SR---ITGILLTIGAVTLMGYGLN---GGDWSDFL-------QQWQTSRF-IHVMSLDFC
LLGLVFPALLWDDMARRKM-NNSFL-FWGVALLPLLGPLFYLCVRSPLSSTLGETETNQQ
QPQA-----
>gi|119513264|ref|ZP_01632306.1|	   219 residues, 50 /line  hypothetical protein N9414_07731 [Nodularia spumigena CCY9414]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------------------------------MFRKIAFGLLWL--GF
LTYAFLF----APPDQP------------------------DTFELIK--NLSVG-----
------------------KWEG-INPLVIALFNVMGIWPVIYSAVLFMDGRGQK--IPAW
---PFATASFALGAFALLPYLALRE-PNQEFS---GEKNF-----------WLK---LLD
SR---ITGLILTIGAAILVAYGL----QGDWGNFV-------QQWQTSRF-IHVMSLDFC
VLSLLFPALLGDDMARRGM-KNEPF-FWLITLIPLFGPLIYLSVRSPLLETNINTELSH-
---------
>gi|28976133|gb|AAO64398.1|	   219 residues, 50 /line  hypothetical protein [Nodularia spumigena]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------------------------------MFRKIAFGLLWL--GF
LTYAFLF----APPDQP------------------------DTFELIK--NLSVG-----
------------------KWEG-INPLVIALFNLMGIWPVIYSAVLFMDGRGQK--IPAW
---PFATASFAVGAFALLPYLVLRE-PNQEFS---GKKSL-----------WLK---LLD
SR---VTGLILTIGAAILVRYGL----QGDWGNFV-------QQWQTSRF-IHVMSLDFC
VLSLLFPALLGDDMARRGM-KNQVF-FWLIALIPLFGPLIYLSVRSPLLETNINTELSH-
---------
>gi|17231537|ref|NP_488085.1|	   226 residues, 50 /line  hypothetical protein alr4045 [Nostoc sp. PCC 7120]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------------------------------MVRKIAFGVLWL--GF
TFYAFVL----APPDQP------------------------DTFELIK--NLSTG-----
------------------QWQG-VNPLIIALFNLMGIWPMIYSALMFIDGRGQK--IPAW
---LFATASFGVGIFALLPYLTLRE-PNPQFP---GTKNT-----------LIK---LLD
SR---VTGMILTIVAAILVAYGLQ---QGDWSNFL-------QQWQTKRF-IHVMSLDFC
LLSLLFPALLGDDMTRRGW-QKPQL-FWVFALIPLFGPLLYLCLRPPLPEASVDLLSSQP
QKVAS----
>gi|75907882|ref|YP_322178.1|	   226 residues, 50 /line  hypothetical protein Ava_1660 [Anabaena variabilis ATCC 29413]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------------------------------MVRKIAFGVLWL--GF
TFYAFVL----APPDQP------------------------DTFELIK--NLSIG-----
------------------QWQG-INPLIIALFSLMGIWPMIYSAIMFIDGRGQK--IPAW
---LFTTASFGVGIFALLPYLTLRE-PNPHFP---GTKNT-----------LIK---LLD
SR---VTGVILTIVAGILVAYGLQ---QGDWSNFV-------HEWKTNRF-IHIMSLDFC
LLSLLFPALLRDDMARRGW-QKPQL-FWLFALIPLFGPLLYLCLRPPLPEASVAVISSQP
QKVAS----
>gi|23127747|ref|ZP_00109610.1|	   225 residues, 50 /line  hypothetical protein Npun02003258 [Nostoc punctiforme PCC 73102]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------------------------------MVRKIAFGFLWL--GF
TIYAFFL----APPEQP------------------------GTFELIK--NLSTG-----
------------------QWQG-VNPLVIALFNLMGIWPLVYSAVVFIDGKGQK--IPAW
---LFVTASFGVGIFALLPYLALRE-PNNQFV---GKKNI-----------LLK---LLD
SR---VTGIVLTVATVLLVAYGLK---GGDWGNFV-------QQWQTNRF-INVMSLDFS
LLSLLFPALLGDDMARRGW-KNPQI-FWLIALIPLFGPLIYLCVRPPLPEVGVEAIPGQQ
P-AAN----
>gi|126659484|ref|ZP_01730617.1|	   386 residues, 50 /line  hypothetical protein CY0110_07154 [Cyanothece sp. CCY0110]
------------------------------------------MIEKTAKDIIESIYQAIN
NREIEQAMQWVDDDCMYEDVNFSKTFQGKEAVKHLFQESCDNAPNDFKFVVDEITTG---
DPLKVGVLWHVE---LDNIPIPNGRGVSFYRISETTGKLIFARDIVEPPLKPGKLSFVII
RLVTPLIKTLLK--------------------------QDSNPPKTQLILSKLLWFLAGT
YIYILLC----SSPNFILPG----------EPVWAVQP---ETIKEVI--SESINFFFVL
P------ILNILGISVM-KSPI-VHPAIEAQFNFAEAWIFMFLPLLLADKRVRD--FPKV
--ALWSVAMFLTNV-FLLPYMAFRF-KQPNLE---KREEP-----------QKGIL----
ERIFGWTGLIVGITAIIWLFIGRPE--FGDLS---QRINYFITQLQSSRV-VIAFAVDLV
LFAIFQIVLMGAVIPPKNP-Q------RPLRFIPFFGLAFWLIL----------------
---------
>gi|67924420|ref|ZP_00517847.1|	   386 residues, 50 /line  hypothetical protein CwatDRAFT_1831 [Crocosphaera watsonii WH 8501]
------------------------------------------MIQKTAKEIIESIYQAIN
NRDIEQAIQWVDDDCLYEDMNFSQPFQGKEAVKTLFQESCDNVPDDLKFIIDEITTE---
DPLKVGILWHVE---LDDIPLPNGRGVSFYRISETTGKLIFARDIVEPPLKPGKLSFLII
RLVTPLVRIFLA--------------------------KDSNPPKTQLILSKILWFLAGT
YIYVLLC----SSPNFILPG----------EPFWAIQP---ETITEVL--NESLNFFFIL
P------ILNSLGISSM-ESPV-VHPAIEAQFNFAEAWIFMFLPLLLADKRVRD--FPKL
--ALWSVAMFLTNV-FLLPYMAFRF-KQPILE---TKEEP-----------KKGIL----
ERIFGWMGLIVGVTAISWLFIGRPE--FGDVN---QKIAYFMTQLNSSRV-VIAFAVDIF
LFAIFQIVLMSSIIPSNSP-Q------RPLRFIPFFGLAFWLII----------------
---------
>gi|126659929|ref|ZP_01731053.1|	   213 residues, 50 /line  hypothetical protein CY0110_09216 [Cyanothece sp. CCY0110]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------------------------------MIAKVFLGLLWV--GF
IIYGFLL----APPGQP------------------------DTIELIK--NLSTG-----
------------------NWDN-INPLIIAVFNSIGLVTVIYANLLFIDGREQK--IVAW
---PFAIASLAVGTFAVIPYLILRE-PNPKFS---GEKNL-----------LIK---LAD
SR---LLHIVLSIALIVFITWGFI---TGNWSNFI-------QEWQTRRF-INVMSLDLL
CLCLIFPFIIKDDMLRRNL-KS-DALFWTVSLIPLLGTLIYLSFRPSLPENK--------
---------
>gi|67921544|ref|ZP_00515062.1|	   215 residues, 50 /line  conserved hypothetical protein [Crocosphaera watsonii WH 8501]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------------------------------MISKIFMSLLWV--GF
LIYGFLL----APPGQP------------------------DTIELIQ--NLSTG-----
------------------NWDN-INPLIISVFNSIGLVTVLYANLLFIDGREQK--IVAW
---PFAITGLALGTFAILPYFILRE-PNPKFS---GEKNL-----------FIK---LSD
SR---FLHLLLTITLLVFVFWGAI---SGSWVDFV-------SEWQSRRF-INVMSLDLL
CLCLIFPLIIRDDMLRRNI-DS-NTLFWVISLIPLLGTLVYLCFRPSLPQSETN------
---------
>gi|145345268|ref|XP_001417138.1|	   252 residues, 50 /line  predicted protein [Ostreococcus lucimarinus CCE9901]
------------------------------------------------------------
--------------MTA-------------------RGARRCATT---------------
---------------------------RRASTPEA-------------------------
---REASDGSFE--------------------------WYR---EPQRVATACAWV--AL
GSFATFG----APSGTSA-----------------------FDLELVK--SLVSA-----
------------------PFTGAVNPLFEALFNSLGVVPATYACLMMPGAKGNKSPFPAA
---LCVGASFALGFFALGPYLVTRE-PRTRVK---RSELG---------FVTRN---IWE
SK---LNAAALLGFAAYLAFYGASNVTPDTLAGFA-------TLFKEQSMLACVSTCDLI
VLSLCVAPAIAEDMRRRDV-DD-ANAL-AFASVPVLGPACWLLVRPSLED----------
---------
>gi|147784272|emb|CAN68342.1|	   349 residues, 50 /line  hypothetical protein [Vitis vinifera]
---------------------------------------------MASP------ALLCN
NICTR---FWVSSLCQTRYQMQLHQRRRPSVNFHTQHNASL-------------------
----------------------------------------------------RFAPLVCR
ASPREEKEVVVE--------------------------GDD---GMRRLLQILLWG--AE
GIYIFWLFLLPYAPGLSATLKIXSLYYMLLSPIRLISKRKPQNSHPIV--TSPYSYVSIL
DHLCNXFFGRVVGIHLI-ESPV-LHPMSEGLFNFVIGWTFMFAPLLFTDYKRDR--YKGS
LDVLWGFQMFLTNT-FLIPYMAIRL-NDEDAE-YIPRKPS-----------RLGSVMIHG
APIVGLIGGAVCLISALWAFFGRQ---DSNFGSIADRLEFLVSYLGSERL-AYAFIWDIC
LYIIFQPWLIGDNLQNVQK-SK-VSFVRYLRFVPVIGLIAYLLFLNLDEE----------
------P--
>gi|16329989|ref|NP_440717.1|	   222 residues, 50 /line  hypothetical protein slr1215 [Synechocystis sp. PCC 6803]
------------------------------------------------------------
---------------------------------M--------------------------
------------------------------------------------------------
--------------------------------------------VLNRLALACLWL--AL
VIFAFGF----APPSNP------------------------QTLVLIK--SLSLG-----
------------------QWQD-INPVIIALFNLMGIWPMTYAAMLLGDRQGRK--FPAW
---PFVAGSFFLGAFALLPYLVFWP-PTAPTD-PA-PSNLG-------SSKLTK---FWR
SP---WLGRVLFLLAIACVSGAVF---RGDWADYG-------QQLQTNQF-IAVMSSDFL
CLTLAFPLVLAQELKHQKA-SP-SLLLVLGSTVPLFGALAYLSIRPNFVVKD-QI-----
--------S
>gi|18404669|ref|NP_566779.1|	   335 residues, 50 /line  unknown protein [Arabidopsis thaliana]
------------------------------------------MILITSP-----------
------------TLTYLRHRLHSSQIKSPQIRRHFLRSREISTVD---------------
---------------------------RCYNPWQSTNRF---------KLRTRDSSFLCC
ARRKPETATVEV--------------------------EDD---SIRRIVRYLLWT--SE
AVYILWLFLLPYAPGDP---------------VWAISS---ETVNSLL--GLSLNFFFVL
P------LTNAAGIHFL-QAPV-LHPMAEGLFNFVIAWTLMFAPLLYTDRKRNR--YKSS
LDVLWSLMMFLTNT-FLIPYMALRL-NDADPD-DKPSKRS-----------QLGEVMTKG
APIVGLTGATVCLISALWSLYGRA---DGDFGGIMDRWQYLIGYLGSERL-AYAFIWDIC
LYTIFQPWLIGENLQNVKK-NK-IELVKYLRFVPVFGLLAYHLFLNLEDES---------
------I--
>gi|22299194|ref|NP_682441.1|	   232 residues, 50 /line  hypothetical protein tll1651 [Thermosynechococcus elongatus BP-1]
------------------------------------------------------------
------------------MTVEETAIRSPLANAY--------------------------
------------------------------------------------------------
--------------------------------------------PVLRLFLAVLWV--GL
IVYSFGF----APPDQP------------------------QTLTLIQ--RLATG-----
------------------NWQG-INPLIVSLFNLMGVWPLIYTALLVVDGQGQR--FPAW
---PFAAFSFVVGAFALLPYLILRQ-PAPLFT---AELNR-----------GVR---LWE
SR---ITGIGIFLLAIVLLSYGLF---AGDWQDFW-------QQWHSSRF-IHVMTLDFC
LLSLLLPVLLVDDWQRRGL-EKSPWR--WWSLVPFVGALGYLLLRPPLILSKKSVA----
---------
>gi|22652039|gb|AAN03581.1|AF381047_3	   231 residues, 50 /line  hypothetical protein [Synechococcus sp. PCC 7002]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------------------------------MARSIFLGSLWL--AF
VLYAFLG----APPNQP------------------------ETLELIT--ALSGG-----
------------------QWDG-INPLIIALFNIMGIFPVMYGALLFLDGDRQK--LPAW
---VFAAGSFFLGAFALLPYLALRR-DNPTFT---GQKNW-----------WLR---WQD
SR---LLGLFCLVALLGLLIYGFS---AGDWGDFG-------TRFWGDRF-IHVMSLDFC
LLALLFPTLIKDDSARRGL-GEQNWLLWAIAFTPPLGAALYLALRPPTLEHENPVTSSQP
PNTAEVSRS
>gi|37519830|ref|NP_923207.1|	   219 residues, 50 /line  hypothetical protein gll0261 [Gloeobacter violaceus PCC 7421]
------------------------------------------------------------
---------------------MP----------M--------------------------
------------------------------------------------------------
--------------------------------------------VAVRIALAALWL--GF
VAYAFLG----GPPETR------------------------SPLQQAA--SLADL-----
------------------ALGR-GEPLSVALFNLMGLIPLAYLFLLVPDAHGEK--LPAW
---PFAVASFAVGAFALLPYLICRR-PHGVWP-HIPPAGR-----------AAR---LFD
SR---WFALAVMAGVAGLFWFGLT---QGNWAAFA-------EQWRTSRF-VHVMGLDFL
VSTALLPLLIGDDLRRRSV-K-RTWPLWIACALPLFGPLLYLVLRPSLPARAV-------
---------
>gi|56750985|ref|YP_171686.1|	   230 residues, 50 /line  hypothetical protein syc0976_c [Synechococcus elongatus PCC 6301]
------------------------------------------------------------
--------------------MDS----------S--------------------------
------------------------------------------------------------
--------------------------------------------LLKRSLAAIAWL--SL
VSYTALL----APPDDP------------------------QTWDLIR--RLSLG-----
------------------QWQG-INLLIVALFNAMGLWPLLYGPLLLLDGHQRG--WRAW
---PFAIASFGAGAFALLPYFVFRPLPTGSLP---VAWPP-----------LLQ---KLD
RR---WLTLPLGIA-IALLGLLAL---QGDLADFV-------QQFQTSRF-IQVMTLDFA
CLTLLFPVLLLEDAHRRGD-R--RRIWPLIGFLPLLGAVIYQGWRLPLPKAKSLSASDEA
TAAA-IS--
>gi|68054053|ref|ZP_00538218.1|	   205 residues, 50 /line  hypothetical protein ExigDRAFT_2894 [Exiguobacterium sibiricum 255-15]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------------------------------MYRRYLLFLVWA--VA
IIFILLF----GNNRVF------------------------PSGFLLS--FLRFD-----
------------------QSQ--FDTSALSLFTLLGIYPAAFFMLFLDEKRFLK--PSPM
---LASFGAFALGSFILMPYLALAI-PRQTFL---PFRR-------------RK---FIP
YV---VA--VLAVLSAIIIWLALA---RSDWSIFG-------VYFMTNQF-VRTMTVDLV
MFYILQLFMLHRIRARQN-----TRLG-WRDLVPLFGLFSYLFRR-HLPTSSN-------
------G--
>gi|113475799|ref|YP_721860.1|	   245 residues, 50 /line  hypothetical protein Tery_2153 [Trichodesmium erythraeum IMS101]
------------------------------------------------------------
----------------MTQSNLPK------------------------------------
-------------------------------------------------Q-Q--------
---------------------------------------------NSPIISILLWLLSAT
YIYILLL----SPQDQLLPN----------GPIWAVQP---ETIKEVI--EVSINFFFIL
P------IFNVIGIKYM-EAPI-VHPWLESLFNFAEAWIFMFLPLLLVDRRGGE--LPKI
--LIWSMAMFLTNT-FLLPYMAWRS-TATELP---IEEQM-----------SKGLL----
AKIFGVVGLIIGSIAIVWGIFARPE--FGDIA---TRGKFFIQNFQSDRL-TIAFCVDVI
LFAIFQAVLIGNIEPPESG-K------RWLRFIPFWGLAVWLIL----------------
---------
>gi|119489733|ref|ZP_01622491.1|	   246 residues, 50 /line  hypothetical protein L8106_10317 [Lyngbya sp. PCC 8106]
------------------------------------------------------------
----------------MAQSNFTK------------------------------------
-------------------------------------------------LQP--------
---------------------------------------------SQRLISALLWLLSAI
YIYILLL----SPSQQLLPG----------EPIWAVQP---ETLKEIV--NESINFFFIL
P------LFNAVGIKSM-QAPI-VHPWIESLFNFAEAWILMFLPLLLLDSKGKE--LPKI
--IIWSLAMFLTNT-FLLPYMAWRF-TVPELQ---PEEKQ-----------TKGLL----
AKIFGYIGLIVGIVSVFWAVFARPE--FGDIP---AKTEFFIGNFMSNRV-TIAFCVDVV
LFYIFQIILMGSIEPVDSR-K------RGLRFVPFWGLAIWLIL----------------
---------

Ad blocker interference detected!


Wikia is a free-to-use site that makes money from advertising. We have a modified experience for viewers using ad blockers

Wikia is not accessible if you’ve made further modifications. Remove the custom ad blocker rule(s) and the page will load as expected.