FANDOM


>gi|22325461|ref|NP_178508.2|	   713 residues, 50 /line  glycoside hydrolase starch-binding domain-containing protein [Arabidopsis thaliana]
----------MQTDSEQDVESCDDNENNLNTDEQNHQLTET-------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------LLPDGGFF-QSE
S---IATTILINSSICTVQRIAVLEGGKLVELLLEPVKTNVQCDSVYLGVITKFVPHMGG
AFVNIGSARHSFMDIKSNREPFIFPPFCDGSK---KQAADGSPILSMNDIPAPHEIEHAS
YDFEASSLLDIDSNDPGESFHDDDDEHENDEYHVSDHLAGLVN-GTVVNHGAVEVGSENG
HIPMERGHSADSLDS--NASVAKASK--VM-SS---KDNKWIQVRKGTKIIVQVVKEGLG
TKGPTLTAYPKLRSRFWVLLTRCK-RIGVSKKISGVE-RTRLKVIAKTL--QPQGF--GL
TVRTVAAGHSLEELQKDLDGLLLTWKNITDEAKSAALAADEGVEGAIPALLHRAMGQTLS
VVQDYFNDKVEKMVVDSPRTYHEVTHYLQDMAPDLCNRVELHDKGIPLFDLYEIEEEIEG
ILSKRVPLSNGGSLVIEQTEALVSIDVNGGHGMFGQGNSQEKAILEVNLAAARQIAREIR
LRDIGGIIVVDFIDMADESNKRLVYEEVKKAVERDRSLVKVSELSRHGLMEITRKRVRPS
VTFMISEPCSCCHATGRVEALETTFSKIEQ------------------EICR--------
------QLAKMEKRGD-----------------------------------------LEN
PKSW--PRFILRVDSHMSSFLTTGKRTRLAILSSSLKVWILLKVARHFTRGTFEVKPF--
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------MDEKT--------------------
---------------------------VNERQHQ--------------------------
----------------------VAISL---------------------------------
------LKKADAIADSSGKKKLTLIPIKKEKTSGKQR-----------------------
------------------------------------------------------------
---R
>gi|117927963|ref|YP_872514.1|	   702 residues, 50 /line  ribonuclease, Rne/Rng family [Acidothermus cellulolyticus 11B]
MPENEPNESVAKTDAPRRIRRSRRTAGSDTAAVESTSASPSRAPDAATLNDATPAGESGT
GAPVAELPPVKRPAVPPPMVVFQPPPPVVFQAPEPAAVTSRRRRARRVPEEPSAALSSTD
GAAGEPEIRSADLDDGSAPSEPAEQVSAATTEGITARRRRRRRRRTTGTAEDDRVLDAVE
APETDTGSAGADDLDAAMALLTGSTRIEAKKQRRREGRELLRRNRRGMILTEAEFLARRE
S---VERVMVVRQR-GDLTQIGVLEDGILVEHYVSTTSANRIVGNVYLGRVQNVLPGMEA
AFVDIGKGRNAVLYAGEVNFDL--------------------------------------
------------------------------------------------------------
--------------------------TGLE-GQ---PQRIEAALKPGQTVVVQVTKDPIG
HKGARLTSQISLPGRFLVFVPEGS-MMGISRKLPD-TERNRLKAIL-RKI-MPEGA--GV
IVRTAAEGASEEELARDIARLMAQWEDIQKKAESG----------TAPALLYAEPDLTIR
VVRDIFNEDFAQLVVQGDSEWDMVEAYVAHVAPDLLPRISHWTSDEDVFAHYRIDEQLAK
ALDRRVWLPSGGYLIIDRTEAMVVIDVNTGRFV-GKGGNLEETVTKTNLEAAEEIVRQLR
LRDIGGIIVIDFIDMLLESNRELVLRRLVECLGRDRTKHQVAEVTSLGLVQMTRKRVGSG
LLEAFSEPCEVCGGRGVIIHTDPVTAQR--------------------------------
---------------------------------------------------------RAH
RGRARTRQEAEPSAEPVAEPAAVGAAGAE----------------------------R--
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------RGRRS--------------------
---------------------------ARAAS----------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----
>gi|119355890|ref|YP_910534.1|	   565 residues, 50 /line  ribonuclease, Rne/Rng family [Chlorobium phaeobacteroides DSM 266]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------------------------------------------MKK
S---LNKQLLMNKT-GDEIQVALVEEGRLAELIIERPESRRSIGDIYLGRVHKVVEGLKA
AFVDIGQKSDGFLHFSDVGTT--------------------------------------T
EDYRAL----IEDDDDDDTTGTDESDGDEI-------AAVL-S-QP------AVL--PEQ
NG-KSSARSGAKRLTAP--AQDGEDGGRRQ-SY---TQMIAGKLKPNDSILVQVIKEPIS
TKGSRLTSDITIAGRFMVLLPFGGGQVAVSRRVIARKERSRLKKL-VRSM-LPDGF--GA
IIRTVAEMQEETLLKQDLEKLLAKWTQIEEKLQDA----------VPPQLIFKEDTIISS
VLRDSLNADVTEIVANSPVIYKETLNYIQWAAPEMEKNVTLYQGKLPLFEGYSIAKDVES
IFSRKVWLKSGGYIIIEHTEAMVVIDVNSGRY--AAKREQEENSLKTNLEAAREIVRQLR
LRDIGGIIVVDFIDMLDQKNAKKVYDSMRTELRNDRAKSNILPMSDFGIMQITRERIRPS
LMQRMGDQCPACGGTGVVQARFTTINQIER------------------WLRK--------
---------------------------------------------------------YAL
QNTMKLQQLDLYVSPTVAEPLQQSEMNTELKWFLQHLLFVRVKPDESLRSDDFRFYSR--
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------KNNKE--------------------
---------------------------ITAEYGD--------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---L
>gi|67939525|ref|ZP_00532023.1|	   572 residues, 50 /line  Ribonuclease E and G [Chlorobium phaeobacteroides BS1]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------------------------------------------MKK
T---VKKQLLMNKS-GDEIQVALVEEGRLAELVIERPDSLRSIGDIYLGRVHKVVEGLKA
AFVDIGQKSDGFLHFSDVGTT--------------------------------------T
EDYRAL----IEDDDDDDENGNGDADADEE-------GKAGMK-TQQEQKEDTRR--PSP
AG-NGQKNGGSRSKGNG--ASAGKDGDGRQ-SY---TQMIAGKLKTNDSILVQVIKEPIS
NKGSRLTSDITIAGRFMVLLPFGGGQIAVSRRVVSRKERARLKKL-VRSM-LPDGF--GA
IIRTVAELQEEELLKKDLEKLLVKWEQIEEKLKDA----------KPPQLIFKEDTIISS
VLRDSLTTDVTELVANSQSIHKETLNYIQWAAPEMEKNVFFYQGKLPLFEGYGIAKDVES
IFSRKVWLKSGGYIIIEHTEAMVVVDVNSGRY--AAKKEQEENSLKTNLEASREVVRQLR
LRDIGGIIVVDFIDMLDPKNSKKVYDSMKNELRQDRAKSNILPMSDFGLMQITRERIRPS
LMQRMGDQCPACGGSGIVQARCTTINQIER------------------WLRK--------
---------------------------------------------------------YAL
QKKMVFQQLDLYVSPTVAEPLRDTDRNIEMKWFLQHLLFVRVKQDESLRSDDFRFYAR--
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------KNSAD--------------------
---------------------------LTAEYGD--------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---L
>gi|145218838|ref|YP_001129547.1|	   564 residues, 50 /line  ribonuclease, Rne/Rng family [Prosthecochloris vibrioformis DSM 265]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------------------------------------------MKK
S---VKKQLLMNKT-GDEIQVALVEEGRLAELIIERPESRRSIGDIYLGRVHKVIEGLKA
AFVDIGQKSDGFLHFSDVGTT--------------------------------------T
EDYKAL----IEDDDDDDDGVEGDEEGDAK-------GSS------------AVQ--AEP
SGAKTVARSGGRGPSASGKDSRSEQAEKRQ-SY---TQMIAGKLKANDSILVQVIKEPIS
TKGSRLTSDITIAGRFMVLLPFGGGQVAVSRRVVSRKERARLKKL-VRSM-LPEGF--GA
IIRTVAEMQEESLLRQDLEMLLGKWTQIEEKLKDA----------TPPQLIFKEDTIISS
VLRDSLNSDVTEIVANSPSIHKETLNYIEWAAPDMVKNVSLYQGKLPLFEGYGIAKDVES
IFSRKVWLKSGGYIIIEHTEAMVVVDVNSGRY--AAKREQEENSLKTNLEAAREVVRQLR
LRDIGGIIVVDFIDMMDSRNSKKVYDTMKGELRNDRAKSNILPLSDFGVMQITRERIRPS
LMQRMGDQCPACGGSGVVQARFTTINQIER------------------WLRK--------
---------------------------------------------------------YAL
QQSMKFQQLDLYVSPTVIEPLQNSDMKTEMKWFLQHLLFVRVKEDESLRSDDFRFYSR--
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------KNSKD--------------------
---------------------------ITAEYGD--------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---L
>gi|67918586|ref|ZP_00512182.1|	   566 residues, 50 /line  Ribonuclease E and G [Chlorobium limicola DSM 245]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------------------------------------------MKK
S---MNKQLLMNKI-GDEIQVALVEEGRLAELTIERPESRRSIGDIYLGRVHKVVEGLKA
AFVDIGQKSDGFLHFSDVGTT--------------------------------------N
EDYRAL----IEDDDDDESVSSDDGDGDAV-------EVAA-----TAGGGDPPA--AGP
HA-RGPQRNGGRK----GPVTEEEKAEKRQ-SY---TQMIAGKLKPNDSILVQVIKEPIS
SKGSRLTSDITIAGRFMVLLPFGGGQVAVSRRVVVRKERARLKKL-VRSM-LPEGF--GA
IIRTVAEQQEESLLKQDLEKLLTKWVQIEEKLKDA----------SPPQLIFKEDTIISS
VLRDSLTSDVTEIVANSPVIYKETLNYIQWAAPEMEKNVSLYQGKLPLFEGYSIAKDVES
IFSRKVWLKSGGYIIIEHTEAMVVVDVNSGRY--AAKREQEENSLKTNLEAAREIVRQLR
LRDIGGIIVVDFIDMLDPKNAKKVHDAMKTELRNDRAKSNILPMSDFGIMQITRERIRPS
LMQRMGDQCPACGGTGVVQARFTTINQIER------------------WLRK--------
---------------------------------------------------------YAL
QQSMKFQQLDLYVSPTVAEPLRNTEMKTELKWFLQHMVFVRVKQDESLRSDDFRFYNR--
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------KNNKD--------------------
---------------------------ITAEYGE--------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---L
>gi|78185904|ref|YP_373947.1|	   570 residues, 50 /line  Ribonuclease E and G [Pelodictyon luteolum DSM 273]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------------------------------------------MKK
S---VKKQLLMNKT-GDEIQVALVEDGRLAELIIERPESRRSIGDIYLGRVHKVIEGLKA
AFVDIGQKSDGFLHFSDVGTT--------------------------------------T
EDYRAL----IEDDDDDDETAADETGTAED-------GADEEE-APVAAGAPQE-----Q
QGSRQSSRSGGRKPQP--QQRKEDGAEKRQ-SY---TQLIAGKLKANDSILVQVIKEPIS
TKGSRLTSDITIAGRFMVLLPFGGGQVAVSRRVVSRKERARLKKL-VRSM-LPEGF--GA
IIRTVAEMQEETLLKQDLEKLLAKWTQIEEKLKDA----------APPQLIFKEDTIISS
VLRDSLTSDVTEIVANSPSIHKETLNYIEWAAPEMVKNVSLYQGKLPLFEGYGIAKDVES
IFSRKVWLKSGGYIIIEHTEAMVVVDVNSGRY--AAKREQEENSLRTNMEAAREVVRQLR
LRDIGGIIVVDFIDMMDARNSKKVYDSMKGELRNDRAKSNILPMSDFGIMQITRERIRPS
LMQRMGDQCPACGGSGVVQARFTTINQIER------------------WLRK--------
---------------------------------------------------------YAL
QHAMKFQQLDLYVSPTVAEPLKNSDMNTELKWFLQHMLFVRVKQDESLRSDDFRFYTR--
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------KDSRD--------------------
---------------------------ITAEYGD--------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---L
>gi|78189942|ref|YP_380280.1|	   568 residues, 50 /line  Ribonuclease E and G [Chlorobium chlorochromatii CaD3]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------------------------------------------MKK
S---STKQLLMNKT-GDEIQVALVEEGRLVELIIERPESRRSIGDIYLGRVHKVVEGLKA
AFVDIGQKSDGFLHFSDVGTT--------------------------------------N
EDYRAL----IEDDDDDDAIIGDDIESDEAT------GQNDSE-FDEASDGETTV-----
SAPKTVARSNSKKPS-----SGEQSGEKPQ-TY---TQMIAGKLKPNDSILVQVIKEPIS
SKGSRLTSDITIAGRFMVLLPFGGGQVAVSRRVVSRKERSRLKKL-VRSI-LPEGF--GA
IIRTVAEDQEEALLKQDLEKLLTKWKQIEEKLQDA----------TPPQLIFKEDTIISS
VLRDSLTSDVSEIVANSPAIYKETLNYIEWAAPEMVKNVALYQGKLPLFEGYAIAKDVES
IFSRKVWLKSGGYIIIEHTEAMVVVDVNSGRY--AAKREQEENSLKTNLEAAREVVRQLR
LRDIGGIIVVDFIDMLDPKNAKKIYDAVKTELRNDRAKSNILPMSDFGLMQITRERIRPS
LMQRMGDQCPACGGTGIVQARFTTINQIER------------------WLRK--------
---------------------------------------------------------YAL
QHPLRFQQLDLYVSPTVLEPLQNSDMKTEMKWFLQHMLFVTVKGDESLRSDDFRFYNR--
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------KNNKD--------------------
---------------------------ITAEYGE--------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---L
>gi|146296322|ref|YP_001180093.1|	   571 residues, 50 /line  ribonuclease, Rne/Rng family [Caldicellulosiruptor saccharolyticus DSM 8903]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----MQSEIIVDV-SFGETRVAVLEDKELVEIYIERNDQQSIVGNIYKGVVENILPGMDA
AFVNIGQDKNAFLYLGDINRLE-FGDTDE-------------------------------
------------------------------------------------------------
-----------------------------Y-YE---IKTNPLALRCGQEIVVQVIKEAYD
QKGPRVTTNITLPGRYLVLLPNTD-YIGISKRIEFEEERTRLKEIACKI--KPDGM--GL
IVRTAAEGKSEEVLRNELEFLRNLWQKIRQKSKES-----------APVLLYKDYDLVFK
AVRDMFTNQVDRFVINDRKKYNKIIEFLSTYAPSLKSKVEYFNLATNIFEYFQIEQKLSK
ALSKRIWLKSGGYIVIDETEALTVIDVNTGKF--VGKNDVSETILKTNLEAAVEIARQIR
LRDIGGIIIIDFIDMKNPEHQKLVLDALKEALKRDKTKTVVVGITPLGLVEMTRKKVRQR
LSCIMQSCCPYCEGSGKILSPETVGLKVLK------------------EIEW--------
---------------------------------------------------------YFK
NRVE--EKFFVEINTKVCEVLRKGEVDRIKELQEKYKKKVYLKASSNIHINKFTICPV--
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------KDEDH--------------------
---------------------------YMALCGA--------------------------
----------------------LSEGDEVLAFVEEEDKFNPKNAVGYVNQNRIEFDDASD
LIGKYIYAKVEKVYGTMSKGKIL--EVCEENKEDVKE-----------------------
------------------------------------------------------------
---F
>gi|148652236|ref|YP_001279329.1|	   613 residues, 50 /line  ribonuclease, Rne/Rng family [Psychrobacter sp. PRwf-1]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----MSEELLINVSPME-SRVAVLDNGVVSEVYIERHNKLGLVGNIYLGTVVRVLPGMQA
AFVEIGQSRTAFLHVNDMRRIARPAPTADKAPEIRHNAKQEPTVLTSMPVDRCEHIAENV
VTASDTMASVIAETEPAMEADPLSAKTEIEAGSLREKKSALADESDNLKNDLLDNALLEI
DSPDMVGNAITKADT--KPAAVKERQIIEP-PR---HELIQYRLHEGQKILVQVTKDQLG
TKGARLTTNISLPSRYLVYLPSSE-HIGISQRIDNEEERHRLKTELGALM-QTVNLTGGL
IARTAAERVPVAKLEEDIYYLVQLWRTIQARKEASA------GSGQSAVLIYQELSLPLR
SIRDLVHPDTEKVIVDHEGMYNEVRQFAKEFVPFIYPRILPYSGEQPLFDVHRVEEDLRD
ALKRRVDLKSGGYLIIDQTEAMTTIDVNTGSF--VGGRSLEDTVYKTNLEATHAIARQLR
LRNLGGIIILDFIDMLEQQHKDDVLENLQYQLSQDYAKTKITQVSELGLVEMTRKRTRES
LEQQLCEPCKTCEGKGFIKTAETVCFEIFR------------------EIMR--------
---------------------------------------------------------CAR
TYNSP-KKFTVVAHASVIDLLLSSEADTVADLEYLLGRVITFEVENLYTQEQYDI-----
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------VL-----------------------
------------------------------------------------------------
---D
>gi|30678106|ref|NP_850989.1|	   619 residues, 50 /line  glycoside hydrolase starch-binding domain-containing protein [Arabidopsis thaliana]
----------MQTDSEQDVESCDDNENNLNTDEQNHQLTET-------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------LLPDGGFF-QSE
S---IATTILINSSICTVQRIAVLEGGKLVELLLEPVKTNVQCDSVYLGVITKFVPHMGG
AFVNIGSARHSFMDIKSNREPFIFPPFCDGSK---KQAADGSPILSMNDIPAPHEIEHAS
YDFEASSLLDIDSNDPGESFHDDDDEHENDEYHVSDHLAGLVN-GTVVNHGAVEVGSENG
HIPMERGHSADSLDS--NASVAKASK--VM-SS---KDNKWIQVRKGTKIIVQVVKEGLG
TKGPTLTAYPKLRSRFWVLLTRCK-RIGVSKKISGVE-RTRLKVIAKTL--QPQGF--GL
TVRTVAAGHSLEELQKDLDGLLLTWKNITDEAKSAALAADEGVEGAIPALLHRAMGQTLS
VVQDYFNDKVEKMVVDSPRTYHEVTHYLQDMAPDLCNRVELHDKGIPLFDLYEIEEEIEG
ILSKRVPLSNGGSLVIEQTEALVSIDVNGGHGMFGQGNSQEKAILEVNLAAARQIAREIR
LRDIGGIIVVDFIDMADESNKRLVYEEVKKAVERDRSLVKVSELSRHGLMEITRKRVRPS
VTFMISEPCSCCHATGRVEALETTFSKIEQ------------------EICR--------
------QLVSV-------------------------------------------------
-------------------------------IISILFCY-------------FSFQP---
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------NEEHLE--------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----
>gi|83814929|ref|YP_444634.1|	   596 residues, 50 /line  ribonuclease, Rne/Rng family subfamily [Salinibacter ruber DSM 13855]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----MSKEIVFNV-GNEQTRIAIVEDGKLVELYIENAEHKRTIGNLYLGQIRKVMPSIQA
AFVDIGQEQDAFLHFSDLSDNL--------------------------------------
------------------PYLLDFLGLEAPTVEAIDV-----------------------
-------------------------PKGKK-DW---DKRPSDLLNRGQTILVQVTKEPIS
NKGSRISTDISLAGRFLVLVPLQN-YVAVSRKITDDEERRRLES-LASSL-VPDGV--GV
IVRTVAQDRDAKSLDKDMKLLMERWRRVEKRLKDK---------PSPPELVHEDVDMASS
IVRDEFSEEYDRILVDHEGLYSSIQSYVRAVGPQLVDRVELHEGDQPVFESVGIQHGADR
AFKDRVELPSGGYLFIEKTEAMHVVDVNSGRS--GKGKSQAENSLNVNLEAARVIARQIR
LRDLGGIIVVDFIDLRDEDDKKKVYDEVKKGFEEDRAVTKVLPMSDFGLVEITRQRLRPS
ITTTFSSANGTPSDDGDDGADPEELRQAERKIQSLEKEVEKREREVKRLKAEDDTPDEEV
TALRQKIQALEDKLEAARAQQTAENATPRPSSSDGSAASAEGDAAPDELVEDIEQWLVAH
SDTH--RAVTLRVHPFVAAFLRRPVPTYTTRWFMEHLVRVHVEADTEVPPHTFQVT----
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------DESG---------------------------
------------------------------------------------------------
-----------------------APLPES-------------------------------
------------------------------------------------------------
---P
>gi|87306478|ref|ZP_01088625.1|	   588 residues, 50 /line  ribonuclease E [Blastopirellula marina DSM 3645]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----MKKEMLINVSQPEECRIAIVEDGILEEFYLERTSQDNYVGNIYKGVVVNLEPSIQA
AFVDFGVGKNGFLHISDVEPQY-F------------RQGGYDPAEQLDDDFGGSYGGATA
ADF---------SDDDEEEISDSSGDDEEDKPDANDD-----------GDGDS-----DD
DAPPKPPQSRGRGQR--RPQQRRQRPGMRP-RV---KPPIQEIFKRGDEVLVQVIKEGIG
SKGPTLSTYISIPGRYLVLMPALG-RVGVSRKIEDDQVRRRLRSTLLELS-PPKGL--GF
IVRTAGQERNKKELSRDMAYLLRLWKVIVRRLKNT----------TGPCDIYEESDMIIR
TIRDIFSSDVDSIYVDSEPAYERAKEFLQLVMPRHVNRLKKYESKDPLFHKYHLDEEIAR
INQREVPLRRGGSIVIDQTEALVAIDVNSGNF--RYDGTAEEAAYQLNMMAAKEIARQLR
LRDLGGVVVNDFIDMRREKHRRNVERALRDSVKRDRARTKILKTSPFGLIEMTRQRIRPS
LKRSVFKDCPCCKGRGVVKSAESMAIEVVR------------------MLLA--------
---------------------------------------------------------AAH
HDGA--SHVTIRVNDEVATYLNNKKRRELARIEEDTNIVVQIYGSESFYPEHLEVECV--
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------DADG---------------------------
------------------------------------------------------------
-----------------------RRLHFDDRPTGNAR-----------------------
------------------------------------------------------------
---H
>gi|114331691|ref|YP_747913.1|	   849 residues, 50 /line  ribonuclease, Rne/Rng family protein [Nitrosomonas eutropha C91]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----MKRMLFNAT-QPEELRVAIVDGQKLIDIDIETLGKEQRKSNIYKAAVTRLEPSLEA
AFVDYGAGRHGFLPYKEIAPTC-F------------DK----------------------
------------------------------------------------------------
---------------------------NTE-RSS---HRIGELLREGQELIVQVDKDERG
NKGAALTTYISLAGRYLVLMPNNPQGGGISRRVSA-EERAELREVI-NHLQVPDGM--SI
IARTAGIGRNEEELQWDLNYLVQLWRAIEGAASSER----------GVFLIYQESSLVIR
AIRDYFHAEIGEILIDNPEIYEQAYQFMANVMPANVDRLKLYQDDIPLFSRFQIEHQIET
AYSRQVTLPSGGSIVIDHTEALVSIDVNSARA--IRGSDIENTALNTNLEAADEIARQLR
LRDLGGLVVVDFIDMEVTRNQREVETNLLKALRLDRARVQIGKISRFGLLELSRQRLRPS
LGEGNYIPCPRCHGTGHIRGTDSSALHILR------------------IIQE--------
---------------------------------------------------------EAM
KEQTSMLQVQLPV--DVATFLLNEKRSEIYRLEARLKVGIILIPNIYMETPNYTINRLRH
EDVKSTEL-----PPSYGMVEKTTEEIT-LPSTSQELK--AIRP---KAAVTGIK-PEQP
APVP-EEKPREQ----LS--------------FLDKFF-SLFR--P---ASSSR-----V
EPEQTAEESQARPLRSERGR----NRRDRGRNKRTKNNIPGTTASETLQEAGNLPSLEQS
--TGHPV--ESTSNDDHHHKASRQGQDQLQESGAESNLPDATTTGEGTT--PAGDSVSER
KTDRRGRSRRRRGGLHRDREERTDANKTTEQGEVTQITSSEN------NEPVVPSADGKE
DRELSFLPPTEPTQH-ITSIASVDDITAEQEVASAKVIEP--INTDAESNTGSQAASE--
SRQPIELPDLTQSGLVMIETAPDKIAEVPEEALAPVKRPRIRPSYLAEPDTTSSEPLVQI
ETRD
>gi|30249428|ref|NP_841498.1|	   853 residues, 50 /line  Ribonuclease G and E [Nitrosomonas europaea ATCC 19718]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----MKRMLFNAT-QPEELRVAIVDGQKLIDIDIETLGKEQRKSNIYKAAVTRLEPSLEA
AFVDYGAGRHGFLPYKEIAPTC-F------------DR----------------------
------------------------------------------------------------
---------------------------NTD-WSG---HRVADLLREGQELIVQVDKDERG
NKGAALTTYISLAGRYLVLMPNNPQGGGISRRVSA-EERAELREVI-NNLQVPEGM--SI
IARTAGIGRNEEELQWDLNYLVQLWRAIEEAASNEK----------GVFLIYQESSLVIR
AIRDYFHAEIGEILIDNPEIYEQAYQFMANVMPANVDRLKLYQDDIPLFSRFQIEHQIET
AYSRQVTLPSGGSIVIDHTEALVSIDVNSARA--IRGSDIETTALNTNLEAADEIARQLR
LRDLGGLVVVDFIDMEVTRNQREVESSLLKALRLDRARVQIGKISRFGLLELSRQRLRPS
LGEGNYIPCPRCHGTGHIRGTDSSALHILR------------------IIQE--------
---------------------------------------------------------EAM
KEQTSMLQVQLPV--DVATFLLNEKRSEIYRLEARLKVGIILIPNIYMETPNYTITRLRH
EDIKSTEL-----PPSYEMVEKTSEEVT-LPSISQETR--ATRP---KAAVTGIK-PEQP
APVP-EEKPREQ----LS--------------FLDKFF-SLFR--P---AGSNR-----T
ETDQAAEESQTKPSRGERSR----NRRDRGRSKRTKTSTQ-VTANGSLQEAGHSSLLDHP
VVVEHPVTDRATDNDRQHRKNGRQNPPQKLE--VASDQLDVSTTPADTA--ATADSTSER
KTEKRGRSRRRRGSLHRDREDQINLNTATGQDEVIPIGENET------VEPVVSSDDDSK
DTENILLLPVEPVGD--TSSTPTNDIIENQVTASAEIIETETIHTRGEPDSEYQVTVEPH
PHQTIELPDLAQSGLIMIETAPDKISETEEVPPAPSRRPRSRPRRSVEPAADNAEPLVQV
ETRD
>gi|67641114|ref|ZP_00439899.1|	   607 residues, 50 /line  COG1530: Ribonucleases G and E [Burkholderia mallei GB8 horse 4]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------MLFNAT-QQEELRVAIVDGQKLIDIDIETAGREQRKGNIYKGVVTRIEPSLEA
CFVNYGEDRHGFLPFKEVARQY-F------------KE----------------------
------------------------------------------------------------
---------------------------GVD-MRS---ARIQDALREGQELIVQVEKEERG
NKGAALTTFISLAGRYLVLMPNNPRGGGVSRRIEG-DERQELRETM-AQLQIPDGM--SM
IARTAGIGRSAEELQWDLNYLLQLWRAIEAASQSGH--------PGQPMLIYLESSLVIR
AIRDYFQPDIGEILIDTTEIHDQARAFMDIVMPDNVGKVKRYHDDVPLFSRFQIEHQIET
AYSRTVPLPSGGAIVIDHTEALVAIDVNSARA--TKGADIEETATRTNLEAADEVARQLR
LRDLGGLIVIDFIDMESAKSQREVEQRLKDALKHDRARVQMGKISRFGLMELSRQRLRPA
LSEGSHVTCPRCNGTGHIRDTESSALQVLR------------------IIQE--------
---------------------------------------------------------EAM
KENTAAIHCQVPV--EVTAFLLNEKRQEINKIESRFKVGVVLIPNKHLDTPHYKLERLRH
DDARLDDP-----RASWKMAEEAARELEAETGYSKRAE--ETKPR-QEAAVKGIT-PERP
APSPAPQRQSAP----EAAAPV-AAAPASGGGFMKWLK-E---MAE---GPVWR------
-----------------------------------------AAGCGA--RTGARRA----
---GNGCASGA-------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------RARGAW-------------------
----
>gi|84361209|ref|ZP_00985887.1|	   707 residues, 50 /line  COG1530: Ribonucleases G and E [Burkholderia dolosa AUO158]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------MLFNAT-QQEELRVAIVDGQKLIDIDIETAGREQRKGNIYKGVVTRIEPSLEA
CFVNYGEDRHGFLPFKEVARQY-F------------KE----------------------
------------------------------------------------------------
---------------------------GVD-MRS---ARIQDALREGQELIVQVEKEERG
NKGAALTTFISLAGRYLVLMPNNPRGGGVSRRIEG-DERQELRETM-AQLQIPDGM--SM
IARTAGIGRSAEELQWDLNYLLQLWRAIEAASQSGN--------PGQPMLIYLESSLVIR
AIRDYFQPDIGEILIDTTEIYDQARAFMDIVMPDNVSKVKRYHDDVPLFSRFQIEHQIET
AYSRTVPLPSGGAIVIDHTEALVAIDVNSARA--TKGADIEETATRTNLEAADEVARQLR
LRDLGGLIVIDFIDMESAKSQREVEQRLKDALKHDRARVQMGKISRFGLMELSRQRLRPA
LSEGSHVTCPRCNGTGHIRDTESSALQVLR------------------IIQE--------
---------------------------------------------------------EAM
KENTAAIHCQVPV--EVTAFLLNEKRQEINKIESRFKVGIVLIPNKHLDTPHYKLERLRH
DDARLDDP-----RASWKMAEEAARELESETGYSKRAA--DVKPK-QEAAVKGIT-PERP
APSAAPQRPVEP----VAAPAP-APVAAASGGFIGWLN-GLFGMSP---APAPA-----P
AAPAPAKEQASRPAR-ERAE----KAEQRGETRR-RSQPA-IAACGA--QAGYKAAVDQ-
-ACERPCGQAATPRKRERLRKRASRVTDAKV--VKAAKVAVSATDSNRA-----------
------------------------------------------------------------
------------------------------------------------------------
-------------------------SRVKAVTRANRARAASRVNRASEPSS---------
---R
>gi|145627603|ref|ZP_01783423.1|	   628 residues, 50 /line  ribonuclease, Rne/Rng family [Shewanella baltica OS185]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------------------------------------------MQRSAMFDDLY---LKK
NDVIMKRMLINAT-QSEELRVALVDGQQLYDLDIESPGHEQKKSNIYKGKITRVEPSLEA
AFVDYGADRHGFLPLKEIAREY-F------------PK----------------------
------------------------------------------------------------
---------------------------GYS-FQG--RPNIKEVVSEGQEVIVQIDKEERG
NKGAALTTFISLAGSYLVLMPNNPRAGGISRRIEG-DERTELKEAM-ADLEVPAGM--GL
IVRTAGVGKESAELKWDLKVLQHHWAAITEASQVKG----------APFLIHQESNVIVR
AIRDYLRRDVGEILIDHPRIFEEAKQHIALVRPDFVERVKLYEAEVPLFTHFQIESQIES
AFQREVRLPSGGSIVIDPTEALTSIDINSARA--TKGGDIEETALNTNLEAADEIARQLR
LRDLGGLVVIDFIDMTPVRHQREVENRLRDAVHHDRARVQLGRISRFGLMEMSRQRLRPS
LEESAAHICPRCHGQGTIRSTESLALSILR------------------LMEE--------
---------------------------------------------------------EAI
KENTSQIEAIVPV--DVAAFLLNEKRKAIRITEQRHDVEVYVIPDAHMMTPDYRVIRHRS
DDEIS--------ESSYKRIEQPEAKLYEPRKLERTAA--PI------PALKGFAAPQKV
EQAPS-----PT----VKVEAP-QP------GFFSKLV-SAISAMF---APSEK-----A
EPVKVVETKTTDTSAANANR----------------------------------------
------------------------------------------------------------
-RNRRNDTRRPRNAQ--------DADKAXE------------------------------
------------------------------------------------------------
------------------------------------------------------------
---G
>gi|119469427|ref|ZP_01612366.1|	   564 residues, 50 /line  RNase E: endoribonuclease for rRNA processing and mRNA degradation; member of the degradosome; involved in the production of [Alteromonadales bacterium TW-7]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----MKRMLINAT-QQEEMRVALVDGQRLYDLDIESPGHEQKKANIYKGKITRIEPSLEA
AFVDYGADRHGFLPLKEIARTY-F------------PA----------------------
------------------------------------------------------------
---------------------------GYT-FNG--RPNIRDVIKEGQEVIIQVDKEERG
QKGAALTTFISVAGSYLVLMPNNPRAGGISRRIEG-DERTELKEAL-SRLELPKGM--GL
IVRTAGVGKSFEELNYDLKALLVHWEAIRQAADSAK----------APFLIHQESNVIFR
AIRDYLRRDIGEILIDKPRVFEEAKAHIERFRPDFMSRVKLYQGDTPLFTHYQIESQIES
AFQREVRLPSGGSIVIDPTEALTSIDINSSKA--TKGGDIEETALNTNLEAADEIARQLR
LRDLGGLIVIDFIDMTPPRHQREVENRLKDAARPDRARVQIGKISRFGLLEMSRQRLRPS
LGEASQGVCPRCSGQGTVRSNESIALSILR------------------LIEE--------
---------------------------------------------------------EAI
KDNTSQVNAQVPV--AVAAYLLNEQRRSVHRIEKHHKCDVVIIPNQHMETPHYEVMRLRK
DETLETV------SYEQVVAPE--PEAFE----MSKSP--AAPVR-EEPMLKGVVMPSSP
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------------------------------------APQAAPAPAAKPAAVAAKEEAGL
LLHLLL------------------------------------------------------
------------------------------------------------------------
---V
>gi|52842507|ref|YP_096306.1|	   667 residues, 50 /line  ribonuclease E [Legionella pneumophila subsp. pneumophila str. Philadelphia 1]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------------------------------------------MGL
Y---MEKMLINAM-QTEEIRVALIKNNQLFDLDIECPGEIKKKGNIYKAIVTRREPSLDA
VFVEYGSKRQGFLPLKEIAPEY-L------------SK----------------------
------------------------------------------------------------
---------------------------NPE-EFGDEKPPITSLIREGQELLIQVDKEERG
NKGAALTTFITLAGCYLVLMPNNPHSGGISRRIEG-DERDELRETL-NALTLPEDM--GL
IIRTAGVGKSLEELQDDLNMLCNQWQSIKEAYNSEL----------APCLIHQEGDVIIR
SIRDNLRKSISEIIIDDQISYIKAKQYIERVKPEFLPNLKLYNSSIPLFNFYQIESQIET
AYQRQVMLPSGGALVIDRTEALVSIDINSAKA--TGGADIEATALNTNLEAADEIARQLR
LRDLGGLVVIDFIDMSSSKNQREVENRLKEALQADRARIQVGRISRFGLLEMSRQRLRLS
LGETAQEICPRCEGRGTVRSIQSHGLSITR------------------LIEE--------
---------------------------------------------------------EAL
KEKTAEIQVQLPP--EMATFIMNEKRNFIRDIEKRHGVSVVVIANPYMHPPQYTITRLKE
DNVGKSK------KPSYSLIQQ--PEVHV----PSSDK--EPVSH-DEPAVKSFAEHRVI
-KHPQT-------------------------SFIKRLWTSLFGGHS---VAHTV-----T
Q--EPGKKHHRAQNQGKHAS----SKSSGGDKRQQ-------------------------
------------------------------------------------------------
-GSNANRRRRSGGGQQRSSSGNTNAAASTHQQRKKSNANQQSHGSQQSNRSIPAKNEGNK
KREAIL------------------------------------------------------
---------------------------------------------AKEPEE---------
---K
>gi|120575645|gb|EAX32269.1|	   720 residues, 50 /line  ribonuclease, Rne/Rng family [Coxiella burnetii 'MSU Goat Q177']
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----MKRMLINAT-QPDEVRVAITDDSKLIDLDIEIPGQEHKKSNIYKGIITSIEPSLGA
VFVNYGSERHGFLPLKEISREY-F------------LQ----------------------
------------------------------------------------------------
---------------------------DIEGDFD--SIDINRVLKLGQELVVQVDKEERG
TKGAALTTFISLAGSFLVLMPNNPRAGGISRRIEG-DERDQLRETI-NQLSLPEGM--GL
IVRTAGLGRPKEELEWDLKILLRYWEAVKQAAVAKP----------GPYLIHQESDVIIR
AIRDYLRQDVEEILIDDEVAFENARHYINQVRPQFVERLKLYREHLPLFSRFQIEQQIEN
AHQREIRLPSGGSLIIDHSEALIAIDINSARA--TRGASIEETALSTNLEAAEEIARQLR
IRDIGGLIVIDFIDMTPLRNQREVENCLRNALSQDRARIQIGRISRFGLLEMSRQRLRSS
LTRSTQIACPRCNAEGTIRSIESLGLSIIH------------------IIQE--------
---------------------------------------------------------QAS
KAKNIHFQLQAPV--DLATYLINEKRELLRDIEHHYPVKITIVPNQYMETPLYQLRQIKI
DPASL--------EHGKGMASYKLTKVFKTEAPQKQ----EIRAL-SEPAIQQFL-TLP-
------------PAPTTPRKTP-TP------GLFKRLMGKMFGSEE---EPSTAV----T
PPVKPHVPERHKPSSPPRGRRQ----GGYASRKS--TGPR--------------------
---------------RHHPRSGGGG--------------------GGHG--QNRHGARSR
RGTRGGR--------RDHGGGRG------GPGYHTQST-----------GPMPPLGEDVV
DVNQL-PMST-------PPSPPPPFLTDADVPPSRDERRSGGINGDADHDA------KPH
PNGKVSDDNRGN------------------------------------------------
---R
>gi|124120794|gb|EAY39537.1|	   619 residues, 50 /line  ribonuclease E [Vibrio cholerae MZO-3]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------MLINAT-QKEELRVALVDGQRLFDLDIESPGHESKKANIYKGRITRIEPSLEA
AFVDYGAERHGFLPLKEIAREY-F------------PD----------------------
------------------------------------------------------------
---------------------------GYS-YQG--RPNIKDVLNEGQEVIVQIEKEERG
SKGAALTTFISLAGSYLVLMPNNPRAGGISRRIEG-DERTELKSAL-SSLELPQGM--GL
IVRTAGVGKSAEELEWDLNVLLKHWSAIKQASDSNP----------APFLIHQESNVIVR
AIRDYLRRDIGEILIDSNSIYERALEHIRLVRPDFVNRVKKYEGEVPLFSHFQIESQIES
AFQREVRLPSGGSIVIDPTEALTSIDINSARA--TKGGDIEETALNTNLEAADEIARQLR
LRDLGGLVVIDFIDMTPVRHQREVENRLREAVRVDRARVQIGRISRFGLLEMSRQRLSPS
LAEASHHICPRCKGTGVIRDNESLALSVLR------------------LIEE--------
---------------------------------------------------------EAL
KDNTSQVLAVVPV--SIASYLLNEKRRSINHIEKAQQVRITIVPNSDMETPHFEVIRVRE
GEEQD--------VLSYLI-PKKLEAMKEAEGKEVVDVELKPKRI-EEPVLKGFAAPAEA
VPAPT-PKPKAEPQPVAEVQQPAQP------GFFSRVFKAIASLFS---ETPE------A
AKVEAPVTQNSEQDKPRRERND--RNNDRRRNPR--------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------DKNRRR------------------------------------------------
---G
>gi|77166294|ref|YP_344819.1|	   764 residues, 50 /line  Ribonuclease E and G [Nitrosococcus oceani ATCC 19707]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----MKRMLINAT-HAEELRVAMVDGQYLQDLDIENPAREQKKANIYKGKITRIEPSLDA
VFVDYGADRQGFLPLKEVTRSY-F------------QS----------------------
------------------------------------------------------------
---------------------------HQG-ESG-DRPKVQDVLKEGQELVVQVEKEERG
NKGAALSTFISLAGRYLVLMPNNPRAGGVSRRIEG-EERSMLLEAM-RTLEIPEGM--GL
ITRTAAVGKNAEELQWDLNYLLHLWHSIQAAAEGRP----------APFLIYQESDVIIR
ALRDYLRLDIGEILIDTPDVYQRAYDFMRQVMPPELRKLKLYQDKVSLFTRFQIESQIET
AFQHEVALPSGGAIVVDYTEALTTIDINSARA--NKGEDIEETALSTNLEAAEEIARQLR
LRDLGGLIVIDFIDMAPLRNQRAVENRLRECLREDRARVQVGRISRFGLLEMSRQRLRPS
LGEAHQVVCPRCNGRGQVRGVESLGLSVLR------------------LIEE--------
---------------------------------------------------------GAA
KEKTARMVIQLPI--SVASFLLNEKRANLAAIEKRYGAHLFLVPNSHLETPVFEIERIKD
VGKGESRVDKRFEMQSYQMANEPSPK---------KPALLTPSAIPDEPLVKAGS-PLFP
KPEPQPVAPKAEP------------------DFLRRFWTAFMKGDQELDVAEVVTQETEV
VSEETGERGRLPPRRG---RSQGRGRRGSGRQHNRKENTQGNEGSGV-------------
-----------SSGAESGQAASEAKETQDMQNG-----TESSSAPSSRTTTRGRRGGRRR
RVNATGRYRHRSGRKEEEETKRPE-------------------------EAQYPE-KDSL
PSSTVLTTP-------PAKSPLEETASDRKKAPSEEGREGLSQEPESPGPT------KVG
VER--------------------------------------------EQAAAVKEPL---
----

Ad blocker interference detected!


Wikia is a free-to-use site that makes money from advertising. We have a modified experience for viewers using ad blockers

Wikia is not accessible if you’ve made further modifications. Remove the custom ad blocker rule(s) and the page will load as expected.