FANDOM


>gi|30678106|ref|NP_850989.1|	   619 residues, 50 /line  glycoside hydrolase starch-binding domain-containing protein [Arabidopsis thaliana]
----------MQTDSEQDVESCDDNENNLNTDEQNHQLTET-------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------LLPDGGFF-QSE
S---IATTILINSSICTVQRIAVLEGGKLVELLLEPVK-TNVQCDSVYLGVITKFVPHMG
GAFVNIGSARHSFMDIKSNREPFIFPPFCDGSK--KQAADGSPIL-SMNDIPAPHEIEHA
SYDFEASSLLDIDSNDPGESFHDDDDEHENDEYHVSDHLAGLVN-GTVVNHGA-------
---------------------------------------VEVGSENGHIPMERGHSADSL
DSNASVAKASKV--MSSKDNKWIQVRKGTKIIVQVVKEGLGTKGPTLTAYPKLRSRFWVL
LTRC-KRI-GVSKKI-SGVERTRLKVIAKTLQ-PQGF--GLTVRTVAAGHSLEELQKDLD
GLLLTWKNITDEAKSAALAADEGVEGAIPALLHRAMGQTLSVVQDYFNDKVEKMVVDSPR
TYHEVTHYLQDMAPDLCNRVELHDKG-IPLFDLYEIEEEIEGILSKRVPLSNGGSLVIEQ
TEALVSIDVNGGHGMFGQGNSQEKAILEVNLAAARQIAREIRLRDIGGIIVVDFIDMADE
SNKRLVYEEVKKAVERDRSLVKVSELSRHGLMEITRKRVRPSVTFMISEPCSCCHATGRV
EALETTFSKIEQEICRQLVSV---------------------------------------
------------------------------------------------------------
---------------IISILFCY---------------FSFQP-------NEEHL-----
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------E------------
>gi|110598301|ref|ZP_01386576.1|	   535 residues, 50 /line  ribonuclease, Rne/Rng family [Chlorobium ferrooxidans DSM 13031]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------------------------------MIIERPE-SRRSIGDIYLGRVHKVVEGLK
AAFVDIGQKSDGFLHFSDVGTTS-------------------------------------
------------------------------------EDYRALIE-DDDDDDAVVGAEDAD
GDDSLNAAPVQVQP-----AA--DQSVKASARSGGKRPS----------GDEQEKAEKRQ
SYTQ---------------MIAGKLKPNDSILVQVIKEPISSKGSRLTSDITIAGRFMVL
LPFGGGQV-AVSRRVVVRKERSRLKKLVRSML-PEGF--GAIIRTVAEDQEETLLKQDLE
KLLAKWTQIEEKLQDA----------APPQLIFKEDTIISSVLRDSLTSDVTEIVANSSV
IHKETLNYIQWAAPEMVKNVSLYQGK-LPLFEGYGIAKDVESIFSRKVWLKSGGYIIIEH
TEAMVVVDVNSGR--YAAKREQEENSLKTNLEAAREIVRQLRLRDIGGIIVVDFIDMLDQ
KNAKKVYDSMKTELRNDRAKSNILPMSDFGIMQITRERIRPSLMQRMGDQCPACGGTGVV
QARFTTINQIERWLRK--------------------------------------------
----------------------------------------YALQHPLNF-QQLDLYVSPT
VVEPLQNSDLKTELKWFLQHLLFVQVKPDESLRSDD--FRFYSRKN--------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---NKDIT---AEYGDI------------
>gi|21675068|ref|NP_663133.1|	   560 residues, 50 /line  ribonuclease G [Chlorobium tepidum TLS]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------------------------------------------MKK
N---VKKQLLMNKIG-DEIQVALVEEGRLAELIIERPE-SMRSIGDIYLGRVHKVVEGLK
AAFVDIGQKSDGFLHFSDVGTTS-------------------------------------
------------------------------------EDYRALVE-DDDNDENG-GDEDDD
ENEGDDNAEAPAPP-----RE--AARPAGQQKS--EQGQ----------QSSGDAAERRQ
SYTQ---------------MIAQKLKPNDSILVQVIKEPIGTKGSRLTSDITIAGRFMVL
LPFGGGQI-AVSRRVVSRKERGRLKKLVRSML-PEGF--GAIIRTVAEDQDESLLKQDLE
KLLAKWTQIEEKLQDA----------QPPQLIFKEDTIISSVLRDSLTTDVTEIVANSKS
IYTETLNYIQWAAPDMVKNVSLYEGK-LPLFEGYGIAKDVESIFSRKVWLKSGGYIIIEH
TEAMVVVDVNSGR--YAAKREQEENSLKTNLEAAREVVRQLRLRDIGGIIVVDFIDMMDP
KNSKKVYDAMKAELRNDRAKSNILPLSDFGIMQITRERIRPSLMQRMGDQCPACGGTGVV
QARFTTINQVERWLRK--------------------------------------------
----------------------------------------FALQQKVPF-QQLDLHISPT
VLEPMRNSDMKTEMKWFLQHLVFVRIKSDESLRSDD--FRFYNRKT--------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---GADIT---AEFN--------------
>gi|78189942|ref|YP_380280.1|	   568 residues, 50 /line  Ribonuclease E and G [Chlorobium chlorochromatii CaD3]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------------------------------------------MKK
S---STKQLLMNKTG-DEIQVALVEEGRLVELIIERPE-SRRSIGDIYLGRVHKVVEGLK
AAFVDIGQKSDGFLHFSDVGTTN-------------------------------------
------------------------------------EDYRALIE-DDDDDDAIIG-DDIE
SDEATGQNDSEFDEASDGETT--VSAPKTVARSNSKKPS-----------SGEQSGEKPQ
TYTQ---------------MIAGKLKPNDSILVQVIKEPISSKGSRLTSDITIAGRFMVL
LPFGGGQV-AVSRRVVSRKERSRLKKLVRSIL-PEGF--GAIIRTVAEDQEEALLKQDLE
KLLTKWKQIEEKLQDA----------TPPQLIFKEDTIISSVLRDSLTSDVSEIVANSPA
IYKETLNYIEWAAPEMVKNVALYQGK-LPLFEGYAIAKDVESIFSRKVWLKSGGYIIIEH
TEAMVVVDVNSGR--YAAKREQEENSLKTNLEAAREVVRQLRLRDIGGIIVVDFIDMLDP
KNAKKIYDAVKTELRNDRAKSNILPMSDFGLMQITRERIRPSLMQRMGDQCPACGGTGIV
QARFTTINQIERWLRK--------------------------------------------
----------------------------------------YALQHPLRF-QQLDLYVSPT
VLEPLQNSDMKTEMKWFLQHMLFVTVKGDESLRSDD--FRFYNRKN--------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---NKDIT---AEYGEL------------
>gi|119355890|ref|YP_910534.1|	   565 residues, 50 /line  ribonuclease, Rne/Rng family [Chlorobium phaeobacteroides DSM 266]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------------------------------------------MKK
S---LNKQLLMNKTG-DEIQVALVEEGRLAELIIERPE-SRRSIGDIYLGRVHKVVEGLK
AAFVDIGQKSDGFLHFSDVGTTT-------------------------------------
------------------------------------EDYRALIE-DDDDDDTTGT-DESD
GDEIA-AV----LSQP---AVLPEQNGKSSARSGAKRLTAP--------AQDGEDGGRRQ
SYTQ---------------MIAGKLKPNDSILVQVIKEPISTKGSRLTSDITIAGRFMVL
LPFGGGQV-AVSRRVIARKERSRLKKLVRSML-PDGF--GAIIRTVAEMQEETLLKQDLE
KLLAKWTQIEEKLQDA----------VPPQLIFKEDTIISSVLRDSLNADVTEIVANSPV
IYKETLNYIQWAAPEMEKNVTLYQGK-LPLFEGYSIAKDVESIFSRKVWLKSGGYIIIEH
TEAMVVIDVNSGR--YAAKREQEENSLKTNLEAAREIVRQLRLRDIGGIIVVDFIDMLDQ
KNAKKVYDSMRTELRNDRAKSNILPMSDFGIMQITRERIRPSLMQRMGDQCPACGGTGVV
QARFTTINQIERWLRK--------------------------------------------
----------------------------------------YALQNTMKL-QQLDLYVSPT
VAEPLQQSEMNTELKWFLQHLLFVRVKPDESLRSDD--FRFYSRKN--------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---NKEIT---AEYGDL------------
>gi|67939525|ref|ZP_00532023.1|	   572 residues, 50 /line  Ribonuclease E and G [Chlorobium phaeobacteroides BS1]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------------------------------------------MKK
T---VKKQLLMNKSG-DEIQVALVEEGRLAELVIERPD-SLRSIGDIYLGRVHKVVEGLK
AAFVDIGQKSDGFLHFSDVGTTT-------------------------------------
------------------------------------EDYRALIE-DDDDDDENGN-GDAD
ADEEG-KAGMKTQQEQKEDTRRPSPAGNGQKNGGSRSKGNG--------ASAGKDGDGRQ
SYTQ---------------MIAGKLKTNDSILVQVIKEPISNKGSRLTSDITIAGRFMVL
LPFGGGQI-AVSRRVVSRKERARLKKLVRSML-PDGF--GAIIRTVAELQEEELLKKDLE
KLLVKWEQIEEKLKDA----------KPPQLIFKEDTIISSVLRDSLTTDVTELVANSQS
IHKETLNYIQWAAPEMEKNVFFYQGK-LPLFEGYGIAKDVESIFSRKVWLKSGGYIIIEH
TEAMVVVDVNSGR--YAAKKEQEENSLKTNLEASREVVRQLRLRDIGGIIVVDFIDMLDP
KNSKKVYDSMKNELRQDRAKSNILPMSDFGLMQITRERIRPSLMQRMGDQCPACGGSGIV
QARCTTINQIERWLRK--------------------------------------------
----------------------------------------YALQKKMVF-QQLDLYVSPT
VAEPLRDTDRNIEMKWFLQHLLFVRVKQDESLRSDD--FRFYARKN--------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---SADLT---AEYGDL------------
>gi|68553030|ref|ZP_00592412.1|	   551 residues, 50 /line  Ribonuclease E and G [Prosthecochloris aestuarii DSM 271]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------------------------------------------MKK
T---VKKQLLMNKSG-DEIQVALVEDGRLAELVIERPD-SLRSIGDIYLGRVHKVVEGLK
AAFVDIGQKSDGFLHFSDVGTTN-------------------------------------
------------------------------------EDYRALIE-DDEDDE-NGA-LEGE
-DVEK-NDDVQAESKPRASEKAPRSATPE---------------------------RKRQ
SYTQ---------------MIAGKLKANDSILVQVIKEPISNKGSRLTSDITIAGRFMVL
LPFGGGQI-AVSRRVVSRKERSRLKKLVRSIL-PEGF--GAIIRTVAENQEEELLKKDLE
KLLVKWQQIEEKLQDA----------KPPQLIFKEDTIISSVLRDSLNSDVTELVANCPS
IYKETLNYILWAAPEMEKNVTLYQGK-LPLFEGYGIAKDVESIFSRKVWLKSGGYIIIEH
TEAMVVVDVNSGR--YAAKKEQEENSLKTNLEAAREVVRQLRLRDIGGIIVVDFIDMLDQ
KNSKKVFDSMKTELRHDRAKSNILPLSDFGLMQITRERIRPSLMQRMGDQCPACGGSGVV
QARYTTINQIERWLRK--------------------------------------------
----------------------------------------YALQRKVMF-QKLDLYVSPT
VAEPLCDEERKTEMKWFLQHMLFVKIKSDESLRSDD--FRFYLQKN--------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---NKEIT---SEFSDL------------
>gi|145218838|ref|YP_001129547.1|	   564 residues, 50 /line  ribonuclease, Rne/Rng family [Prosthecochloris vibrioformis DSM 265]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------------------------------------------MKK
S---VKKQLLMNKTG-DEIQVALVEEGRLAELIIERPE-SRRSIGDIYLGRVHKVIEGLK
AAFVDIGQKSDGFLHFSDVGTTT-------------------------------------
------------------------------------EDYKALIE-DDDDDDDGVE-GDEE
GDAKG-SSAVQAE--PSGAKTVARSGGRGPSASGKD--------------SRSEQAEKRQ
SYTQ---------------MIAGKLKANDSILVQVIKEPISTKGSRLTSDITIAGRFMVL
LPFGGGQV-AVSRRVVSRKERARLKKLVRSML-PEGF--GAIIRTVAEMQEESLLRQDLE
MLLGKWTQIEEKLKDA----------TPPQLIFKEDTIISSVLRDSLNSDVTEIVANSPS
IHKETLNYIEWAAPDMVKNVSLYQGK-LPLFEGYGIAKDVESIFSRKVWLKSGGYIIIEH
TEAMVVVDVNSGR--YAAKREQEENSLKTNLEAAREVVRQLRLRDIGGIIVVDFIDMMDS
RNSKKVYDTMKGELRNDRAKSNILPLSDFGVMQITRERIRPSLMQRMGDQCPACGGSGVV
QARFTTINQIERWLRK--------------------------------------------
----------------------------------------YALQQSMKF-QQLDLYVSPT
VIEPLQNSDMKTEMKWFLQHLLFVRVKEDESLRSDD--FRFYSRKN--------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---SKDIT---AEYGDL------------
>gi|67918586|ref|ZP_00512182.1|	   566 residues, 50 /line  Ribonuclease E and G [Chlorobium limicola DSM 245]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------------------------------------------MKK
S---MNKQLLMNKIG-DEIQVALVEEGRLAELTIERPE-SRRSIGDIYLGRVHKVVEGLK
AAFVDIGQKSDGFLHFSDVGTTN-------------------------------------
------------------------------------EDYRALIE-DDDDDESVSS-DDGD
GDAVE-VAA----TAGGGDPPAAGPHARGPQRNGGRK--GP--------VTEEEKAEKRQ
SYTQ---------------MIAGKLKPNDSILVQVIKEPISSKGSRLTSDITIAGRFMVL
LPFGGGQV-AVSRRVVVRKERARLKKLVRSML-PEGF--GAIIRTVAEQQEESLLKQDLE
KLLTKWVQIEEKLKDA----------SPPQLIFKEDTIISSVLRDSLTSDVTEIVANSPV
IYKETLNYIQWAAPEMEKNVSLYQGK-LPLFEGYSIAKDVESIFSRKVWLKSGGYIIIEH
TEAMVVVDVNSGR--YAAKREQEENSLKTNLEAAREIVRQLRLRDIGGIIVVDFIDMLDP
KNAKKVHDAMKTELRNDRAKSNILPMSDFGIMQITRERIRPSLMQRMGDQCPACGGTGVV
QARFTTINQIERWLRK--------------------------------------------
----------------------------------------YALQQSMKF-QQLDLYVSPT
VAEPLRNTEMKTELKWFLQHMVFVRVKQDESLRSDD--FRFYNRKN--------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---NKDIT---AEYGEL------------
>gi|78185904|ref|YP_373947.1|	   570 residues, 50 /line  Ribonuclease E and G [Pelodictyon luteolum DSM 273]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------------------------------------------MKK
S---VKKQLLMNKTG-DEIQVALVEDGRLAELIIERPE-SRRSIGDIYLGRVHKVIEGLK
AAFVDIGQKSDGFLHFSDVGTTT-------------------------------------
------------------------------------EDYRALIE-DDDDDDETAA-DETG
TAEDG-ADEEEAPVAAGAPQ--EQQGSRQSSRSGGRKPQPQ--------QRKEDGAEKRQ
SYTQ---------------LIAGKLKANDSILVQVIKEPISTKGSRLTSDITIAGRFMVL
LPFGGGQV-AVSRRVVSRKERARLKKLVRSML-PEGF--GAIIRTVAEMQEETLLKQDLE
KLLAKWTQIEEKLKDA----------APPQLIFKEDTIISSVLRDSLTSDVTEIVANSPS
IHKETLNYIEWAAPEMVKNVSLYQGK-LPLFEGYGIAKDVESIFSRKVWLKSGGYIIIEH
TEAMVVVDVNSGR--YAAKREQEENSLRTNMEAAREVVRQLRLRDIGGIIVVDFIDMMDA
RNSKKVYDSMKGELRNDRAKSNILPMSDFGIMQITRERIRPSLMQRMGDQCPACGGSGVV
QARFTTINQIERWLRK--------------------------------------------
----------------------------------------YALQHAMKF-QQLDLYVSPT
VAEPLKNSDMNTELKWFLQHMLFVRVKQDESLRSDD--FRFYTRKD--------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---SRDIT---AEYGDL------------
>gi|110640055|ref|YP_680265.1|	   535 residues, 50 /line  ribonuclease G [Cytophaga hutchinsonii ATCC 33406]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----MSNELFISSSQ-SGDRIALIQEKRLVEYQFEDHT-RKFNVGDIYLGTVRKVVPGLN
AAFIDVGYEKDAFLHYFDLGPKI-------------------------------------
------------------------------------KSLTKFTK-NAITSAST-------
---------------------------------------PA--------LLKKFELEAEI
KKDG---------------KVSQVLEKGNPILVQVVKEPISTKGPRLSCEISLAGRYLVL
VPFS-NVV-SVSKKITDKEERQRLVRLISSIR-PENF--GVIIRTVASNKEVAELDKDLR
NLVKTWEDGIAILKKA----------RPRDLIIGELDRTSSILRDMLNESFDSINVDTKE
LYDDLRSYIKNIAPDKERLVKLHQGK-TKMFESTGVEKQLKTLFGKSVSLSGGGYLIIEH
TEALHVIDVNSGNK-SNNETSQEETALHTNLEACREVARQLRLRDMGGIIVVDFIDMKNL
DNRKVIYERMKLEMKDDRSKNVILPLSKFGLMQITRERVRPQTNLITMEVCPTCNGTGKI
SASIAITDQIEHKLDY--------------------------------------------
----------------------------------------IITKQNE---KNITLVLHPY
IYAYFTTGYISKRTKWFFKYFRWVKLRTDSSLGLTE--FKFLDEGA--------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--QNIDME---SEATTEDYRSEEYITSEK
>gi|126646091|ref|ZP_01718608.1|	   523 residues, 50 /line  putative ribonuclease E [Algoriphagus sp. PR1]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----MSTELLIDSAQ-SGSRIALLQDKSLVELHSEGMD-NQFKVGDIYLGTVRKIVNGLN
AAFIDVGYEKDAFLHYQDLGPNF-------------------------------------
------------------------------------NSLMKFTK-MVRNNNYS-------
---------------------------------------SY--------NLKGFENVPEI
DKIG---------------KISSILSKNNQVLVQVVKEPISTKGPRLSCELSLPGRYLVL
VPFS-DSV-NVSKKIRSSDERKRLLRLINSIK-PANF--GVIIRTVAEGQSVTELDKDLR
NLLNNWEEGMQKLLKA----------KSRDKVIGEMSMASSLVRDLLNESFDAITVEEES
TYDQIRSYIRSIAPEKEKIVRLYNGK-AKLFENFGIEKQIKSLFGQTVSLPQGGYVIIEH
TEALHVIDVNSGNK-SNQESDQESTALKTNLVAAKEIARQLRLRDMGGIIVVDFIDMRKA
ENKKVIYEAMKEELKMDRSKHTVLPLSKFGLMQITRQRVRPEVNIVTKETCPACNGTGKI
QASILVADKLEKDLEH--------------------------------------------
----------------------------------------IATIQNV---SQIHIGLHPY
LHAYFTTGIISRRVKWFFKYYKWIKLIKDSSLPVTE--YRFQDESG--------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--EEIELK---VKSETE------------
>gi|117927963|ref|YP_872514.1|	   702 residues, 50 /line  ribonuclease, Rne/Rng family [Acidothermus cellulolyticus 11B]
MPENEPNESVAKTDAPRRIRRSRRTAGSDTAAVESTSASPSRAPDAATLNDATPAGESGT
GAPVAELPPVKRPAVPPPMVVFQPPPPVVFQAPEPAAVTSRRRRARRVPEEPSAALSSTD
GAAGEPEIRSADLDDGSAPSEPAEQVSAATTEGITARRRRRRRRRTTGTAEDDRVLDAVE
APETDTGSAGADDLDAAMALLTGSTRIEAKKQRRREGRELLRRNRRGMILTEAEFLARRE
S---VERVMVVRQRG-DLTQIGVLEDGILVEHYVSTTS-ANRIVGNVYLGRVQNVLPGME
AAFVDIGKGRNAVLYAGEVNFDL-------------------------------------
------------------------------------TGL---------------------
-----------------------------------------------------------E
GQPQ---------------RIEAALKPGQTVVVQVTKDPIGHKGARLTSQISLPGRFLVF
VPEGS-MM-GISRKLPD-TERNRLKAILRKIM-PEGA--GVIVRTAAEGASEEELARDIA
RLMAQWEDIQKKAESG----------TAPALLYAEPDLTIRVVRDIFNEDFAQLVVQGDS
EWDMVEAYVAHVAPDLLPRISHWTSD-EDVFAHYRIDEQLAKALDRRVWLPSGGYLIIDR
TEAMVVIDVNTGRF-VGKGGNLEETVTKTNLEAAEEIVRQLRLRDIGGIIVIDFIDMLLE
SNRELVLRRLVECLGRDRTKHQVAEVTSLGLVQMTRKRVGSGLLEAFSEPCEVCGGRGVI
IHTDPVTAQ------R--------------------------------------------
----------------------------------------RAHRGRART-RQEAEPSAEP
VAEPAAVGAAGAER----------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------------------RGRRSARAAS
>gi|126662499|ref|ZP_01733498.1|	   538 residues, 50 /line  Ribonuclease G [Flavobacteria bacterium BAL38]
-------------------MNLKTSINKTSRTEHK-------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------QI-KMY
C---MNKELIIRSGS-DAVDFALLKDGKLIELHKEEEKQSNFAVGDIFIAKIRKPVAGLN
AAFVNLGHEKDAFLHYHDLGPNL-------------------------------------
------------------------------------PSLTKFIK-LVSAGKIK-------
---------------------------------------DY--------SLKNFPFEAEI
DKDG---------------SINDILSANQSVLVQVVKEPISTKGPRISSEISLAGRYVVL
VPFS-DRV-SVSQKIESREEKDRLKRLVQSIK-PKGF--GVIVRTVAEGKKVAELDKDLQ
TLLDRWSAMSRRLQTA----------HHPSKVLGELNKASSILRDVFNDTFTGIYVDDED
LYLETKEYLQEIAPDKVSIVKHYQSKDLPLFEKYNIERQIKTSFGKTVSMSKGAYLIIEH
TEALHVIDVNSGNR-SSKATSQEGTALEVNMIAAAEIARQLRLRDMGGIIVVDFIDMQNP
ENRKVLYDFLREEMSDDKAKHKILPPSKFGLIQITRQRVRPEVNIKTREEDPNN-EHREI
EAPILIVDKIATDLER--------------------------------------------
----------------------------------------IIKDH-----KKVVLNVHPF
VAAYLSKGFPSLRSKWFFEYKKWVKIIPRDAYTYLE--YHFFDKEG--------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--NEIIVK---------------------
>gi|146299292|ref|YP_001193883.1|	   543 residues, 50 /line  ribonuclease, Rne/Rng family [Flavobacterium johnsoniae UW101]
-----------MIFVFWFLVSLPTTINKQPTTNSR-------------------------
------------------------------------------------------------
------------------------------------------------------------
-------------------------------------------------------I-KIY
S---VNKELIIRSSS-EAVDFALLKDGKLIELHKEEEK-SNFQVGDIFIAKIRKPVAGLN
AAFVNVGFEKDAFLHYHDLGPNL-------------------------------------
------------------------------------ASQLKFIK-LVSAGKLK-------
---------------------------------------DF--------SLKTFQFEKEI
DKDG---------------IITDILSANQSVLVQVVKEPISTKGPRISAELSLAGRFIVL
VPFS-DRV-SISQKIEDKKEKDRLKKLVLSIK-PKGF--GVIVRTVAEGKNVAELEKDLQ
NLLGRWSAMCKKLPTA----------HHPSKVLGELNRASSILRDVFNDTFSGIQIDDEE
LYHQTKEYLQEIAPSKQSIVKFYQSNDTPIFEKYNIERQIKTSFGRTVSMSKGAYLIIEH
TEALHVIDVNSGNR-SNKATNQEDTAMEVNMIAAAEIARQLRLRDMGGIIVVDFIDMSNP
ENRKVLFDFLREEMSDDKAKHKILPPSKFGLVQITRQRVRPEVNIKTREEDPNK-VNGEI
EAPILIIDKITSDLER--------------------------------------------
----------------------------------------LLKTH-----NKVVLNTHPF
VAAYLSKGFPSLRSKWFFEHKKWVKIIPRDAYTYLE--YHFYDKKG--------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--NVITE----------------------
>gi|88804792|ref|ZP_01120312.1|	   523 residues, 50 /line  Ribonuclease G [Robiginitalea biformata HTCC2501]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------------------------------MN
Q---VNRELIVRSNS-NSVDFALLKNGKLIELHKDEDD-HKFNVGDIMLAKIRKPVTGLN
AAFVNVGYEKDAFLHYHDLGPQL-------------------------------------
------------------------------------KSMLKFLK-LARSGRLK-------
---------------------------------------DF--------SLKNFSFEKDI
DKNG---------------SIKDVVKPNQTMLVQIVKEPISTKGPRISSELSIAGRYLIL
VPFS-DRV-SVSQKIGSKEEKDRLKRLVKSIK-PKGF--GVIIRTVAEGKKVAELDKDLE
NLMSKWISMCKKINRA----------STPSKVLVELNRASSILRDVFNDSFSGIHVDDET
LFNQIKDYVHEIAPDKESIVKLYSSN-VPIFEKFGIERQIKTSFGRTASMSKGAYLVIEH
TEALHVIDVNSGNR-STKAKNQEDTALEVNLIAAAEVARQLRLRDMGGIIVIDFIDMVRP
DHRKKLYNHLRDEMKDDRAKHKILPPSKFGLVQITRQRVRPEVNIKTTEVDPSG-NGQEV
EAPIVLIEKISDELER--------------------------------------------
----------------------------------------IMKGE-GRE-KAITLNAHPF
IAAYLTKGFPSIRSKWFLEFKKWIKIQPRDAYSYLE--YRFTDKDG--------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--APLQEA------QEA------------
>gi|147677164|ref|YP_001211379.1|	   561 residues, 50 /line  ribonucleases G and E [Pelotomaculum thermopropionicum SI]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----MLKEIVVNVGE-EETRVAVLEDRVPVEIYIERSV-NQRLVGNIFKGRVENVLPGMQ
AAFVNIGLEKNAFLYVEDAIPAR-ALD---------------------------------
------------------------------------------------------------
-------------------------------------------------------GHG--
-------------DSMLGANICDILKQGQEVLVQIVKEPIGTKGPRVTTHITLPGRYLVL
MPTV-DYI-GISRRIESERERERLKELASRVK-PEGM--GVIVRTVAEGVDEEEFRQDVG
LLTKLWRKVLSRAAHG----------PVPNLVHRDLELVQRILRDVFTEDVDRLILDSRY
EYEKVLDLLDITGPRLKLKVFLDE-R-DSIFEEYGIEQEIEKALKRKVWLKSGGYLVIDQ
AEALTAVDVNTGKY--VGTTNLEDTVLKTNLEAAREIARQLRLRNIGGIVIVDFIDMSRE
EHRQEVVRTLEEEIKKDKTKTNILGITQLGLVEMTRKKVRPSLSEVIQKPCPYCDGKGRV
LSEETLGISFKNQIYN--------------------------------------------
----------------------------------------MARQ--TTA-KTILVEANPV
VAARLIGSGGANLRDLENKTGKSLYIRGVASHHIESIVI--RPLHDNEQVQARTLP----
------------------------------------------------------------
--------------------------------------VKPGEVLEVKVEEPHITNIRDG
IAR---------------------------------------------VDGFILDIEGGG
ALVGETI------------------------------------------PVEVSKVYRTY
AKARP---------VRT------------
>gi|148652236|ref|YP_001279329.1|	   613 residues, 50 /line  ribonuclease, Rne/Rng family [Psychrobacter sp. PRwf-1]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----MSEELLINVSP-MESRVAVLDNGVVSEVYIERHN-KLGLVGNIYLGTVVRVLPGMQ
AAFVEIGQSRTAFLHVNDMRRIARPAPTADKAPEIRHNAKQEPTVLTSMPVDRCEHIAEN
VVTASDTMASVIAETEPAMEADPLSAKTEIEAGSLREKKSALADESDNLKNDL-------
---------------------------------------LDNALLEIDSPDMVGNAITKA
DTKPAAVKERQIIEPPRHELIQYRLHEGQKILVQVTKDQLGTKGARLTTNISLPSRYLVY
LPSS-EHI-GISQRIDNEEERHRLKTELGALMQTVNLTGGLIARTAAERVPVAKLEEDIY
YLVQLWRTIQARKEASA------GSGQSAVLIYQELSLPLRSIRDLVHPDTEKVIVDHEG
MYNEVRQFAKEFVPFIYPRILPYSGE-QPLFDVHRVEEDLRDALKRRVDLKSGGYLIIDQ
TEAMTTIDVNTGSF--VGGRSLEDTVYKTNLEATHAIARQLRLRNLGGIIILDFIDMLEQ
QHKDDVLENLQYQLSQDYAKTKITQVSELGLVEMTRKRTRESLEQQLCEPCKTCEGKGFI
KTAETVCFEIFREIMR--------------------------------------------
----------------------------------------CART--YNSPKKFTVVAHAS
VIDLLLSSEADTVADLEYLLGRVITFEVENLYTQEQYDIVL-------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------D------------
>gi|149176937|ref|ZP_01855546.1|	   519 residues, 50 /line  ribonuclease E [Planctomyces maris DSM 8797]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----MKKEMLVNVLQPEESRIAIVEDGILEELYVERNS-LENLVGNIYKGKVVNIEPSIQ
AAFVDFGVGRNGFLHVSDIEHQY-YKH-----------LT---------D----------
------------------------------------------------------------
------------------------------------------GDGNGKPGRGRNQKGRRV
NER----------SVANKPPIQEILKRGSEVLVQVIKEGLGNKGPTLSTYISIPGRYLVI
MPGL-QRV-GISRKIADEDVRKDLRTILTQLAPPPGL--GFIVRTAGIDRTADDLKRDLN
YLLRLWGTIVGRIKKL----------PTPVEIYSESDMMIRTIRDIYNSEIDTLYIDEPT
AYQRARDFMKVVLPKHVNRVKHYTGN-DPIFYNSKLDDEICSIQNRHVPMKGGGSIVIDQ
TEALVAIDVNSGNY--RADDNAEKTAFKVNMKAAEEISRQIRLRDLGGVIVIDFIDMREE
KHRRSVERRLRELVKRDRARTKVLRISPFGLIEMTRQRIRPSLRRSMYEDCPSCRGTGQV
KTAESMAIEVMRTLMT--------------------------------------------
----------------------------------------TVNK--KNI-SRLVLNVHEN
VANYLNNKRRKDITQLEETAQTSIIINARTDVEPEHLMARCYDDIG--------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--NEVNF----------------------
>gi|32475458|ref|NP_868452.1|	   534 residues, 50 /line  ribonuclease E [Rhodopirellula baltica SH 1]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----MKREMLINVLQPEESRIAVVENNRLEELYVERKS-VENYSGNIYRGKIVNLEPSIQ
AAFVDFGVGRNGFLHISDIEPQY-FRQ-----------GGYDPEE-IMRE----------
------------------------------------------------------------
------------------------------------------SDEMAEAAAQRNRESGRG
STRVFK-----GGRPRNKPPIQEIFKRGDEVLVQVIKEGIGNKGPTLSTYISIPGRYLVL
MPAL-SRV-GVSRKIEDEDDRKRLKKCLLSLSPPKGL--GFIVRTAGAGRSEDELQRDMD
YLLRLWKAIVRRVENT----------TEPGEIYEESDLIIRTIRDIYSDDIDHILIDQKE
SYEKARDFLKMVMPRVVDRLKYYDGP-GPLFHKYNLEEEIVKINQRQVALPDGGSIVIDP
TEALVAIDVNSGNF--RGNASAEENAFRLNIAAAKEIARQLRLRDLGGVIVNDFIDMRKE
SYRRKVERVLRDAMANDRARTKILRTSPFGLIEMTRQRIRPSLKRSIYKDCPCCEGRGLV
KTPESMSIEVVRMLAL--------------------------------------------
----------------------------------------AVKN--KHI-VRVTVRVNDE
VSAFLNNKKRRTVSEMEECGNMTVQILGSEGLFPEHLEVDCRDEHG--------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--ERVEIDS--------------------
>gi|87306478|ref|ZP_01088625.1|	   588 residues, 50 /line  ribonuclease E [Blastopirellula marina DSM 3645]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----MKKEMLINVSQPEECRIAIVEDGILEEFYLERTS-QDNYVGNIYKGVVVNLEPSIQ
AAFVDFGVGKNGFLHISDVEPQY-FRQ-----------GGYDPAE-QLDDDFGGSYGGAT
AADF---------SDDDEEEISDSSGDDEEDKPDANDD----------------------
----------------------------------------GDGDSDDDAPPKPPQSRGRG
QRRPQQRRQRPGMRPRVKPPIQEIFKRGDEVLVQVIKEGIGSKGPTLSTYISIPGRYLVL
MPAL-GRV-GVSRKIEDDQVRRRLRSTLLELSPPKGL--GFIVRTAGQERNKKELSRDMA
YLLRLWKVIVRRLKNT----------TGPCDIYEESDMIIRTIRDIFSSDVDSIYVDSEP
AYERAKEFLQLVMPRHVNRLKKYESK-DPLFHKYHLDEEIARINQREVPLRRGGSIVIDQ
TEALVAIDVNSGNF--RYDGTAEEAAYQLNMMAAKEIARQLRLRDLGGVVVNDFIDMRRE
KHRRNVERALRDSVKRDRARTKILKTSPFGLIEMTRQRIRPSLKRSVFKDCPCCKGRGVV
KSAESMAIEVVRMLLA--------------------------------------------
----------------------------------------AAHH--DGA-SHVTIRVNDE
VATYLNNKKRRELARIEEDTNIVVQIYGSESFYPEHLEVECVDADG--------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--RRLHFDDRPTGNARH------------
>gi|22325461|ref|NP_178508.2|	   713 residues, 50 /line  glycoside hydrolase starch-binding domain-containing protein [Arabidopsis thaliana]
----------MQTDSEQDVESCDDNENNLNTDEQNHQLTET-------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------LLPDGGFF-QSE
S---IATTILINSSICTVQRIAVLEGGKLVELLLEPVK-TNVQCDSVYLGVITKFVPHMG
GAFVNIGSARHSFMDIKSNREPFIFPPFCDGSK--KQAADGSPIL-SMNDIPAPHEIEHA
SYDFEASSLLDIDSNDPGESFHDDDDEHENDEYHVSDHLAGLVN-GTVVNHGA-------
---------------------------------------VEVGSENGHIPMERGHSADSL
DSNASVAKASKV--MSSKDNKWIQVRKGTKIIVQVVKEGLGTKGPTLTAYPKLRSRFWVL
LTRC-KRI-GVSKKI-SGVERTRLKVIAKTLQ-PQGF--GLTVRTVAAGHSLEELQKDLD
GLLLTWKNITDEAKSAALAADEGVEGAIPALLHRAMGQTLSVVQDYFNDKVEKMVVDSPR
TYHEVTHYLQDMAPDLCNRVELHDKG-IPLFDLYEIEEEIEGILSKRVPLSNGGSLVIEQ
TEALVSIDVNGGHGMFGQGNSQEKAILEVNLAAARQIAREIRLRDIGGIIVVDFIDMADE
SNKRLVYEEVKKAVERDRSLVKVSELSRHGLMEITRKRVRPSVTFMISEPCSCCHATGRV
EALETTFSKIEQEICRQLAKMEKRGD----------------------------------
----------------------------------------LENP--KSW-PRFILRVDSH
MSSFLTTGKRTRLAILSSSLKVWILLKVARHFTRGT--FEVKPFMDEKTVNERQHQ----
------------------------------------------------------------
--------------------------------------VAISLLKK-----------ADA
IAD---------------------------------------------SSG---------
---KKKL------------------------------------------TLIPIKK----
-----EKT---SGKQRR------------
>gi|29346910|ref|NP_810413.1|	   524 residues, 50 /line  Ribonuclease G [Bacteroides thetaiotaomicron VPI-5482]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----MTSEIVIDVQP-KEVSIALLEDKSLVELQSEGRN-ISFSVGNMYLGRIKKLMPGLN
ACFVDVGYEKDAFLHYLDLGPQF-------------------------------------
------------------------------------NSLEKFVK-QTLSDKKK-------
---------------------------------------LN--------SISKATLLPDL
DKDG---------------TVANTLKVGQEVVVQIVKEPISTKGPRLTSEISFAGRYLVL
IPFN-DKV-SVSQKIKSSEERARLKQLLMSIK-PKNF--GVIVRTVAEGKRVAELDGELK
VLIKHWEDAMAKVQKAT---------KYPTLIYEETSRAVGLLRDLFNPSFENIHVNDEA
VYNEIKDYVTLIAPDRANIVKLYKGQ-LPIYDNFGITKQIKSSFGKTVSYKSGAYLIIEH
TEALHVVDVNSGNR-TKNANGQEGNALEVNLGAADELARQLRLRDMGGIIVVDFIDMNEA
ENRQKLYERMCANMQKDRARHNILPLSKFGLMQITRQRVRPAMDVNTTEICPTCFGKGTI
KSSILFTDTLESKIDY--------------------------------------------
----------------------------------------LVNK--LKV-KKFSLHVHPY
VAAFINQGLVSLRRKWQMKYGFGIKIIPSQKLAFLQ--YVFYDTHG--------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--EEIDMK---EEIEIK------------
>gi|53712844|ref|YP_098836.1|	   524 residues, 50 /line  ribonuclease G [Bacteroides fragilis YCH46]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----MTSELVVDVQP-KEVSIALLEDKSLVELQSEGRN-ISFSVGNMYLGRVKKLMPGLN
ACFVDVGYEKDAFLHYLDLGPQF-------------------------------------
------------------------------------NSLEKYVK-QTLSDKKK-------
---------------------------------------LN--------PISKATLLPDL
DKDG---------------TVANTLKVGQEVVVQIVKEPISTKGPRLTSEISFAGRYLVL
IPFN-DKV-SVSQKIKSSEERARLKQLLMSIK-PKNF--GVIVRTVAEGKRVAELDGELK
VLLKHWEESITKVQKAT---------KFPTLIYEETSRAVALLRDLFNPSFENIYVNNEA
VFNEIRDYVTLIAPERAGIVKLYKGQ-LPIYDNFGITKQIKSSFGKTVSYKSGAYLIIEH
TEALHVVDVNSGNR-TKNANGQEGNALEVNLGAADELARQLRLRDMGGIIVVDFIDMNEA
ENRQKLYERMCANMQKDRARHNILPLSKFGLMQITRQRVRPAMDVNTTETCPTCFGKGTI
KSSILFTDTLESKIDY--------------------------------------------
----------------------------------------LVNK--LKI-KKFSLHIHPY
VAAYLNQGLMSLKRKWQMKYGFGIKIIPSQKLAFLE--YVFYDSHG--------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--EEIDMK---EEFEIK------------
>gi|83589420|ref|YP_429429.1|	   562 residues, 50 /line  ribonuclease, Rne/Rng family [Moorella thermoacetica ATCC 39073]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----MLKEILIQDDA-EETAVALLEDGRLMEIYLERDS-NQRLVGNIYKGRVANVLPGMQ
AAFVDIGLEKNAFLFVDDTSGIE-------------------------------------
------------------------------------ALE---------------------
-------------------------------------------------------GEIVS
RSRR---------------RISDVVREGQEILVQVAKEPQGTKGARVTTQITLPGRYLVL
MPTV-NYI-GVSRRISHEEERERLKNLARAVK-PRRM--GLIVRTVAAGAGLEELQADCQ
NLTRTWKRIRQAARR-S---------KAPRLVHHDVELSLRILRDLYADDVNRLVVNSPA
TYAKVLEVLAGRAPNLRQRVILRE-N-ADLFAVYGVQNQIEQALKRKVWLRCGGYLIIDQ
MEALTAIDVNTGKY-V-GRHNLAETVLTTNLEAAVEVARQLRLRNIGGIIVVDFIDMDNP
LHREQVIKVLEGELTKDKTKTQILGFTRLGLLEMTRKKAQQRLESVLQQDCPYCHGTGKV
LSAETVTLKARKEILQ--------------------------------------------
----------------------------------------LAAV--SKA-RAILAEANPA
VAAPLIGVGGANLRTLERRAGKKLIIKGNENFHLEE--VRLRELFDREEIANLSTP----
------------------------------------------------------------
--------------------------------------VKVGQVLQVTIEGVHTGNGGDG
IAR---------------------------------------------VAGFVLDIPGGA
AYLGREV------------------------------------------PVEITRVFRTY
ARARLLAN--------A------------
>gi|83814929|ref|YP_444634.1|	   596 residues, 50 /line  ribonuclease, Rne/Rng family subfamily [Salinibacter ruber DSM 13855]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----MSKEIVFNVGN-EQTRIAIVEDGKLVELYIENAE-HKRTIGNLYLGQIRKVMPSIQ
AAFVDIGQEQDAFLHFSDLSDNL-------------------------------------
------------------------------------PYLLDFLG-LEAPTVEA-------
---------------------------------------ID-------------VPKGKK
DWDK---------------RPSDLLNRGQTILVQVTKEPISNKGSRISTDISLAGRFLVL
VPLQ-NYV-AVSRKITDDEERRRLESLASSLV-PDGV--GVIVRTVAQDRDAKSLDKDMK
LLMERWRRVEKRLKDKP---------SPPELVHEDVDMASSIVRDEFSEEYDRILVDHEG
LYSSIQSYVRAVGPQLVDRVELHEGD-QPVFESVGIQHGADRAFKDRVELPSGGYLFIEK
TEAMHVVDVNSGRS-G-KGKSQAENSLNVNLEAARVIARQIRLRDLGGIIVVDFIDLRDE
DDKKKVYDEVKKGFEEDRAVTKVLPMSDFGLVEITRQRLRPSITTTFSSANGTPSDDGDD
GADPEELRQAERKIQS-LEKEVEKREREVKRLKAEDDTPDEEVTALRQKIQALEDKLEAA
RAQQTAENATPRPSSSDGSAASAEGDAAPDELVEDIEQWLVAHS--DTH-RAVTLRVHPF
VAAFLRRPVPTYTTRWFMEHLVRVHVEADTEVPPHT--FQVTDESG--------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--APLPES--------P------------
>gi|119469427|ref|ZP_01612366.1|	   564 residues, 50 /line  RNase E: endoribonuclease for rRNA processing and mRNA degradation; member of the degradosome; involved in the production of [Alteromonadales bacterium TW-7]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----MKR-MLINATQQEEMRVALVDGQRLYDLDIESPG-HEQKKANIYKGKITRIEPSLE
AAFVDYGADRHGFLPLKEIARTY-FPA---------------------------------
------------------------------------------------------------
---------------------------------------------------GYTFNG---
-----------------RPNIRDVIKEGQEVIIQVDKEERGQKGAALTTFISVAGSYLVL
MPNN-PRAGGISRRIEG-DERTELKEALSRLELPKGM--GLIVRTAGVGKSFEELNYDLK
ALLVHWEAIRQAADSA----------KAPFLIHQESNVIFRAIRDYLRRDIGEILIDKPR
VFEEAKAHIERFRPDFMSRVKLYQGD-TPLFTHYQIESQIESAFQREVRLPSGGSIVIDP
TEALTSIDINSSKA--TKGGDIEETALNTNLEAADEIARQLRLRDLGGLIVIDFIDMTPP
RHQREVENRLKDAARPDRARVQIGKISRFGLLEMSRQRLRPSLGEASQGVCPRCSGQGTV
RSNESIALSILRLIEE--------------------------------------------
----------------------------------------EAIK--DNT-SQVNAQVPVA
VAAYLLNEQRRSVHRIEKHHKCDVVIIPNQHMETPHYEVMRL----RKDET---LETVSY
EQV----VAPEPEAFEMSKSPAAP--VREEPMLKGVV----M------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------PSSPAPQAAPAPAAKPAA--VAAKEEAGLLL
HLL---LV---------------------
>gi|52842507|ref|YP_096306.1|	   667 residues, 50 /line  ribonuclease E [Legionella pneumophila subsp. pneumophila str. Philadelphia 1]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------------------------------------------MGL
Y---MEK-MLINAMQTEEIRVALIKNNQLFDLDIECPG-EIKKKGNIYKAIVTRREPSLD
AVFVEYGSKRQGFLPLKEIAPEY-LSK---------------------------------
------------------------------------------------------------
---------------------------------------------------NPEEFG---
---------------DEKPPITSLIREGQELLIQVDKEERGNKGAALTTFITLAGCYLVL
MPNN-PHSGGISRRIEG-DERDELRETLNALTLPEDM--GLIIRTAGVGKSLEELQDDLN
MLCNQWQSIKEAYNSE----------LAPCLIHQEGDVIIRSIRDNLRKSISEIIIDDQI
SYIKAKQYIERVKPEFLPNLKLYNSS-IPLFNFYQIESQIETAYQRQVMLPSGGALVIDR
TEALVSIDINSAKA--TGGADIEATALNTNLEAADEIARQLRLRDLGGLVVIDFIDMSSS
KNQREVENRLKEALQADRARIQVGRISRFGLLEMSRQRLRLSLGETAQEICPRCEGRGTV
RSIQSHGLSITRLIEE--------------------------------------------
----------------------------------------EALK--EKT-AEIQVQLPPE
MATFIMNEKRNFIRDIEKRHGVSVVVIANPYMHPPQYTITRL----KEDNV---GKSKKP
SYS----LIQQPEVHVPSSDKEPV--SHDEPAVKSFA----E-HRVIKHPQTSF-IK---
-------RLWTSLFGGHSVAHTVTQEPGKKHHRAQNQG-----KHASSKSSGGDKRQQGS
N-----ANRRRRSGGGQ------QRSSSGN-----TN-----------------------
-AAAS---------------T----HQQRKKSNANQQSHGSQQSNRS--IPAKNEGNKKR
EAI---LA---KEPEEK------------
>gi|145627603|ref|ZP_01783423.1|	   628 residues, 50 /line  ribonuclease, Rne/Rng family [Shewanella baltica OS185]
------------------------------------------------------------
------------------------------------------------------------
------MQRSA-------------------------------------------------
------------------------------------------------MFDDLY---LKK
NDVIMKR-MLINATQSEELRVALVDGQQLYDLDIESPG-HEQKKSNIYKGKITRVEPSLE
AAFVDYGADRHGFLPLKEIAREY-FPK---------------------------------
------------------------------------------------------------
---------------------------------------------------GYSFQG---
-----------------RPNIKEVVSEGQEVIVQIDKEERGNKGAALTTFISLAGSYLVL
MPNN-PRAGGISRRIEG-DERTELKEAMADLEVPAGM--GLIVRTAGVGKESAELKWDLK
VLQHHWAAITEASQVK----------GAPFLIHQESNVIVRAIRDYLRRDVGEILIDHPR
IFEEAKQHIALVRPDFVERVKLYEAE-VPLFTHFQIESQIESAFQREVRLPSGGSIVIDP
TEALTSIDINSARA--TKGGDIEETALNTNLEAADEIARQLRLRDLGGLVVIDFIDMTPV
RHQREVENRLRDAVHHDRARVQLGRISRFGLMEMSRQRLRPSLEESAAHICPRCHGQGTI
RSTESLALSILRLMEE--------------------------------------------
----------------------------------------EAIK--ENT-SQIEAIVPVD
VAAFLLNEKRKAIRITEQRHDVEVYVIPDAHMMTPDYRVIRH----RSDDE---ISESSY
KRI----EQPEAKLYEPRK-LERT--AAPIPALKGFA----APQKVEQAPSPTVKVE---
-------APQPGFFSKLVSAISAMFAPSEKAEPVKVVE-----TKTTDTSAANANRRNRR
N-----DTRRPRNAQDA------D------------------------------------
------------------------------------------------------------
------------KAXEG------------
>gi|124120794|gb|EAY39537.1|	   619 residues, 50 /line  ribonuclease E [Vibrio cholerae MZO-3]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------MLINATQKEELRVALVDGQRLFDLDIESPG-HESKKANIYKGRITRIEPSLE
AAFVDYGAERHGFLPLKEIAREY-FPD---------------------------------
------------------------------------------------------------
---------------------------------------------------GYSYQG---
-----------------RPNIKDVLNEGQEVIVQIEKEERGSKGAALTTFISLAGSYLVL
MPNN-PRAGGISRRIEG-DERTELKSALSSLELPQGM--GLIVRTAGVGKSAEELEWDLN
VLLKHWSAIKQASDSN----------PAPFLIHQESNVIVRAIRDYLRRDIGEILIDSNS
IYERALEHIRLVRPDFVNRVKKYEGE-VPLFSHFQIESQIESAFQREVRLPSGGSIVIDP
TEALTSIDINSARA--TKGGDIEETALNTNLEAADEIARQLRLRDLGGLVVIDFIDMTPV
RHQREVENRLREAVRVDRARVQIGRISRFGLLEMSRQRLSPSLAEASHHICPRCKGTGVI
RDNESLALSVLRLIEE--------------------------------------------
----------------------------------------EALK--DNT-SQVLAVVPVS
IASYLLNEKRRSINHIEKAQQVRITIVPNSDMETPHFEVIRV----REGE---EQDVLSY
LIPKKLEAMKEAE-GKEVVDVELKPKRIEEPVLKGFA----APAEAVPAPTPKPKAEPQP
VAE-VQQPAQPGFFSRVFKAIASLFSETPEAAKVEAPV-----TQNSEQDKPRRERNDRN
N-----DRR--RNPRDK-------------------------------------------
------------------------------------------------------------
------------NRRRG------------
>gi|67641114|ref|ZP_00439899.1|	   607 residues, 50 /line  COG1530: Ribonucleases G and E [Burkholderia mallei GB8 horse 4]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------MLFNATQQEELRVAIVDGQKLIDIDIETAG-REQRKGNIYKGVVTRIEPSLE
ACFVNYGEDRHGFLPFKEVARQY-FKE---------------------------------
------------------------------------------------------------
---------------------------------------------------GVDMR----
-----------------SARIQDALREGQELIVQVEKEERGNKGAALTTFISLAGRYLVL
MPNN-PRGGGVSRRIEG-DERQELRETMAQLQIPDGM--SMIARTAGIGRSAEELQWDLN
YLLQLWRAIEAASQSGH--------PGQPMLIYLESSLVIRAIRDYFQPDIGEILIDTTE
IHDQARAFMDIVMPDNVGKVKRYHDD-VPLFSRFQIEHQIETAYSRTVPLPSGGAIVIDH
TEALVAIDVNSARA--TKGADIEETATRTNLEAADEVARQLRLRDLGGLIVIDFIDMESA
KSQREVEQRLKDALKHDRARVQMGKISRFGLMELSRQRLRPALSEGSHVTCPRCNGTGHI
RDTESSALQVLRIIQE--------------------------------------------
----------------------------------------EAMK--ENT-AAIHCQVPVE
VTAFLLNEKRQEINKIESRFKVGVVLIPNKHLDTPHYKLERL----RHDDARLDDPRASW
KMAEEAARELEAETGYSKRAEETKPR--QEAAVKGIT-----PERPAPSPAPQRQSAPEA
AAPVAAAPASGGGFMKWLKE------MAEGPVWR--------------------------
-----------------AAGCGARTGARRA-----GN-----------------------
-GCASGA--------------------------------------------------RAR
GAW--------------------------
>gi|84361209|ref|ZP_00985887.1|	   707 residues, 50 /line  COG1530: Ribonucleases G and E [Burkholderia dolosa AUO158]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------MLFNATQQEELRVAIVDGQKLIDIDIETAG-REQRKGNIYKGVVTRIEPSLE
ACFVNYGEDRHGFLPFKEVARQY-FKE---------------------------------
------------------------------------------------------------
---------------------------------------------------GVDMR----
-----------------SARIQDALREGQELIVQVEKEERGNKGAALTTFISLAGRYLVL
MPNN-PRGGGVSRRIEG-DERQELRETMAQLQIPDGM--SMIARTAGIGRSAEELQWDLN
YLLQLWRAIEAASQSGN--------PGQPMLIYLESSLVIRAIRDYFQPDIGEILIDTTE
IYDQARAFMDIVMPDNVSKVKRYHDD-VPLFSRFQIEHQIETAYSRTVPLPSGGAIVIDH
TEALVAIDVNSARA--TKGADIEETATRTNLEAADEVARQLRLRDLGGLIVIDFIDMESA
KSQREVEQRLKDALKHDRARVQMGKISRFGLMELSRQRLRPALSEGSHVTCPRCNGTGHI
RDTESSALQVLRIIQE--------------------------------------------
----------------------------------------EAMK--ENT-AAIHCQVPVE
VTAFLLNEKRQEINKIESRFKVGIVLIPNKHLDTPHYKLERL----RHDDARLDDPRASW
KMAEEAARELESETGYSKRAADVKPK--QEAAVKGIT-----PERPAPSAAPQRPVEPVA
APAPAPVAAASGGFIGWLNG---LFGMSPAPAPAPAAP----APAKEQASRPARERAEKA
E--QRGETR--RRSQPAIAACGAQAGYKAAVDQACER-----------------------
-PCGQAATPRKRERLRKRASR----VTDAKVVKAAKVAVSATDSNRASRVKAVTRANRAR
AASRVNRA---SEPSSR------------
>gi|95926894|ref|ZP_01309664.1|	   715 residues, 50 /line  hypothetical protein CburR_01001281 [Coxiella burnetii RSA 331]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------MLINATQPDEVRVAITDDSKLIDLDIEIPG-QEQKKSNIYKGIITSIEPSLG
AVFVNYGSERHGFLPLKEISREY-FLQ---------------------------------
------------------------------------------------------------
---------------------------------------------------DIEGDF---
----------------DSIDINRVLKLGQELVVQVDKEERGTKGAALTTFISLAGSFLVL
MPNN-PRAGGISRRIEG-DERDQLRETINQLSLPEGM--GLIVRTAGLGRPKEELEWDLK
ILLRYWEAVKQAAVAK----------PGPYLIHQESDVIIRAIRDYLRQDVEEILIDDEV
AFENARHYINQVRPQFVERLKLYREH-LPLFSRFQIEQQIENAHQREIRLPSGGSLIIDH
SEALIAIDINSARA--TRGASIEETALSTNLEAAEEIARQLRIRDIGGLIVIDFIDMTPL
RNQREVENCLRNALSQDRARIQIGRISRFGLLEMSRQRLRSSLTRSTQIACPRCNAEGTI
RSIESLGLSIIHIIQE--------------------------------------------
----------------------------------------QASK--AKN-IHFQLQAPVD
LATYLINEKRELLRGIEHHYPVKITIVPNQYMETPLYQLRQI----KIDPASLE---HGK
GMASYKLTKVFKTEAPQK--QEIR--ALSEPAIQQFLTSPPAPTTPRKTPTP--------
-----------GLFKRLMGK---MFGSEEEPSTAVTPPVKPHVPERHKPSSPPRGRRQGG
YASRKSTGP--RRHHPRSGGGDHGQNRHGARSRRGTRGGRRDHGGGRGGPGYHTQSTGPM
PPLGEDVVDVNQLPMSTPPSPPPPFLTDADVPPSRDERRSGGINGDADHGAKPHPNGKVS
DDNRGN----------R------------

Ad blocker interference detected!


Wikia is a free-to-use site that makes money from advertising. We have a modified experience for viewers using ad blockers

Wikia is not accessible if you’ve made further modifications. Remove the custom ad blocker rule(s) and the page will load as expected.