FANDOM


&&&&&&&&&&&&&&&&&&&& BEGIN  /usr/local/www/html/proteins/Compiled_Programs/WYRM/PyMOL_highlight_conserved_residues &&&&&&&&&&&&&&&&&&&&

Successfully read 2 file paths from WYRM_file_paths.txt

generic_input                                         /usr/local/www/html/proteins/workspace/
generic_output                                        /usr/local/www/html/proteins/htdocs/results/

======================================================

Sequence file type = 3

Sequence type = 3

Got here 1
Got here 2
Got here 3
Sequence 1
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Sequence 2
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Read 2 amino_acid sequences from PIR Sequence file /usr/local/www/html/proteins/workspace/At2g04270-2-2bx2L.pir.txt

======================================================

Assigned types to 871 residues in Sequence 2-4270-2, 21 remain unknown
Assigned types to 488 residues in Sequence 2bx2L, 404 remain unknown

======================================================

Successfully read 576 entries for residue match scoring matrix /usr/local/www/html/proteins/workspace/BLOSUM62.dat

Read the residue match scoring matrix /usr/local/www/html/proteins/workspace/BLOSUM62.dat

======================================================

Error in function WYRM_analyze_conservation_in_sequence_alignment()
Path index 402  All residues are positively and negatively charged

Error in function WYRM_analyze_conservation_in_sequence_alignment()
Path index 403  All residues are positively and negatively charged

Error in function WYRM_analyze_conservation_in_sequence_alignment()
Path index 404  All residues are positively and negatively charged

Error in function WYRM_analyze_conservation_in_sequence_alignment()
Path index 405  All residues are positively and negatively charged

Error in function WYRM_analyze_conservation_in_sequence_alignment()
Path index 406  All residues are positively and negatively charged

Error in function WYRM_analyze_conservation_in_sequence_alignment()
Path index 407  All residues are positively and negatively charged

Error in function WYRM_analyze_conservation_in_sequence_alignment()
Path index 408  All residues are positively and negatively charged

Error in function WYRM_analyze_conservation_in_sequence_alignment()
Path index 458  All residues are positively and negatively charged

Error in function WYRM_analyze_conservation_in_sequence_alignment()
Path index 466  All residues are positively and negatively charged

Error in function WYRM_analyze_conservation_in_sequence_alignment()
Path index 467  All residues are positively and negatively charged

Error in function WYRM_analyze_conservation_in_sequence_alignment()
Path index 468  All residues are positively and negatively charged

Error in function WYRM_analyze_conservation_in_sequence_alignment()
Path index 469  All residues are positively and negatively charged

Error in function WYRM_analyze_conservation_in_sequence_alignment()
Path index 470  All residues are positively and negatively charged

Error in function WYRM_analyze_conservation_in_sequence_alignment()
Path index 471  All residues are positively and negatively charged

Error in function WYRM_analyze_conservation_in_sequence_alignment()
Path index 488  All residues are positively and negatively charged

Error in function WYRM_analyze_conservation_in_sequence_alignment()
Path index 586  All residues are positively and negatively charged

Error in function WYRM_analyze_conservation_in_sequence_alignment()
Path index 653  All residues are positively and negatively charged

Error in function WYRM_analyze_conservation_in_sequence_alignment()
Path index 654  All residues are positively and negatively charged

Error in function WYRM_analyze_conservation_in_sequence_alignment()
Path index 655  All residues are positively and negatively charged

Error in function WYRM_analyze_conservation_in_sequence_alignment()
Path index 656  All residues are positively and negatively charged

Error in function WYRM_analyze_conservation_in_sequence_alignment()
Path index 821  All residues are positively and negatively charged

Translated sequence file At2g04270-2-2bx2L.pir.txt into sequence alignment.

======================================================

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code C for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code A for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code G for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

Error in function WYRM_amino_acid_type_from_3letter_code()
Unknown 3-letter code U for amino acid

>2BX2.pdb  Made from 4076 ATOM records in 2BX2.pdb
AHIEGRHMKRMLINATQQEELRVALVDGQRLYDLDIESPGHEQKKANIYK
GKITRIEPSLEAAFVDYGAERHGFLPLKEIAREYFPRPNIKDVLREGQEV
IVQIDKEERGNKGAALTTFISLAGSYLVLMPNNPRAGGISRRIELKEALA
SLELPEGMGLIVRTAGVGKSAEALQWDLSFRLKHWEAIKKAAESRPAPFL
IHQESNVIVRAFRDYLRQDIGEILIDNPKVLELARQHIAALGRPDFSSKI
KLYTGEIPLFSHYQIESQIESAFQREVRLPSGGSIVIDSTEALTAIDINS
ARGDIEETAFNTNLEAADEIARQLRLRDLGGLIVIDFIDMTPVRHQRAVE
NRLREAVRQDRARIQISHISRFGLLEMSRQRLSPSLGESSHHVCPRCSGT
GTVRDNESLSLSILRLIEEEALKENTQEVHAIVPVPIASYLLNEKRSAVN
AIETRQDGVRCVIVPNDQMETPHYHVLRVRKGEETPTLSYMLPKLHEEAM
XXXXXXXXXXXXXX

======================================================

Error in function WYRM_analyze_conservation_in_sequence_alignment()
Path index 81  All residues are positively and negatively charged

Error in function WYRM_analyze_conservation_in_sequence_alignment()
Path index 145  All residues are positively and negatively charged

Best alignment:
2BX2.pdb    94  LREGQEVIVQIDKEERGNKGAALTTFISLAGSYLVLMPNNPRAG---GIS   140
                +R+G ++IVQ+ KE  G KG  LT +  L   + VL+    R G    IS
2-4270-2   409  VRKGTKIIVQVVKEGLGTKGPTLTAYPKLRSRFWVLLTRCKRIGVSKKIS   458

2BX2.pdb   140  --RRIELKEALASLELPEGMGLIVRTAGVGKSAEALQWDLSFRLKHW---   185
                   R  LK    +L+ P+G GL VRT   G S E LQ DL   L  W   
2-4270-2   459  GVERTRLKVIAKTLQ-PQGFGLTVRTVAAGHSLEELQKDLDGLLLTWKNI   507

2BX2.pdb   185  -----EAIKKAAE--SRPAPFLIHQESNVIVRAFRDYLRQDIGEILIDNP   228
                      A   A E      P L+H+     +   +DY    + ++++D+P
2-4270-2   508  TDEAKSAALAADEGVEGAIPALLHRAMGQTLSVVQDYFNDKVEKMVVDSP   557

2BX2.pdb   229  KVLELARQHIAALGRPDFSSKIKLYTGEIPLFSHYQIESQIESAFQREVR   278
                +       ++  +  PD  ++++L+   IPLF  Y+IE +IE    + V 
2-4270-2   558  RTYHEVTHYLQDMA-PDLCNRVELHDKGIPLFDLYEIEEEIEGILSKRVP   606

2BX2.pdb   279  LPSGGSIVIDSTEALTAIDINSA-----RGDIEETA-FNTNLEAADEIAR   322
                L +GGS+VI+ TEAL +ID+N       +G+ +E A    NL AA +IAR
2-4270-2   607  LSNGGSLVIEQTEALVSIDVNGGHGMFGQGNSQEKAILEVNLAAARQIAR   656

2BX2.pdb   323  QLRLRDLGGLIVIDFIDMTPVRHQRAVENRLREAVRQDRARIQISHISRF   372
                ++RLRD+GG+IV+DFIDM    ++R V   +++AV +DR+ +++S +SR 
2-4270-2   657  EIRLRDIGGIIVVDFIDMADESNKRLVYEEVKKAVERDRSLVKVSELSRH   706

2BX2.pdb   373  GLLEMSRQRLSPSLGESSHHVCPRCSGTGTVRDNES   408
                GL+E++R+R+ PS+       C  C  TG V   E+
2-4270-2   707  GLMEITRKRVRPSVTFMISEPCSCCHATGRVEALET   742

======================================================

Highlighted IDENTICAL residue ARG   95  index1   95  path  417  %Seq 100.00
Highlighted IDENTICAL residue GLY   97  index1   97  path  419  %Seq 100.00
Highlighted IDENTICAL residue ILE  101  index1  101  path  423  %Seq 100.00
Highlighted IDENTICAL residue VAL  102  index1  102  path  424  %Seq 100.00
Highlighted IDENTICAL residue GLN  103  index1  103  path  425  %Seq 100.00
Highlighted IDENTICAL residue LYS  106  index1  106  path  428  %Seq 100.00
Highlighted IDENTICAL residue GLU  107  index1  107  path  429  %Seq 100.00
Highlighted IDENTICAL residue GLY  110  index1  110  path  432  %Seq 100.00
Highlighted IDENTICAL residue LYS  112  index1  112  path  434  %Seq 100.00
Highlighted IDENTICAL residue GLY  113  index1  113  path  435  %Seq 100.00
Highlighted IDENTICAL residue LEU  116  index1  116  path  438  %Seq 100.00
Highlighted IDENTICAL residue THR  117  index1  117  path  439  %Seq 100.00
Highlighted IDENTICAL residue LEU  122  index1  122  path  444  %Seq 100.00
Highlighted IDENTICAL residue VAL  128  index1  128  path  450  %Seq 100.00
Highlighted IDENTICAL residue LEU  129  index1  129  path  451  %Seq 100.00
Highlighted IDENTICAL residue ARG  135  index1  135  path  457  %Seq 100.00
Highlighted IDENTICAL residue GLY  137  index1  137  path  460  %Seq 100.00
Highlighted IDENTICAL residue ILE  139  index1  139  path  465  %Seq 100.00
Highlighted IDENTICAL residue ARG  141  index1  141  path  475  %Seq  50.00
Highlighted IDENTICAL residue ARG  142  index1  142  path  476  %Seq  50.00
Highlighted IDENTICAL residue ILE  143  index1  143  path  477  %Seq  50.00
Highlighted IDENTICAL residue GLU  150  index1  144  path  478  %Seq  50.00
Highlighted IDENTICAL residue LEU  151  index1  145  path  479  %Seq 100.00
Highlighted IDENTICAL residue LYS  152  index1  146  path  480  %Seq 100.00
Highlighted IDENTICAL residue LEU  158  index1  152  path  486  %Seq 100.00
Highlighted IDENTICAL residue PRO  161  index1  155  path  489  %Seq 100.00
Highlighted IDENTICAL residue GLY  163  index1  157  path  491  %Seq 100.00
Highlighted IDENTICAL residue GLY  165  index1  159  path  493  %Seq 100.00
Highlighted IDENTICAL residue LEU  166  index1  160  path  494  %Seq 100.00
Highlighted IDENTICAL residue VAL  168  index1  162  path  496  %Seq 100.00
Highlighted IDENTICAL residue ARG  169  index1  163  path  497  %Seq 100.00
Highlighted IDENTICAL residue THR  170  index1  164  path  498  %Seq 100.00
Highlighted IDENTICAL residue GLY  174  index1  168  path  502  %Seq 100.00
Highlighted IDENTICAL residue SER  176  index1  170  path  504  %Seq 100.00
Highlighted IDENTICAL residue GLU  178  index1  172  path  506  %Seq 100.00
Highlighted IDENTICAL residue LEU  180  index1  174  path  508  %Seq 100.00
Highlighted IDENTICAL residue GLN  181  index1  175  path  509  %Seq 100.00
Highlighted IDENTICAL residue ASP  183  index1  177  path  511  %Seq 100.00
Highlighted IDENTICAL residue LEU  184  index1  178  path  512  %Seq 100.00
Highlighted IDENTICAL residue LEU  188  index1  182  path  516  %Seq 100.00
Highlighted IDENTICAL residue TRP  191  index1  185  path  519  %Seq 100.00
Highlighted IDENTICAL residue GLU  192  index1  186  path  528  %Seq 100.00
Highlighted IDENTICAL residue ILE  194  index1  188  path  530  %Seq  50.00
Highlighted IDENTICAL residue LYS  195  index1  189  path  531  %Seq  50.00
Highlighted IDENTICAL residue LYS  196  index1  190  path  532  %Seq  50.00
Highlighted IDENTICAL residue ALA  197  index1  191  path  533  %Seq  50.00
Highlighted IDENTICAL residue ALA  198  index1  192  path  534  %Seq  50.00
Highlighted IDENTICAL residue GLU  199  index1  193  path  535  %Seq  50.00
Highlighted IDENTICAL residue SER  200  index1  194  path  538  %Seq  50.00
Highlighted IDENTICAL residue ARG  201  index1  195  path  539  %Seq  50.00
Highlighted IDENTICAL residue PRO  204  index1  198  path  542  %Seq 100.00
Highlighted IDENTICAL residue LEU  206  index1  200  path  544  %Seq 100.00
Highlighted IDENTICAL residue HIS  208  index1  202  path  546  %Seq 100.00
Highlighted IDENTICAL residue ASP  220  index1  214  path  558  %Seq 100.00
Highlighted IDENTICAL residue TYR  221  index1  215  path  559  %Seq 100.00
Highlighted IDENTICAL residue ASP  232  index1  226  path  570  %Seq 100.00
Highlighted IDENTICAL residue PRO  234  index1  228  path  572  %Seq 100.00
Highlighted IDENTICAL residue PRO  250  index1  244  path  588  %Seq 100.00
Highlighted IDENTICAL residue ASP  251  index1  245  path  589  %Seq 100.00
Highlighted IDENTICAL residue LEU  258  index1  252  path  596  %Seq 100.00
Highlighted IDENTICAL residue ILE  263  index1  257  path  601  %Seq 100.00
Highlighted IDENTICAL residue PRO  264  index1  258  path  602  %Seq 100.00
Highlighted IDENTICAL residue LEU  265  index1  259  path  603  %Seq 100.00
Highlighted IDENTICAL residue PHE  266  index1  260  path  604  %Seq 100.00
Highlighted IDENTICAL residue TYR  269  index1  263  path  607  %Seq 100.00
Highlighted IDENTICAL residue ILE  271  index1  265  path  609  %Seq 100.00
Highlighted IDENTICAL residue GLU  272  index1  266  path  610  %Seq 100.00
Highlighted IDENTICAL residue ILE  275  index1  269  path  613  %Seq 100.00
Highlighted IDENTICAL residue GLU  276  index1  270  path  614  %Seq 100.00
Highlighted IDENTICAL residue VAL  283  index1  277  path  621  %Seq 100.00
Highlighted IDENTICAL residue LEU  285  index1  279  path  623  %Seq 100.00
Highlighted IDENTICAL residue GLY  288  index1  282  path  626  %Seq 100.00
Highlighted IDENTICAL residue GLY  289  index1  283  path  627  %Seq 100.00
Highlighted IDENTICAL residue SER  290  index1  284  path  628  %Seq 100.00
Highlighted IDENTICAL residue VAL  292  index1  286  path  630  %Seq 100.00
Highlighted IDENTICAL residue ILE  293  index1  287  path  631  %Seq 100.00
Highlighted IDENTICAL residue THR  296  index1  290  path  634  %Seq 100.00
Highlighted IDENTICAL residue GLU  297  index1  291  path  635  %Seq 100.00
Highlighted IDENTICAL residue ALA  298  index1  292  path  636  %Seq 100.00
Highlighted IDENTICAL residue LEU  299  index1  293  path  637  %Seq 100.00
Highlighted IDENTICAL residue ILE  302  index1  296  path  640  %Seq 100.00
Highlighted IDENTICAL residue ASP  303  index1  297  path  641  %Seq 100.00
Highlighted IDENTICAL residue ASN  305  index1  299  path  643  %Seq 100.00
Highlighted IDENTICAL residue ARG  308  index1  302  path  651  %Seq  50.00
Highlighted IDENTICAL residue GLY  313  index1  303  path  652  %Seq  50.00
Highlighted IDENTICAL residue GLU  317  index1  307  path  660  %Seq 100.00
Highlighted IDENTICAL residue ASN  323  index1  313  path  667  %Seq 100.00
Highlighted IDENTICAL residue LEU  324  index1  314  path  668  %Seq 100.00
Highlighted IDENTICAL residue ALA  326  index1  316  path  670  %Seq 100.00
Highlighted IDENTICAL residue ALA  327  index1  317  path  671  %Seq 100.00
Highlighted IDENTICAL residue ILE  330  index1  320  path  674  %Seq 100.00
Highlighted IDENTICAL residue ALA  331  index1  321  path  675  %Seq 100.00
Highlighted IDENTICAL residue ARG  332  index1  322  path  676  %Seq 100.00
Highlighted IDENTICAL residue ARG  335  index1  325  path  679  %Seq 100.00
Highlighted IDENTICAL residue LEU  336  index1  326  path  680  %Seq 100.00
Highlighted IDENTICAL residue ARG  337  index1  327  path  681  %Seq 100.00
Highlighted IDENTICAL residue ASP  338  index1  328  path  682  %Seq 100.00
Highlighted IDENTICAL residue GLY  340  index1  330  path  684  %Seq 100.00
Highlighted IDENTICAL residue GLY  341  index1  331  path  685  %Seq 100.00
Highlighted IDENTICAL residue ILE  343  index1  333  path  687  %Seq 100.00
Highlighted IDENTICAL residue VAL  344  index1  334  path  688  %Seq 100.00
Highlighted IDENTICAL residue ASP  346  index1  336  path  690  %Seq 100.00
Highlighted IDENTICAL residue PHE  347  index1  337  path  691  %Seq 100.00
Highlighted IDENTICAL residue ILE  348  index1  338  path  692  %Seq 100.00
Highlighted IDENTICAL residue ASP  349  index1  339  path  693  %Seq 100.00
Highlighted IDENTICAL residue MET  350  index1  340  path  694  %Seq 100.00
Highlighted IDENTICAL residue ARG  357  index1  347  path  701  %Seq 100.00
Highlighted IDENTICAL residue VAL  359  index1  349  path  703  %Seq 100.00
Highlighted IDENTICAL residue ALA  366  index1  356  path  710  %Seq 100.00
Highlighted IDENTICAL residue VAL  367  index1  357  path  711  %Seq 100.00
Highlighted IDENTICAL residue ASP  370  index1  360  path  714  %Seq 100.00
Highlighted IDENTICAL residue ARG  371  index1  361  path  715  %Seq 100.00
Highlighted IDENTICAL residue SER  377  index1  367  path  721  %Seq 100.00
Highlighted IDENTICAL residue SER  380  index1  370  path  724  %Seq 100.00
Highlighted IDENTICAL residue ARG  381  index1  371  path  725  %Seq 100.00
Highlighted IDENTICAL residue GLY  383  index1  373  path  727  %Seq 100.00
Highlighted IDENTICAL residue LEU  384  index1  374  path  728  %Seq 100.00
Highlighted IDENTICAL residue GLU  386  index1  376  path  730  %Seq 100.00
Highlighted IDENTICAL residue ARG  389  index1  379  path  733  %Seq 100.00
Highlighted IDENTICAL residue ARG  391  index1  381  path  735  %Seq 100.00
Highlighted IDENTICAL residue PRO  394  index1  384  path  738  %Seq 100.00
Highlighted IDENTICAL residue SER  395  index1  385  path  739  %Seq 100.00
Highlighted IDENTICAL residue CYS  404  index1  394  path  748  %Seq 100.00
Highlighted IDENTICAL residue CYS  407  index1  397  path  751  %Seq 100.00
Highlighted IDENTICAL residue THR  410  index1  400  path  754  %Seq 100.00
Highlighted IDENTICAL residue GLY  411  index1  401  path  755  %Seq 100.00
Highlighted IDENTICAL residue VAL  413  index1  403  path  757  %Seq 100.00
Highlighted IDENTICAL residue GLU  417  index1  407  path  761  %Seq 100.00
Highlighted 128 residues for visualization

Wrote PyMOL macro into file /usr/local/www/html/proteins/htdocs/results/At2g04270-2-2bx2L.pir.txt.2BX2.pdb.conservation.pml

===============================================================================

The program

/usr/local/www/html/proteins/Compiled_Programs/WYRM/PyMOL_highlight_conserved_residues At2g04270-2-2bx2L.pir.txt PIR amino_acid 2BX2.pdb _ 100.0 BLOSUM62.dat 

completed successfully.

@@@@@@@@@@@@@@@@@@@@ END  /usr/local/www/html/proteins/Compiled_Programs/WYRM/PyMOL_highlight_conserved_residues @@@@@@@@@@@@@@@@@@@@


Ad blocker interference detected!


Wikia is a free-to-use site that makes money from advertising. We have a modified experience for viewers using ad blockers

Wikia is not accessible if you’ve made further modifications. Remove the custom ad blocker rule(s) and the page will load as expected.