Fandom

Proteins Wiki

At2g04270.2/MSA

< At2g04270.2

47,923pages on
this wiki
Add New Page
Talk0 Share
>gi|30678104|ref|NP_850988.1|	   871 residues, 50 /line  glycoside hydrolase starch-binding domain-containing protein [Arabidopsis thaliana]
------------------------------------------------------------
------------------------------------------------------------
--MIMNGKLKS-------------------------------------------------
-RYNYLLKAGYGSSSDVIWRPGPQFSLSVPSSVNQDRKIIIRDSWMSMSISSKSQESYGW
GSWIDDAYLFPNCVTPAQSEDECTSADSAIEV---------------------PRTHLND
KQVGAESFLCDELAAFSSENSNLSALFS-DNY-----QPIEEPWLI--------------
------QESITLQHERNMQTDSEQDVESCDDNENNLNTDEQNHQLT------------ET
-----------------L------LPDGGFFQSESI------------------------
---ATTILINSSICTVQRIAVLEGGKLVELLLEPVKTNVQCDSVYLGVITKFVPHMGGAF
VNIGSARHSFMDIKSNREPFIFPPFCDGSK-KQAADGS----------------------
------------------------------------------------PILSMNDIPAPH
EIEHASY-----------------------------------------------------
-----DFEASSLLD-IDSND-PGESFH----DDDDEH----ENDEYHV--SDHLAGLVNG
TVVNHGAVEVGSENGH----IPMERGHSADSLDSNAS----------VAKAS-KVM-SSK
D-N--KWIQVRKGTKIIVQVVKEGLGTKGPTLTAYPKLRSRFWVLLTRCKRI-GVSKKI-
SGV-ERTRLKVIAKTLQ-PQGFGLTVRTVAAGHSLEELQKDLDGLLLTWKNITDEAKSAA
LAADEGVEGAIPALLHRAMGQTLSVVQDYFNDKVEKMVVDSPRTYHEVTHYLQDMAPDLC
NRVELH----DKG-----IPLFDLYEIEEEIEGILSKRVPLSNGGSLVIEQTEALVSIDV
NGGHGMFGQGNSQEKAILEVNLAAARQIAREIRLRDIGGIIVVDFIDMADESNKRLVYEE
VKKAVERDRSLVKVSELSRHGLMEITRKRVRPSVTFMISEPCSCCHATGRVEALETTFSK
IEQEICRQLAKMEKRGDLENPKSWPRFILRVDSHMSSFLTTGKRTRLAILSSSLKVWILL
KVARHFTRGTFEVKPFMDEKTVNERQHQ--VAISLLKK------------ADAIAD----
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------------SSGKKKL-TLIPIKKE------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------KTSGKQR--R
>gi|114326947|ref|YP_744104.1|	   949 residues, 50 /line  ribonuclease E [Granulibacter bethesdensis CGDNIH1]
-----MSCHAPQALARIRLRLCVPF-----------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-ATIHRHNVMPGGARRSRISRVCTGA----------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------------------HYSM------------------------
---TKKMLIDASHAEETRVVVMDGNRLEDFDVEAASRKQIKGNIYLAKVVRVEPSLQAAF
VEYGGNRHGFLAFSEIHPDYYQ-----------------IPVADRQRLLAMQEEEAREEE
EAEEAEF--------------------------------------------------SAA
EARRSAS-----------------------------------------------------
-----RPLNNAR-EVIQA-DSEQPEAS----D-PQED----GADHGVQ----------DE
SAAD-----FSGEAGD----EGSVPASAGEGDDQEESRQASRPARQKEDRERRSPRFLRN
Y-K--IQEVIKRRQILLIQVVKEERGNKGAALSTYISLAGRYCVLMPNSPRGGGVSRKIT
SAT-DRRRLKDIIGALEIPRGMGIIVRTAGGNRPKAEIMRDCEYLLRLWDDIRDITLR--
--------SSAPALIHEEASLIKRAIRDVYTSTIEEVLVDGEEGWRAARDIMRMLMPSHA
RKVICW----NADKERAGQPLFAHYQVESQLDAILAPNVSLKSGGYLVINQAEALVAIDV
NSGRST--KERGIEETALRTNLEAADEVARQLRLRDLAGLIVIDFIDMESRKHNGMVERR
LKEALKNDRARIQVGQISSFGLLEMSRQRLRPSLTETSMITCPHCNGLGLVRTTEGASVH
VLRAIEEEGAR----------RRYAEIMVHAAADVAFYILNNRRDFLATLESRFGMKVLF
SADTQFSGSQLRIEKIRARAMEDVVRTPLIGVADPQPS------------VAGDLYDFA-
-----DASDGFATFE--------------A--------APVAALPVAVQAEPVGTAEEGN
NGG--------------RLP-SAEGDSEPGPD----------------------------
-------------------------------DGE---RRRRRRRRRRGN--RRNDGAENG
MDARSEQDE-----------------------------------NGNPVEEGEGVRHGDA
NTSALPVET-------------TELTVAGVAS-------KETSAETQGDAID-GTQAVSG
EF-GD----EFAEDSRPRRRGRRGGRGRRQPAQ-ANGHDA--------------------
---GEVAYTGPTPADPFGQQPLDVFDVM------------DGIEQPMIRDGKV--DQGSR
SERHPDLV------------P-EPVVVSEEQAEPYI-APPIQPVVI--------------
EDTAPR------------------------------------------------------
------------------------------------------------ARRGW----WKR
------------------------------
>gi|126461575|ref|YP_001042689.1|	   890 residues, 50 /line  ribonuclease, Rne/Rng family [Rhodobacter sphaeroides ATCC 17029]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------M------------------------
---AKKMLIDATHPEETRVVVVDGNKVEEFDFETVNKRQLAGNIYLAKVTRVEPSLQAAF
VDYGGNRHGFLAFAEIHPDYYQ-----------------IPVADRKALL----EEERAYA
RAEDDED--------------------------------------------------HGR
SRRRSRP-----------------------------------------------------
-----APAAAASGDAVQSGDVAGMDVV----DLGEET----GADALYE--TDG----SDA
GAADSGQPEAPDADEK----PYRAMDHASDGDDEIESVADEDVA--EEIPAPRKPR-SRR
Y-K--IQEVIKVRQIMLVQVVKEERGNKGAALTTYLSLAGRYCVLMPNTARGGGISRKIT
QAA-DRKKLKEIASELEVPEGAGLIIRTAGAKRTKQEIRRDYEYLLRLWEQIRDLTLK--
--------SVAPAPIYEEGDLIKRTIRDLFNREIEEVLVEGETGYRTAKDFMRMIMPAHA
RQVIRY----DEP-----MPLFARYQVESYLSGMFNPVVQLKSGGYIVIGVTEALVAIDV
NSGRAT--KEGSIEETALKTNLEAAEEVARQLRLRDLAGLIVIDFIDMEERKNNAAVEKR
LKDKLKTDRARIQVGRISGFGLMEMSRQRLRPGMLESTTQPCAHCHGTGLIRSDDSLALQ
VLRQLEEEGTR----------KRSKEVLLRAPIAVVNFLMNSKREHIAMIEARYGMAVRV
EADPSLSSPDYVIEKFKTATRV---VPEAVKVISGSAD------------LMGAPVD---
-----EPEDDWVEEE-----------------------------PEI--VE---------
-----------------EAE-EVAEAAEAAPA----------------------------
-------------------------------EGQPKKKRRRRRRRRNG---VNGANGSDA
QE--NGDEG-----------------------------------DESDEDEGDAADEPEA
VEAAAAV---------------PELAPEAVVSAP-----EPAAAEPEPTPAE-PVAAP--
---AA----EEPAAPRKRTRTRKPKVTEEAPAE-AAA----EAPA---------------
---AEAPAKEPKKP-RTRTSRSRKTAAA------------A-EAVPAVEVAVT--VDETP
AEASLEIA-RTTEAVPETTPE-APAAEAPAAEAPVAETPAPQPEPVAEEA-------GEG
EDNKPKRR----------------------------------------------------
---------------------------------------------------GW----WSI
GR----------------------------
>gi|146276768|ref|YP_001166927.1|	   869 residues, 50 /line  ribonuclease, Rne/Rng family [Rhodobacter sphaeroides ATCC 17025]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------M------------------------
---AKKMLIDATHPEETRVVVVDGNKVEEFDFETVNKRQLAGNIYLAKVTRVEPSLQAAF
VDYGGNRHGFLAFAEIHPDYYQ-----------------IPVADRKALI----EEERAYA
RAEEDED--------------------------------------------------HGR
SRRRSRP-----------------------------------------------------
-----APAEAPSADAVQSGDVGGMDVV----DLGEET----GADALYE--TER----GEA
------RPEADEA-EK----PWKAVDHAAETDDEIESVADEDVA--EEIPAPRKPR-QRR
Y-K--IQEVIKVRQIMLVQVVKEERGNKGAALTTYLSLAGRYCVLMPNTARGGGISRKIT
QAA-DRKKLKEIASELEVPEGAGLIIRTAGAKRTKQEIRRDYEYLLRLWEQIRELTLK--
--------SVAPAPIYEEGDLIKRSIRDLFNREIEEVLVEGETGYRTAKDFMRMIMPAHA
RQVIRY----DEP-----MPLFARYQVESYLSGMFNPVVQLKSGGYIVIGVTEALVAIDV
NSGRAT--KEGSIEDTALKTNLEAAEEVARQLRLRDLAGLIVIDFIDMEERKNNAAVEKR
LKDKLKTDRARIQVGRISGFGLMEMSRQRLRPGMLESTTQPCAHCHGTGLIRSDDSLALQ
VLRQLEEEGTR----------KRSKEVLLRAPIAVVNFLMNQKREHIAMIEARYGMAVRV
EADPSLSSPDYVIEKFKTATRV---VPETVKVISGSAD------------LMGAPVD---
-----EPEDDWIEEE-----------------------------PEVEEAE---------
-----------------EAV-EAAEPAEAAPS----------------------------
-------------------------------EGQPKKKRRRRRRRRNG---ANGATDQTG
AEAAESDES-----------------------------------DDSDEDEDETADEGDV
PEPAAFV---------------PEMAPEAVIAEP--------AAEPV---AE-PVAEP--
EA-VA----EEPPAPRKRTRVRKPKVVEESAAA-PAE----AAP----------------
----EAEPKEPKKPSRSRTSRSRKSAAA------------AEEAAPAVEVAVT--VDEAP
AEAALDVV------------E-TPAEPAPAAPQPEA-APEPQPEPVSGET---------D
EESKPRRR----------------------------------------------------
---------------------------------------------------GW----WSI
SR----------------------------
>gi|77462682|ref|YP_352186.1|	   936 residues, 50 /line  Ribonuclease E [Rhodobacter sphaeroides 2.4.1]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------M------------------------
---AKKMLIDATHPEETRVVVVDGNKVEEFDFETVNKRQLAGNIYLAKVTRVEPSLQAAF
VDYGGNRHGFLAFAEIHPDYYQ-----------------IPVADRKALL----EEERAYA
RAEDDED--------------------------------------------------HGR
SRRRSRP-----------------------------------------------------
-----APAAAASGDAVQSGDVAGMDVV----DLGEET----GADALYE--TDG----SDA
GAADSGQPEAPDADEK----PYRAMDHASDGDDEIESVADEDVA--EEIPAPRKPR-SRR
Y-K--IQEVIKVRQIMLVQVVKEERGNKGAALTTYLSLAGRYCVLMPNTARGGGISRKIT
QAA-DRKKLKEIASELEVPEGAGLIIRTAGAKRTKQEIRRDYEYLLRLWEQIRDLTLK--
--------SVAPAPIYEEGDLIKRTIRDLFNREIEEVLVEGETGYRTAKDFMRMIMPAHA
RQVIRY----DEP-----MPLFARYQVESYLSGMFNPVVQLKSGGYIVIGVTEALVAIDV
NSGRAT--KEGSIEETALKTNLEAAEEVARQLRLRDLAGLIVIDFIDMEERKNNAAVEKR
LKDKLKTDRARIQVGRISGFGLMEMSRQRLRPGMLESTTQPCAHCHGTGLIRSDDSLALQ
VLRQLEEEGTR----------KRSKEVLLRAPIAVVNFLMNSKREHIAMIEARYGMAVRV
EADPSLSSPDYVIEKFKTATRV---VPEAVKVISGSAD------------LMGAPVD---
-----EPEDDWVEEE-----------------------------PEI--VE---------
-----------------EAE-EVADAAEAAPS----------------------------
-------------------------------EGQPKKKRRRRRRRRNG---VNGANGSDA
QE--NGDEG-----------------------------------DESDEDEGDAADEPEA
VEAAAAV---------------PELAPEAVVSAP-----EPAAAEPEPTPAD-PVAAP--
---AA----EEPAAPRKRTRTRKPKVTEEAPAE-AAAEAPAEAPA---------------
---AEAPAKEAKKP-RTRTSRSRKTAAA------------A-EAVPAVEVAVT--VDETP
AEASLEIA-RTTEAAPETTPR---------RPPPKP-PPPKRLWPKRLRR---------S
PSRWPRRRARARTTSPSAAAGGRSAADLQRLT----------------------------
-------------------QGRL---RAPLFVPAGA-----------DGRLAR----WPT
ARAGGIPGLRDLR-----------------
>gi|115380147|ref|ZP_01467180.1|	   905 residues, 50 /line  ribonuclease G [Stigmatella aurantiaca DW4/3-1]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---MGSILVINAAGRETRVALVEGGHIAEFYLERKKDKGVVGNIYKGRVVRVLPGMQAAF
VDIGLEKAAFLYVSDVVYDPDFARAQFELTEGEHEDFPEVPTESEAEAA----EAAAGDT
PAGPDTELELEVQELAPGELPPPQGEPPALPPEAVATVAPIVEGASPAPETPPADAPPAE
AAAPAAELGVTAVESTQIVAASTGPVTPPPPPAAAFETAEAAPSAPPEAAPSETAPSEAA
PAEAAPVEPSPGAE-PPQAL-QAEPPPASATALGE--LIPVPSAPAESPAPAARAPVATT
GERRTPREGREAREPRHRE---KDRDGRDKDKSRRPR--EEHSR---REKDEKSKV-RKS
S-R--IEDLLKVGQEVVVQISKDPIGTKGARLTSHISIPGRHLVFMPTVDHV-GISRRI-
SNEKERKRLREIVDRLR-PPGTGFIVRTVAENVPQEKLETDIRFLIEVWNQVVRRNEK--
--------RGGPGLLHPDLDLILRATRDLFAHDVEKLVVDDREEYERILAFVTAQDPLLK
DRVVLH----EGD-----EPVFDAYGIEQEMHRATQRKVWLKSGGYLIIDQAEALTAIDV
NSGRYV--GKKSLEETITKINVEAAKEIVYQLRLRNIGGIIICDFIDMEKAQNRDKVFKS
LQEALGRDKAKTNVLRISELGLVEMTRKRVRESIGRVLHEDCPYCDGRGFVKTATTVTYE
IFREIRREAPG----------YKDSTLVINCSAEVARQLQGEERQELRHLMDRYNKSIQV
KAQQNYHREQYDIYGR--------------------------------------------
-------------------S---GMGPEHK--------VAS---------SPGSGDGE--
------------------------LAMQRRPE----------------------------
-------------------------------NGGHGERYRQEQGRRGGG--RGDRNERGD
RGERGDRNERGDRGERGG------------------------------------------
--------------------GERGGGERGGGERG-----DRGERGERNDRGD-RREGRRP
DRGDR----NRGGERRGDERR---------------------------------------
-----------------------------------------------------GGESQRP
PQAAATPEP---------------------------------------------------
-----------------------------SSSAGGTPPP---------------------
----------------PPS---------------ST-----------GGSSGS----EGN
GQS---------------------------
>gi|119025257|ref|YP_909102.1|	   937 residues, 50 /line  ribonuclease G [Bifidobacterium adolescentis ATCC 15703]
MPRSVVPTTN-EGLDQVEAVVSSDNSTNNAASSAGSVSADPAPRRRRGGRRVVRGVGAAG
ASLELKVEEHAKAPLFEEPKLEPVQPARDSADFNDADDAEPSRPRRRRVTRYDDDDEMRD
ERPRRRRRSSVDVQD----------------EDDRPSRRRRRISDEPRDDRDDRDDYG--
----------NRGNRDESSEDRALDAVSALPEGHETRHNPRPMTSLLFQEPILPAAP--A
GRGSSDDDDADDTGRRGSDDARDSRDDRDDDRPTRRRRRRSHDTADTDRTDASNDGRGRD
DGNDRNNDAEDDDHGDSRRSRRSRRLNAQERRAAAEVEQIEEDLVLDGITYAPIDDESRN
GNDDDDEQPTRTRRRRRGRGNHEEADEQQTSERESRRRHEDDDEEEGTVTRRRRRRRGGS
KAEESDETMSRRSRKQQYIDEITDVEGSTRLEAKKQRRRDNRRERSRQNQLMEQDFLARR
EH-VERLMVVRERERHTQISVIEDNVLVEHYVSDIQEVATVGNIYLGRVQNVLPSMEAAF
VDIGQARNGVLYAGEVNWDSAR--------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------------------------------------------------------L-EGQ
PRR--IELAFKSGDPVLVQVTKDPIGHKGARLTSQVTLAGRFLVLVPSGGMT-GVSRKL-
SER-ERARLKNIVSKI-APKDMGVIIRTAAEGASEEAITKDLENLVRQWERITAKRDE--
-----FLHGKRPKLLQGEPDVAIRVVRDIFNDDFSKMIVEGDRVYERIEEYLDTMAPDLK
DKLEKWDPAEHDG-----KDVFDKWQIDSQLRKGMERQVYLPSGGSIVIDRTEAMTTIDV
NTGRFI-GRGKSLEETVTRCNLEAAEEIARQLRLRDIGGMVMIDFVDMVMPANRDLVLRR
LVECLARDRTKHQVAEVTSLGLVQMTRKRIGQGLVEAFSEECPTCKGRGFILHDEPTVS-
---------------ADYDDPYAL--------KGGDPFVKTNKHGH--------------
--------GTDVQVPKGSSPDVKAKLAQ--IAAAAVAA------------NNADLG----
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------------EEEQEE----------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------
>gi|145618243|ref|ZP_01774303.1|	   919 residues, 50 /line  ribonuclease, Rne/Rng family [Geobacter bemidjiensis Bem]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------M------------------------
---SKKMLINALHPEEARVAIVEDGRLVDLDVEIAGNEQIRGNIYKGVVVRVEQGLQAAF
VDIGLKKLGFLQMGELHPENWKWR------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------------------DDIPE-DQR-HRR
P-R--IQEVLRRGQELIVQVEKGERDNKGSALTTYVSLPGRYMVLMPGSDSA-GISRKV-
EGEGERKKLKEIIAEMAIPEGYGYIIRTEAMGRTREELQKDLDNLIATYQGIRSKGLA--
--------MKGAGMIYQESALIIRTIRDYFSADIDEVLVDSKDVYNDVRDCLKEIDPAFE
KLVKMH----QEK-----RPIFSRYQLEEQIDLIYEKKVPLKSGGSIFIEPTEALVSIDV
NSGKST--GEKGVEDTAFKTNLEAAEEAARQLRLRDLGGLIVIDFIDMRDRKHNSEVEKT
LKTALKADKARVNVSRISEFGLLEMSRQRIRQTLNQASTLECPHCDGRGKVKSVEAMALS
FLRKVHAAAAK----------GTIGEVVGGLPLEVAYYLLNRKRHELSQIESDYDIEVTV
KGKPSYLLNQMDLELIKREKAADELPLE--KPAHGRAL------------PKEEAAQ---
-----EPAAEGRKKKKKGKK---AQEPEAA--------AHVEALPVAVVEEPTGAELV--
------------------------VTVEGEPE----------------------------
-------------------------------EH--KKKRRRKRKRGKGG--AAEAGAEAA
ASQSVEAEVELPAAEPGTLPAPGPVTEQAAAAEGEQLQ------HEAGEEVKKKRRRKRR
RGKGGHEAQL--------HESAAEFPPQLEAFAA-----AGAIPVQEVTPVI-TASAVSA
EPGAA----AKKGRKRGKARAEEPAVSAGAAQV-EAITVPAEVIE---------------
---SAQPAAKPKRP---RGGRKVKEAAA------------E-QGAPAVVAAAPGGAPEAP
AGAAAPAEPAKAKRKPRGAKAAKGAEATPV-----PEAGEAKAAPAGKKAPAA----VTE
GTEAPAKAKGKSTKGKSAEAP-KAKKEQEAATAAPEPPP---------------------
----------------APAQDKA---PAKARAPRAS-----------RKKEAP----EGT
GQAPAAPVEEKPKKPRAPRKKKEEAPA--E
>gi|50725997|dbj|BAD33523.1|	   898 residues, 50 /line  putative endoribonuclease E [Oryza sativa (japonica cultivar-group)]
MAARALGPPPPHAL----------GATRQAPRCPHAAAADASAPPTHGYR---RGAAALG
SALSARRGRHT---LCSVQLMDALRGGNLQVEPNILHSPKPLMSTRR-----DDSAITCK
GFCTISWNLKSDVLDGYIIFVTGDPVTLGCWESDMAVQLSPSVESNNLWTAEIKVPYGVH
FKYNYFVREENDASSDIIWRPGPEYSLSIPPVGRKKHVIVVKDLWMKTSVAGIPTPS--W
GSWLMEANFLEDQFAKSGEHQNIVKAHSVIDTVDRASSVGEHIIL---RLGNGTPLHVKN
ISENPSASVHDDFTVTDKANSIKSSISEHERN-----QPVEEPWIL--------------
-------GSVMAAKKSVAAGKHEKNRWKFVNKKQNLSEVSENIPEQ------------DQ
PVEEPWLFQSKVVAKKPV------VQTKGKIEAKDIIRK--LRKMDKPPAPLEEDKATSG
EPSSRVIVINSSVCTMQRIAVLEDGKLVELLLEPIKNNVQCDSIYLGIVTKLVPHMGGAF
VDIGLSRPSLMSIKQNRDPFVYPQIVKNAK-RDSANFS----------------------
---------------------------------------------------DYNDDSLP-
TYEDEDD-----------------------------------------------------
-----DMTDGELAD-EENDD-ESSAFPAEVVSENEEHMAFLPNSKINMIHSAEFESISSY
DEEKDDEIDDHMEDEYNEDLLPGDQSEVSNDLKTLSS----------IQHAL-RES-SDD
T-NGSRWSQVRKGTKIMVQVVKEGLGSKGPTLSPFPCLRSRFWILVSRGNKV-GVSKKI-
TGI-ERTRLKGITKLLR-PPGFTLTARTVAAGHSWEELQKDLDRLLSTWKGIIEHAQSAA
LAAEEGVEGAVPVMLHRSKGQALSVVQDDFNEKVKRLVVDSPRTYHEVTNYLQEVAPELC
NRVDLY----EKR-----TPIFDEYKIEKEIDNILCKRVPLHNGGSLVIEQTEALVSIDV
NGGHSMFGQGTSQEKAILEVNLEAAKQVC-------------------------------
------------------------------------------------------------
------------------------PMFCFVLESSIFAF----------------------
-------------KPY----------------FSLLI-----------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------
>gi|100060889|ref|ZP_01322858.1|	   968 residues, 50 /line  hypothetical protein BpseP_03003293 [Burkholderia pseudomallei Pasteur]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------MLFNATQQEELRVAIVDGQKLIDIDIETAGREQRKGNIYKGVVTRIEPSLEACF
VNYGEDRHGFLPFKEVARQYFKEG------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------VDM-RS
A-R--IQDALREGQELIVQVEKEERGNKGAALTTFISLAGRYLVLMPNNPRGGGVSRRI-
EGD-ERQELRETMAQLQIPDGMSMIARTAGIGRSAEELQWDLNYLLQLWRAIEAASQS--
------GHPGQPMLIYLESSLVIRAIRDYFQPDIGEILIDTTEIHDQARAFMDIVMPDNV
GKVKRY----HDD-----VPLFSRFQIEHQIETAYSRTVPLPSGGAIVIDHTEALVAIDV
NSARAT--KGADIEETATRTNLEAADEVARQLRLRDLGGLIVIDFIDMESAKSQREVEQR
LKDALKHDRARVQMGKISRFGLMELSRQRLRPALSEGSHVTCPRCNGTGHIRDTESSALQ
VLRIIQEEAMK----------ENTAAIHCQVPVEVTAFLLNEKRQEINKIESRFKVGVVL
IPNKHLDTPHYKLERLRHDDARLD----DPRASWKMAEEAAR--ELEAE------TGY--
-SKRAEETKPRQEAAVKGIT---PERPAPSPA-PQRQSAPEAAAPVAAA-PASGGGFMKW
LK----GLFGAQPAAVPAPA-PAAQETAARPARERAERGERGEKAERGERGGDRNR--H-
RRGGAAQQAGGRDQAAAGGGRAQAPR--AEREGKETREPREGREARGGRDNREGREARET
REAREPREQ----------------REPREAREQREARERAETVDAAEAPRGERRERGER
RKPAPHVATL--------ETVNRGESAHAETAEK-----PLYAPGAEAGVDAD-SNARDG
EERRR-RRRGRRG--GRREREDEVA--GAVQAA-EGSEGVTAEA----------------
---EALEHAEHAQQRV----------------------APVANQAPEHAAQAG--AGVAA
AAAATVAAEAIAH-VESGA--------------KVEPQPAAEASAGDTE----------Q
AEAVPARSIEAPAQAASTGQA------EAVQAAPAAPAHVTPA------T-ADVAREPAA
PAETA-----SAETTPAEIPPAE---AAPAEAPA-----------AEASEVA----ASAV
ASAPAPAA---------------------E
>gi|114331691|ref|YP_747913.1|	   849 residues, 50 /line  ribonuclease, Rne/Rng family protein [Nitrosomonas eutropha C91]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---MKRMLFNATQPEELRVAIVDGQKLIDIDIETLGKEQRKSNIYKAAVTRLEPSLEAAF
VDYGAGRHGFLPYKEIAPTCFDKN------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------TER-SS
H-R--IGELLREGQELIVQVDKDERGNKGAALTTYISLAGRYLVLMPNNPQGGGISRRV-
SAE-ERAELREVINHLQVPDGMSIIARTAGIGRNEEELQWDLNYLVQLWRAIEGAASS--
--------ERGVFLIYQESSLVIRAIRDYFHAEIGEILIDNPEIYEQAYQFMANVMPANV
DRLKLY----QDD-----IPLFSRFQIEHQIETAYSRQVTLPSGGSIVIDHTEALVSIDV
NSARAI--RGSDIENTALNTNLEAADEIARQLRLRDLGGLVVVDFIDMEVTRNQREVETN
LLKALRLDRARVQIGKISRFGLLELSRQRLRPSLGEGNYIPCPRCHGTGHIRGTDSSALH
ILRIIQEEAMK----------EQTSMLQVQLPVDVATFLLNEKRSEIYRLEARLKVGIIL
IPNIYMETPNYTINRLRHEDVKST----ELPPSYGMVEKTTE--EI---------TLP--
-STSQELKAIRPKAAVTGIK---PEQPAPVPE-EK---------------PREQLSFLDK
FF----SLFRPASSSRVEPE-QTAEESQARPLR--SERGRNRRDRGRNKRTKNNIP--GT
TASETLQEAG-------NLPSLEQS----TGHPVES------------------------
----------------------------------------------------------TS
NDDHHHKASR--------QGQDQLQESGAESNLP-----DATTTGEGTTPAGD-SVSERK
TDRRG-RSRRRRG--GLHRDREERT--DANKTTEQGEVTQITSS----------------
---ENNEPVVPSADGKED--------------------RELSFLPPTEPTQHI--TSIA-
-----------------------------------SVDDITAE-----------------
QEVASAKVIEP--INTDAESN------TGSQAASE--SRQPIE------L-PDLTQSGLV
MIETA-----PDKI--AEVPEEA---LAPVKRPR-----------IRPSYLAE---PDTT
SSEPLVQIETR------------------D
>gi|30249428|ref|NP_841498.1|	   853 residues, 50 /line  Ribonuclease G and E [Nitrosomonas europaea ATCC 19718]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---MKRMLFNATQPEELRVAIVDGQKLIDIDIETLGKEQRKSNIYKAAVTRLEPSLEAAF
VDYGAGRHGFLPYKEIAPTCFDRN------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------TDW-SG
H-R--VADLLREGQELIVQVDKDERGNKGAALTTYISLAGRYLVLMPNNPQGGGISRRV-
SAE-ERAELREVINNLQVPEGMSIIARTAGIGRNEEELQWDLNYLVQLWRAIEEAASN--
--------EKGVFLIYQESSLVIRAIRDYFHAEIGEILIDNPEIYEQAYQFMANVMPANV
DRLKLY----QDD-----IPLFSRFQIEHQIETAYSRQVTLPSGGSIVIDHTEALVSIDV
NSARAI--RGSDIETTALNTNLEAADEIARQLRLRDLGGLVVVDFIDMEVTRNQREVESS
LLKALRLDRARVQIGKISRFGLLELSRQRLRPSLGEGNYIPCPRCHGTGHIRGTDSSALH
ILRIIQEEAMK----------EQTSMLQVQLPVDVATFLLNEKRSEIYRLEARLKVGIIL
IPNIYMETPNYTITRLRHEDIKST----ELPPSYEMVEKTSE--EV---------TLP--
-SISQETRATRPKAAVTGIK---PEQPAPVPE-EK---------------PREQLSFLDK
FF----SLFRPAGSNRTETD-QAAEESQTKPSR--GERSRNRRDRGRSKRTKTSTQ---V
TANGSLQEAG-------HSSLLDHPV--VVEHPVTDRA----------------------
----------------------------------------------------------TD
NDRQHRKNGR--------QNPPQKLE--VASDQL-----DVSTTPADTAATAD-STSERK
TEKRG-RSRRRRG--SLHRDREDQI--NLNTATGQDEVIPIGEN----------------
---ETVEPVVSSDDDSKD--------------------TENILLLPVEPVGD---TSST-
-----------------------------------PTNDIIEN-----------------
QVTASAEIIETETIHTRGEPD------SEYQVTVEPHPHQTIE------L-PDLAQSGLI
MIETA-----PDKI--SETEEVP---PAPSRRPR-----------SRPRRSVE---PAAD
NAEPLVQVETR------------------D
>gi|145588576|ref|YP_001155173.1|	   879 residues, 50 /line  ribonuclease, Rne/Rng family [Polynucleobacter sp. QLW-P1DMWA-1]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---MKRMLFNATQQEELRVAIVDGQKLIDIDIEAAGREQRKGNIYKGVITRIEPSLEACF
VNYGEERHGFLPFKEVARTYFKEG------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------IDV-RN
A-S--IKDALREGQEIIVQVEKEERGQKGAALTSFVSLAGRYLVLMPNNPRGGGVSRRI-
EGE-DRQELREAMSQLEVPEGMSIIARTAGIGRDATELQWDLSYLMQLWKAIDEAAKG--
--------NSAPLLIYLESSLVIRAIRDYFQPDIGEILIDTDDIYEQAAAFMSVVMPDNL
PRVKRY----HDD-----VPLFSRFQIEHQIETAYSRTVPLPSGGAIVIDHTEALVSVDV
NSARAT--RGSDIEETATRTNLEAADEIARQARLRDLGGLIVIDFIDMESSKAQKDVENR
LRDALRHDRARVQMGKISKFGLMEMSRQRLRPALSEGSHVTCPRCNGTGHIRDTESSALQ
VLRIIQEEAMK----------ENTAAIHTQVPVEVAAFLLNEKRAEVIKIETRFKVNVLM
VPNKHLETPHYKLERLRHDDPRLD----DQKASYVMAEEAAR--ELETD------TTV--
-SRKDAELKVRPEAAVKGIT---PAQPAPISQ-PRPARTE------KTT-TESSGGLFGF
IK----KLFSSSPAVEEKP----------APSNTRGRNQG--RNGDRNNRNGNRGR--RG
DRNERN------------------------------------------------------
-------SE----------------RAERPAAAAAEGPASTPAEGTNNRTRNNRTR----
NNQNGPKPER--------QEGNRNQANPAAVTPA-----TEAAPGTDATPGV------EG
EERRG-RGRNRRGRGRGQRERGERT--EGGTDASPAVVASSASP----------------
---FAGPPVGMA-GASAS--------------------MPIQNITNSFSNAK------PV
AEKQERAPRAPRQSNRSAP--------------SSTPVAIPVAVVAAKA----------T
--------VEVITKPAPELPK------VAFQALEETPLHS------------VVQSAGMI
WVATD-----SSKH--AEAQSQ-----IKAEPVA-----------SNLGRTPK--PAAAL
PDGPMVLVETGG-----------QEKT--V
>gi|74317582|ref|YP_315322.1|	   873 residues, 50 /line  ribonuclease E and G [Thiobacillus denitrificans ATCC 25259]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---MKRMLFNATQAEELRVAIVDGQKLVDLDIESASKEQRKGNIYKGVVTRVEPSLEAAF
VDYGCERHGFLPFKEIARSCLPNG------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
G-R--VPENLKEGQELLVQVEKDERGNKGAALTTYVSLAGRYVVLMPTNPRGGGVSRRI-
EGE-ERNELRDTLAQLDIPEGMSLIARTAGIGRTAEEFQWDLNYLLSLWKAIDGASTS--
--------MSGAFLIYQEGSLVIRAIRDYFSADIGEILIDTEDIYEQAQQFMAHVMPANV
NKVKLY----RDD-----VPLFSRFQIEHQIESAFSRQVNLPSGGAIVIDHTEALVSIDV
NSARAT--KGSDVEQTAYNTNLEAADEVARQMRLRDLGGLIVIDFIDMENPKHQREVENR
LRDALHHDRARVQTGKISRFGLLEMSRQRLQPSLGETSYNPCPRCHGTGHIRGTESSALH
ILRILQEEAMK----------ENTGAVHVQLPVDVATFLLNEKRPDIHTVESRLKVNVVL
IPNIHMETPHYTITRLRHDELNVA---GAAEPSYKMALVPET--E----------AIY--
-QTAQAAAPLRQEAAVKSIP---PPQPTVAPR-P------VVPAS-----EPAPAGLFDR
IF----GWFKKRGDETHA-P-EAAPAAEAVPAIVRSERPSERRERERKP--GQRRG--R-
------------------------------------------------GEGREGREGRN-
--------G----------------EGRNGEARQGESR---QTEPRQPEVREPRAE----
-QAKPPRPPR--------QPKPRPE---AEVAPR-----AATAPVAE-----E-PAGEEK
REPRSRRGRGRRGRGEGRSEAAANG--SATPRAVIEIAGYRAVI----------------
---ELARPARPAPAAA----------------------------APVAAAAEP--AAAPA
PSQQALQLDAPTPATKPAPGAV-----------TASPAEILAA-----------------
LAAGEAELQQVETRSAAAAAA------DGSEPSRPRRRRRPSV------K-ADAEPVSLM
QVETS-----A----PIEVPVDA---PAPAAGPH-----------PTRRRPRP---QPSA
PQEPLVQVETQA-----------------K
>gi|91775674|ref|YP_545430.1|	   904 residues, 50 /line  ribonuclease, Rne/Rng family [Methylobacillus flagellatus KT]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---MKRMLFNATQSEELRVAIVDGQKLIDLDIESAGKEQRKSNIYKGVITRIEPSLEAAF
VNYGTDRHGFLPFKEIARSYFLND------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------SDAGRS
P-R--IQDVLKEGQELIVQVDKDERGNKGAALTTFVSLAGRYLVLMPNNPRGGGVSRRI-
EGE-ERNELRDTMAQLQVPSGMSIIARTAGIGRSVEELQWDLNYLLQLWTAVESASTI--
--------QSGPFLIYQEGSLVIRAIRDYFQPDIGEILIDTPDIYEQAVQFMNHVMPNNV
SRVKLY----RDE-----IPLFSRFQIEHQIESAFAREVRLPSGGAIVIDHTEALVSVDV
NSGRST--KGSDIEQTAFNTNLEAADEVARQLRLRDLGGLVVIDFIDMENQRNQREVENR
LREALHHDRARVQTGKISRFGLLELSRQRLRPSLGESNHIPCPRCHGTGHIRGIESTALH
ILRITQEEAMK----------ENSAIIQVQLPVEAATFLLNEKRSEIHKIEQRMGVQVVL
IPNIHMETPNYNILRIRHDDVE-----ETGRASYEMVELPSE--TLE----------T--
-ALAQEPKPAKAEAAVKGIT---PASPAPAAA-R--------EKE-----KPSSTSLLHR
FK----SWLASVAAPKPEVK-PQEETQQR-DSNRNPRRNNRRNERSASERTGNDR----Q
MQNEQRQEQR--------------------------KEQRSQQERR--------------
-----------------------------------------------PQQAEQRAAQ---
--GRQERAER--------PERNERQP---KVQQP-----QPTPSLQSETPI-E-ANSEQR
GNRRGRNGRRERQPRSDNANRENRQ--QAAEELHAAAAAPIASV----------------
---EAAERPVEAKTAPTT--------------------PEAAPITQVKENTE----TVHT
ATEAAPQKEAPAPAIRKDVVVTEESLPAIDATAVKETRTKEEKSAHLSE----------P
LAESPADTKQEKPLEALADEAPTEAAKPEKKPRAPRRRKVEAE------KPADLMDSGLQ
LVETK-----AEAI--QAVIAVE---EAPAPRAP-----------RKPAAWQQKAAKEAA
VSEELVMVETQ------------------K
>gi|113460860|ref|YP_718927.1|	   942 residues, 50 /line  ribonuclease E [Haemophilus somnus 129PT]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---MKRMLINATQKEELRVALVDGQRLFDLDIENPGHEQKKANIYKGRITRVEPSLEAAF
VDYGVERHGFLPLKEIAREYFPDD------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------------------------YVY-QGR
P-N--IRDILSEGQEVIVQVNKEERGNKGAALTTFVSLAGSYLVIMPNNPRAGGISRRI-
EGD-ERLELKEALSSLDVPEGVGLIVRTAGVGKSPEELQWDLKVLLHHWEAIKQASQS--
--------RPAPFLIHQESDVIVRAIRDYLRRDIGEILIDSPKVYEKAKAHIKLVRPDFI
NRVKLY----QGE-----VPLFSHYQIESQIESAFQREVRLPSGGSIVIDATEALTAIDI
NSARST--RGGDIEETALNTNLEAADEIARQLRLRDLGGLIVIDFIDMTPVRHQREVENR
MREAVRQDRARIQISRISRFGLLEMSRQRLSPSLGESSHHVCPRCQGTGKIRDNESLSLS
ILRLLEEEALK----------ENTKQVHTIVPVQIASYLLNEKRKAIHSIEKRHNVDIVV
APNEAMETPHFSVFRVREGEEINE-------LSYNLAKLHEMNDET---YVVEDAFISRH
LENSAATVESAVENAAVSLA---IETPAPMPQ-ERKQ---------------ERESLLRR
IIEGIKNLFADNSSK------------NKKNKNTRQNKN--------A-RHNRRNQDRRS
SRRIRQEHE-IK------SDENNKLDTQH----SHYT------ERYSKHAKKGVDDPQ--
-----------------------IQTKKAGELEIHTKDDETI---ETIQ---PRRQRRDL
RKKVRVEENL-VDTP---NLGSTEEHVENE--K-TTEPVTSLEQAVLQTENEK---THER
QDNNYRHRRLPRHLRV-NNQRRRRNVELKSAMPLF---AAVASP------------ELAS
GKVWVDVNVVN--SKNNNFLSVDELLKQQYQQE---------EIEVVIPASEI--LMDTQ
SDDIKPLSNFVSQPANEAVEKKVQETL-QRLT----------------------------
-Q----EV-VDE-SSTIERTE-----V-----DTNIS--VPE------FVREYQFNGRLG
TISAVMHTKAEMTL--AKSSDEPM---QPFSIVEWQ-DSRYYFYGRGAA--------GHH
CAISHVYSEPA------------NTKI--E
>gi|68249015|ref|YP_248127.1|	   951 residues, 50 /line  ribonuclease E [Haemophilus influenzae 86-028NP]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------MRFILRFFKYLIRELT------------------------
---MKRMLINATQKEELRVALVDGQRLFDLDIESPGHEQKKANIYKGKITRVEPSLEAAF
VDYGAERHGFLPLKEIAREYFPDD------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------------------------YVF-QGR
P-N--IRDILTEGQEVIVQVNKEERGNKGAALTTFVSLAGSYLVLMPNNPRAGGISRRI-
EGD-ERTELKEALSSLDVPEGVGLIVRTAGVGKSPEELQWDLKVLLHHWEAIKQASQS--
--------RPAPFLIHQESDVIVRAIRDYLRRDIGEILIDSPKIFEKAKEHIKLVRPDFI
NRVKLY----QGE-----VPLFSHYQIESQIESAFQREVRLPSGGSIVIDVTEALTAIDI
NSARST--RGGDIEETALNTNLEAADEIARQLRLRDLGGLVVIDFIDMTPIRHQREVENR
IRDAVRPDRARIQISRISRFGLLEMSRQRLSPSLGESSHHICPRCQGTGKVRDNESLSLS
ILRLLEEEALK----------ENTKQVHTIVPVQIASYLLNEKRKAISNIEKRHNVDIIV
APNEAMETPHFSVFRLRDGEEVNE-------LSYNLAKIHCAQDEN-----TEESLLSRN
VETTAVIEQPAVESAVVALS---ISEAAPTPV-ERKS---------------NEPSLLAK
IIAKIKGLFATKSE-------------ENKPKNNRTSRNP-------N-RNQRRSQDRRS
SRRPRSE-----------NNETERTEEQV----RNVR------ERNQRRPRRNLVEES--
-----------------------IAESAVNSTPVFEAKEERT---EPVT---QRRQRRDL
RKRVRVEDNE-TVVE---NN---------F--S-TTEKMPEVDVITVQNNDEKPVHQNQR
SERQERQRRTPRHLRAANNQRRRRNQEPKSPMPLF---AAVVSP------------ELAS
GKAWIDYSTVNL-PKENHFLSVDELLEQEKTKK---------GF--ITPAMGI--VVEEK
SPDVKPALDFITQPANESVQKKVQESL-DRLS----------------------------
-SYKPQEV-VESIDPAINVDE-----P-----ETLEK--VSK------FVRTYEFNGRLG
TISSVPHTKAEMTL--AKANDEMP---EAFPIRAWQ-DSRYYFYGKGAA--------GHH
CAISHVYSEPT------------RAKS--E
>gi|126511000|gb|EAZ73594.1|	   963 residues, 50 /line  ribonuclease E [Vibrio cholerae NCTC 8457]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---MKRMLINATQKEELRVALVDGQRLFDLDIESPGHESKKANIYKGRITRIEPSLEAAF
VDYGAERHGFLPLKEIAREYFPDG------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------------------------YSY-QGR
P-N--IKDVLNEGQEVIVQIEKEERGSKGAALTTFISLAGSYLVLMPNNPRAGGISRRI-
EGD-ERTELKSALSSLELPQGMGLIVRTAGVGKSAEELEWDLNVLLKHWSAIKQASDS--
--------NPAPFLIHQESNVIVRAIRDYLRRDIGEILIDSNSIYERALEHIRLVRPDFV
NRVKKY----EGE-----VPLFSHFQIESQIESAFQREVRLPSGGSIVIDPTEALTSIDI
NSARAT--KGGDIEETALNTNLEAADEIARQLRLRDLGGLVVIDFIDMTPVRHQREVENR
LREAVRVDRARVQIGRISRFGLLEMSRQRLSPSLAEASHHICPRCKGTGVIRDNESLALS
VLRLIEEEALK----------DNTSQVLAVVPVSIASYLLNEKRRSINHIEKAQQVRITI
VPNSDMETPHFEVIRVREGEEQDV-------LSYLIPKKLEAMKEAEGKEVVDVELKPKR
IEEPVLKGFAAPAEAVPAPTPKPKAEPQPVAE-VQQP---------------AQPGFFSR
VFKAIASLFSATPEAAKVEAPVTQNSEQDKPRRERNDRNNDRRRNPRD-KNRRRGNEENN
ERNDKETSN-SNRKPQERKPKQERGERNE----RNDRNERPETERPERQDRRNKRDESKT
AKLLEQGRQ--------------LAAEAQQEVKAVEPKEEKA---AVVK---ERRQRRKL
SKQIRVKDQL-AAEE---LDNLSTAPVDNAFDA-PAPVNLPVTDDFADSAQED---NEQD
DQKQRRNRRSPRHLRA-SGQRRRRGRD-RRPNPFRLRKGGVASP------------EMAM
GKVMPRYDLAPR-PQSRH-------ETAEGAQH---------VTHVTPTAATA--VVESE
KVAAPRVLGGVAFPEMAMGKVIVRR----ETA----------------------------
-AVQPEPV-VQ--EPVITDVI-----A-----ETLIAPVEPV------VVEATVIEAPVI
EESATETAALETVV--AKVAE-----------VEDE-RENYKLI----------------
-----------------------QKRK---
>gi|52425677|ref|YP_088814.1|	   960 residues, 50 /line  CafA protein [Mannheimia succiniciproducens MBEL55E]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---MKRMLINATQQEELRVALVDGQRLFDLDIESPGHEQKKANIYKGKITRVEPSLEAAF
VDYGAERHGFLPLKEIAREYFPDD------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------------------------YVY-QGR
P-N--IKDIIKEGQEVIVQVNKEERGNKGAALTTFVSLAGSYLVIMPNNPRAGGISRRI-
EGD-ERLELKDALSSLDVPEGVGLIVRTAGVGKSSEELQWDLKVLLHHWEAIKQASQS--
--------RPAPFLIHQESDVIVRAIRDYLRRDIGEILIDSPKVYEKAKAHIKLVRPDFI
SRIKLY----QGE-----VPLFSHYQIESQIESAFQREVRLPSGGSIVIDVTEALTAIDI
NSARST--RGGDIEETALNTNLEAADEIARQLRLRDLGGLIVIDFIDMTPVRHQREVENR
MREAVRQDRARIQISRISRFGLLEMSRQRISPSLGESSHHICPRCQGTGKVRDNESLSLS
ILRLLEEEALK----------ENTKQVHTVVPVNIASYLLNEKRKAIHDIEKRHNVEILV
VPNKEMETPHFSVFRVRDGEEINT-------LSYNLVKVYEEQETT---FIADEPFTTRV
TETAAVTTENVLESAALSMT---ISEPAPTIE-VKKE---------------EQPSLFVR
IVAAIKGLFASEPKVEEKVEE------APQP-NTRNRRNNQEHRN------SRRNRNERN
NRGNNEEPA-DKVQSEKS---AEKAERPA----RSERT------RRNNRNRNAAADDS--
-----------------------LNNESVIEAVTNETTDDEA---KAPQ---QRRQRRDL
RKRVRVTEEQ-VTV--------AAEPVDKPSLA---------ESVPVEPVVEE--NVYQE
RDRQDNRRRLPRHLRV-NNQRRRRNAEQVSAMPLF---AAVASP------------ELAS
GKVWIESPTAPAKPKESAFLSVDELLEQQSEVK-------QPGVTTPAPATQV--IFDKA
DNDIAPLASFVTQPANESVQKKVQESL-DRLE----------------------------
-QTNGQQTEVKEDDNASNMTL-----SDVTATESAVEKTEVL------NLSNYRFSGRLG
TISAVKHTKAEMTL--AKAADEVL---PPFEIVQWQ-DSRYYFHGKGSA--------GHN
SAVSHVFTAAT------------QAKA--E
>gi|75428521|ref|ZP_00731723.1|	   962 residues, 50 /line  ribonucleases G and E [Actinobacillus succinogenes 130Z]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---MKRMLINATQKEELRVALVDGQHLFDLDIESPGHEQKKANIYKGRITRVEPSLEAAF
VDYGAERHGFLPLKEIAREYFPAD------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------------------------YVY-NGR
P-N--IKDVIKEGQEVIVQVNKEERGNKGAALTTFVSLAGSYLVIMPNNPRAGGISRRI-
EGD-ERIELKEALSSLDVPEGVGLIVRTAGVGKSSEELQWDLKVLLHHWEAIKQVSEN--
--------RPAPFLIHQESDVIVRAIRDYLRRDIGEILVDSPKIYEKAKAHIKLVRPDFI
NRIKLY----QGE-----VPLFSHYQIESQIESAFQREVRLPSGGSIVIDATEALIAIDI
NSARST--RGGDIEETALNTNLEAADEIARQLRLRDLGGLVVIDFIDMTPVRHQREVENR
MREAVRQDRARIQISRISRFGLLEMSRQRLSPSLGESSSHICPRCQGTGKVRDNESLSLS
ILRLIEEEALK----------ENSKQVQCIVPVQIASYLLNEKRKAIRSIEKRHNVDIVV
APNEAMETPHFSVFRLRDGEEANV-------LSYHLPKLHEVQEDV---FVAEESLISRN
IETAAVTAENMAESAVLSMT---IPEAAPVIE-AKKE---------------AESSLFAR
IVAAIKKLFTTAPEAEKVEE---------QPVVTRNNRNNRRERN------NERNNERRN
SRRSRAERN-TARNNDTA---AEKPETPS----RNERSN----ERNNRRNA-------RR
AALTDETSA------------------NAGTAEAVETSEEKSPAPRQPR---ERRERRDL
RKKVRVSNET-V----------EQQAVEEVS--------AVAEETVTEQPSSE---SPRR
ERSERNSRRMPRHLRT-NNSRRRRNE--VSSMPLF---AAVASP------------ELAS
GKVWIDSNTTSQKTKESNFLSVDELLEQQTQND---------EVEVSTPASSI---VEKA
ENNAQPL-GLVSQPANEAVEKKVQESL-ERLNE---------------------------
-EQRVLEQQAKASSVAEAAVE-----KENVIPEKKVNEPEISVKNGQKFDRTYRFNGRLG
TISAVRHTKADMTL--AKADNEVN---VPFDIVEWK-DSRYYFHGKGSA--------GHH
SAISHVFSEPT------------KAEA--K
>gi|90021266|ref|YP_527093.1|	   968 residues, 50 /line  DNA polymerase III delta prime subunit [Saccharophagus degradans 2-40]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---MKRMLINATQPEELRVALVDGQWLYDLDIENRLREQKKANIYKGRITRVEPSLEAAF
VDYGSERHGFLPLKEISREYFAKQ------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------------------------PKDI-DGR
I-R--IQDVVKEGMEVIVQVDKEERGNKGAALTTFISLAGRYLVLMPNNPRAGGISRRI-
DGD-DRTELKDALSQIDVPAGMGIIVRTAGVGRRAEELQWDMNYLAQLWASIKTAAEE--
--------KTAPEFLFQESNVIIRAIRDYLRPDIGEVIVDNQDAYNLATAFVEQVMPNYR
SKVKLY----EEP-----LPLFNRFQIESQIETAFEREVKLPSGGSIVIDVTEALISIDI
NSSRAT--KGGDIEETALQTNLEAADEIARQLRLRDMGGLVVIDFIDMQPVRNQREVENR
MRDALEMDRARVQVGRISRFGLLEMSRQRLRPSLGETTSKVCPRCSGQGTIRGTKSIALS
ILRLVEEEAQK----------ERSAEIRAVVPVAVATYLLNEKRKVISGIEERQKTRIVI
IPSEKMTTPHFDVQRLRDDDVVSS---E---ISYKI-EVPQGEDEE---KIQDD------
----AAALAKLPRPAVQAIP---PAQPAPEAP-K-------------------PDSLLTK
ILKKLKELFKTDDKKRK---NTSKNSRGQQRRRGNNSQ-NNRNRN-RN-RNGRGNDNRNK
NRDDEITDNLSSRTKSDQ---SQQGQGPSSDDNRPDRGNRKRGNRRRNNNRRNDQDRNDS
PESNNDEQQ--------------NNNQPQEQNNA----PKEQGPNRRPN---GRRGRGGR
ERKREPVPQA-AEES--------VTKDDSALAAEVTSAIDTAEKAFATNS---PAELKQA
KSEAKEQAKSEAKEQAK-SEAKEQAKQERAPQ---EAAITAETP------------SEAK
QPEATATAAEAK-PEPSEKAKASQAPQA------------AEASDTTETVAET--KVEAP
SAEAAPAKEAPVETAAETASE--AETA-EPVAAAETAEVAEVA-----VAEATEEASEAK
EELAPAQAVRKQYSRATN---------DPRATPKPVANTLVSN-----VVTQIRMSRPLD
TTQPANILRNPRDL--SRPAND-----------PRL-KRNIEEV----------------
------------------------ASD--A
>gi|114773717|ref|ZP_01450745.1|	   968 residues, 50 /line  ribonuclease E [alpha proteobacterium HTCC2255]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---MKRMLINATQSEELRVALVDGQKLYDLDIESPGHEQKKANIYKGTITRVEPSLEAAF
VDYGADRHGFLPLKEIARHYFPKN------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------------------------YTF-EGR
P-N--IRDAVKEGQEVIIQIDKEERGQKGAALTTFISLAGSYLVLMPNNPRAGGISRRI-
EGD-ERSELKATLDQLELPKGMGLIVRTAGVGKSFEELAWDLKVLLTHWEAITAVAEE--
--------RPAPFLIHQESNVIVRAIRDYLRRDVGEIIIDKPAIFEQALQHIELVRPDFA
NRVKPY----TGD-----VPLFSHYQIESQIESAFQREVRLPSGGSIVIDPTEALTSIDI
NSARAT--KGGDIEETAFNTNLEAADEIARQLRLRDLGGLVVIDYIDMSVNKHQREVENR
MKDAVSGDRARIQLGRISRFGLLEMSRQRLRPSLGESAHNVCPRCAGTGTVRGTESLALS
VLRIIEEECIK----------DNTGQVEAQLPVDVATYILNEKRKALREMEERNKVEVLV
LPNPNLSTPNFQIERRRPEDKVSG-------ISYQL-ELAESNEQI--------------
QEAASAVPVQREEPALKGMI---APKAAPSPKPAEAK---------------ATPSLIAG
FIAWLTALFAPKPAPKAK---GKGRGRNNNQRRQ----GQNRNRN-RN-QRNRNQGDKND
ARDNNVNAK-DNRELHDSNDAK-------EGKSNPRRNTRNRK-RHDNDEGDNGQQK---
---------------------------RRQPRATETSDVNDA---PAPK---ERRKRRDN
RKNVRVTNEA-STAEEVNTIASTSEPVQSEVIT-------TGDESVNTNVE---ANDTVP
TDKKTRSRRSPRHARA-AGQKRKQEEQAETENVSQTVEGQTALPLEEPTGAQIQAIVEEN
QQIALSADHGEDTTTESTSLSNEEL-EVKRNNSLIESDNAVESSNDVIQATSE--AIDKA
KEDLDSVSEVVDTPIQALLD----------ISEETEVTSTEASTAIVSEAVTPVDTISAP
E--------------------------------EITAPTSV-----------------PA
VLAPKAHASHPMAL--PAVLAQEF---GEIVVKQKDNSERYEYVKTEKR--------ADM
QSVTSRVSAPT------------TLPLSVD
>gi|119478177|ref|ZP_01618233.1|	   956 residues, 50 /line  ribonuclease E [marine gamma proteobacterium HTCC2143]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------MPKSSAYSGFVSN------------------------
---MKRMLINATQPEELRVGLVDGQRLYDLDIENRTRVQMKDNIYKGTITRVEPSLEAAF
IDFGADRHGFLPLKEISRDYFYRQ------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------------------------PSDV-QGR
F-K--IRDVVKEGTEVIVQVDKEERGNKGAALTTFISLAGRYLVLMPNNPRAGGISRSI-
EGE-ERSDLKDALNNMAIPKGMGAIVRTAAVGRSAEELQWDLDYQAQIWDAIKKAAED--
--------QPAPLLLLQDSNVIIRAIRDYLREDIDQVLIDAEEAYTDAMNFVTRIMPHYE
SRIRLY----QDP-----VPLFNRYQIESQIETAFQRDVDLPSGGSIVIDPTEALVSIDI
NSARAT--KGGNIEETALQTNLEAADEIARQLRLRDMGGLIVIDFIDMSAAKNQRAVENR
MRDALNIDRARVQVGRISRFGLLEMSRQRLRPSLGETSAKVCPRCTGQGTIRDTKSLSLS
ILRLVEESASK----------ERSAEIRALVPVNVASYLLNEKRQPIHDIELRTGVRVVI
APIPQLETPHFELQRLRDDEIGK----D---VEISYKMQTEIADE---------TSIQ-V
QQKAAAP----QQAAVQSIA---PPAPAPLAA-AKANIAP------DTA-T-KSPGLLSK
IIGFFTGGDKDDEKKDEQKKPEKRESTNRRPQNRGGQQNNNRNRN------RNRNKSRNE
SRNESN----------------DRNEGND----RGTKD-----------GNRNAAPQQKK
THDKVEPR------------------EAPAANESHEDK-----PQRRPS---NRRPRSSQ
RRRNRGPNTENNEIENTSNE-----------LPKTPEAVNNGQDLQQLEPAID---HPVV
APIAAVS------------EVAEVSE--VSAVAEV---AEVAQ-----------VAEVAE
VSEVVEVAEVAEVTEISEVAEVAEVIVAPVTEV---------ELIVESTPETV--IVDQQ
E---TPASDEILEPDTTAEAPSVDNAVVETEMEPLEAAIANTASSAIAEPPVEEEAVVTD
N---------------------------------------------AANTALTEAPTESG
TAEA-SPTSAEAPV--GRASNDPRLTPKTIDAVEIE-TEHLDTIPKAPAAAAEPD--SEK
AAPSRAPNDPR------------HK----R
>gi|88810810|ref|ZP_01126067.1|	   910 residues, 50 /line  RNase E [Nitrococcus mobilis Nb-231]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------MLINATQPEELRVALVDGQSLYDLDIETPARERKKANIYKGKITRVEPSLEAAF
VQYGAERHGFLPFKEIARGYFQTE------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------------------------EDAD-LTK
I-S--IKEAIREGQELVVQVDKEERGNKGAALTTFISLAGRYLVLMPNNPRAGGVSRRI-
EGQ-DRNEIRDALRSLDVPEGMGLIVRTAGVGRSVEELQWDLDYLLNLWMSIQKAAAE--
--------RNAPLLIYQESNVIIRALRDYLRNDIAEILVDDPDVYEQAKGFIQQVMPHNL
AKLKPY----QDN-----VPLFTRYQLESQIESAFQREIRLPSGGAIVIDRTEALISIDI
NSSRAT--KGADIEETALQTNNEAADEVARQLRLRDLGGLIVVDFIDMGANRNQREVENR
LREAVKMDRARVQVGRISRFGLLEMSRQRLHTSLGESSQEVCSRCGGRGTVRGVESLALA
VLRIIEEEAMK----------EKTHKVLAQLPIEVATFLLNEKRSVLSATEQRNGVEITL
IPNKTLETPHYEIQRIRTDDRTAE---G---SSYQLVAKTPQGK--LAEQLVAA------
----ATQKPRIEEPVVKHLK---PLTPAPLPL-QMKNSTL------HDP-L-PMSKGLSS
FFGWLRKLVPGSEHGADLGTTAN---RGNEPTRTQNVRGANARSDDTT-QGRTLADNSQS
MTTAGQEAA-SVDEKTEA---NGDGQAHGSSRR--------SSRRGRRGGRRRRRSSDKS
QQLGAQPEA--------------VSGEATQ-------------TPRAPG---SEYEPVQP
EPD-----------------STSGSPVEPPRAT----------------------PAHTT
SSSKTDAADTAKGSI--GGDPRRWPGRPRIPHNEGSAERNIAAPQMALR-----------
PELESTSPAAPNEETTRG---------------------------TAATKQAA--VKPEV
PRLAAPASSAPVEPTQIREQRTDGPLAREDD-----------------------------
-SAKPPVVLEANDGKLESADK-----ASTA-------------APAKPKTRKASANSSKK
APSRAQRSKEPQTQ--RRKRPNPE---------------------------NEGE-ADSK
SDGERAVAGGD------------DSLA--R
>gi|71907634|ref|YP_285221.1|	   870 residues, 50 /line  Ribonuclease E and G [Dechloromonas aromatica RCB]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---MKRMLFNATQAEELRVAIVDGQKLIDLDIESAAKEQRKSNIYKGVITRIEPSLEACF
VDYGADRHGFLPFKEVSRAFFQPG------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------TE-VGR
A-R--IQDALKEGQELIIQVDKDERGNKGAALTTYVSLAGRYLVLMPNNPRGGGVSRRV-
DGD-ERAELRDVMDQLEVPNGMSLIARTAAIGRQAEELQWDLNYLLQLWTAIDGAAQQ--
--------QSGAFLIYLEGSLVIRAIRDYFQPDIGEILIDTDEVYEQARAFMGTVMPGNI
NRVKRY----RDD-----VPLFSRFQIEHQIETAFARQVNLPSGGAIVIDHTEALVAVDV
NSGRAT--KGSDIEETAFKTNQEAAEELARQLRLRDLGGLIVIDFIDMENQKNQREVENR
LRDALRFDRARVQMGKISRFGLMELSRQRLRPALAETSYIPCPRCTGTGHIRSAESAALH
ILRILEEEAMK----------ENTGAVHVQVPVDVATFLLNEKRPDIQAIELRHKVTILL
IPNVHLETPAHTITRLRHDDLNQD---DLREPSYKMVDMPIE-----------EAIKQ--
-ATQAEAAKPRQEAAIKGIS---PDQPAPIMP-EKAEAPV------AAP-AQPEGGLFSK
IF----SWFRSSPKPVE---PVAAPEPAKKPREGRGDGRRDGRRGG---RNGNRRDEERG
ERKERP-----ERKERNAVDKAPQDGTPASNGERKERRPRG-------------------
----------------------------------------------------ERKERGER
QQQAETVENK-----------LVQQTAAADA--------AVAPLLANEAPDAQ------G
NEEQGNRRRGRRGGRG-RGERRNEA--DSTPVAEV---LPVIEPAVEPIN----------
----------------------------------------QEPVVVVIPAAEP--VV-VA
AEVVTPVVEPVASPIVEPVQVAE------------------------------------V
IEAAPAAIIEALPVEIQESPK-----AEAPAPAPAPVVAEPVN------LEATLAESGLV
MVQTT-----SAAV--AAAQPEP---PVKLGRPR---------KAKPAS--------KQA
ESESLVMVETA------------------K

Ad blocker interference detected!


Wikia is a free-to-use site that makes money from advertising. We have a modified experience for viewers using ad blockers

Wikia is not accessible if you’ve made further modifications. Remove the custom ad blocker rule(s) and the page will load as expected.