Fandom

Proteins Wiki

At2g04270.1/MSA

< At2g04270.1

47,922pages on
this wiki
Add New Page
Talk0 Share
>gi|30678102|ref|NP_850987.1|	   996 residues, 50 /line  glycoside hydrolase starch-binding domain-containing protein [Arabidopsis thaliana]
MDVTEV--------------PWRRLPQ--FSVSSRASWLVSSGFPLSSYMFSHVERGKTF
RLTLC--------------FGVSRLRPRSAI----VSAQQEQPPSRLKGLCEVVWIVEAD
LAANEHLYVTGDPSTLGSWEPDCAISMYPT-ENDNEWEA-KVKIASGVNFRYNYLLKAGY
GSSSDVIWRPGPQFSLSVPSSVNQDRKIIIRDSWMSMSISSKSQESYGWGSWIDDAYLFP
NCVTPAQSEDE-------CTSADSAIEV------------------PRTHLNDKQVGAES
FLCDELAAFSSENSNLSALFS-DNYQPIEEPWLIQESITLQHERNMQTDSEQDVESCD--
------------------------------------------------------------
------------------------------------------------------------
----------------------------------------DNENNLNTDEQNHQLTETLL
PDGGFFQSESIATTILINSSICTVQRIAVLEGGKLVELLLEPVKTNVQCDSVYLGVITKF
VPHMGGAFVNIGSARHSFMDIKSNREPFIFPPFCDGSKKQ----AADGSPILSMNDIPAP
HEIEHASYDFEASSLLD-IDSND-PGESFHDDDDEHENDEYHVSD-HLAGLVNGTVVNHG
A-------VEVGSENGH-----------------IPMERGHSADSLDSNASVAKASKVMS
--SKDNKWIQVRKGTKIIVQVVKEGLGTKGPTLTAYPKLRSRFWVLLTRCKRIG-VSKKI
-SGVERTRLKVIAKTLQ-PQGFGLTVRTVAAGHSLEELQKDLDGLLLTWKNITD---EAK
SAALAADEGVEGAIPALLHRAMGQTLSVVQDYFNDKVEKMVVDSPRTYHEVTHYLQDMAP
DLCNRVELHDKG-----IPLFDLYEIEEEIEGILSKRVPLSNGGSLVIEQTEALVSIDVN
GGH-GMFGQGNSQEKAILEVNLAAARQIAREIRLRDIGGIIVVDFIDMADESNKRLVYEE
VKKAVERDRSLVKVSELSRHGLMEITRKRVRPSVTFMISEPCSCCHATGRVEALETTFSK
IEQEICRQLAKMEKRGDLENPKSWPRFILRVDSHMSSFLTTGKRTRLAILSSSLKVWILL
KVARHFTRGTFEVKPFMDEKTVNE----RQHQVA-ISLLKKADAIA-------DSSGKKK
LTL-IP------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
IKKEK-TSGKQRR-----------------------------------------------
----------------------------
>gi|113460860|ref|YP_718927.1|	   942 residues, 50 /line  ribonuclease E [Haemophilus somnus 129PT]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------MKRMLINATQKEELRVALVDGQRLFDLDIENPGHEQKKANIYKGRITRV
EPSLEAAFVDYGVERHGFLPLKEIAREYFPDD-Y--------------------------
------------------------------------------------------------
-----------------------------------------------------------V
YQGRPNIRDILSEGQEVIVQVNKEERGNKGAALTTFVSLAGSYLVIMPNNPRAGGISRRI
-EGDERLELKEALSSLDVPEGVGLIVRTAGVGKSPEELQWDLKVLLHHWEAIKQ---AS-
---------QSRPAPFLIHQESDVIVRAIRDYLRRDIGEILIDSPKVYEKAKAHIKLVRP
DFINRVKLYQGE-----VPLFSHYQIESQIESAFQREVRLPSGGSIVIDATEALTAIDIN
SAR-ST--RGGDIEETALNTNLEAADEIARQLRLRDLGGLIVIDFIDMTPVRHQREVENR
MREAVRQDRARIQISRISRFGLLEMSRQRLSPSLGESSHHVCPRCQGTGKIRDNESLSLS
ILRLLEEE----------ALKENTKQVHTIVPVQIASYLLNEKRKAIHSIEKRHNVDIVV
APNEAMETPHFSVFRVREGEEIN----ELSYNLAKLHEMNDET------YVVE---DAFI
SRH-LENSAATVESAVENA--AVSLAIET--PAPM-------------PQER--KQERES
LLRRIIEGIKNLF-ADNSSKN---------------------------------------
------------------KKNKNTRQNK-N-ARHNRRNQDRRSSRRIRQEHEIKSDENNK
LD-----------TQHSHYT--ERYSKH---AKKGVDDP---------------------
------------QIQTKKAGEL------------EIHTKDDETIETIQPRRQRRDLRKKV
RVEENLVDTP----NLGSTEEHVENEKTTEPV-T----S-LEQAV---LQTENEKTHERQ
DNNYRHRRLPRHLRVNNQRRRR-NV----EL-----------KSAMPL-FAAVASPELAS
GK-VWVDVNVVN-----------------SKNNNFLSVDELLKQQYQQEEIEVVI-----
PASEILMDTQSDDIKPLSNFVSQP--ANEAVEKKVQETLQR--LTQEVV-----------
---------------------------------DESSTIERTEV----------------
-------DTNISVP-----------------------EFVREYQFNGRLGTISAV---MH
T----------KAEMTLAKSSDEPMQ-----------PFSIVEWQDSRYYF-YGRGAAGH
HCA-----ISHVYSEPANTKI------E
>gi|15602856|ref|NP_245928.1|	   1004 residues, 50 /line  Rne [Pasteurella multocida subsp. multocida str. Pm70]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------MKRMLINATQKEELRVALVDGQRLFDLDIESPGHEQKKANIYKGRITRV
EPSLEAAFVDYGAERHGFLPLKEIAREYFPDD-Y--------------------------
------------------------------------------------------------
-----------------------------------------------------------V
YQGRPNIRDILSEGQEVIVQVNKEERGNKGAALTTFVSLAGSYLVIMPNNPRAGGISRRI
-EGDERLELKDALSSLEVPDGVGLIVRTAGVGKSPEELQWDLKVLLHHWEAIKQ---AS-
---------QSRPAPFLIHQESDVIVRAIRDYLRRDIGEILIDSPKVYEKAKAHIKLVRP
DFIHRVKLYQGE-----VPLFSHYQIESQIESAFQREVRLPSGGSIVIDVTEALTAIDIN
SSR-ST--RGGDIEETALNTNLEAADEIARQLRLRDLGGLIVIDFIDMTPVRHQREVENR
IRDAVRQDRARIQISRISRFGLLEMSRQRLSPSLGESSHHVCPRCQGTGKIRDNESLSLS
ILRLIEEE----------ALKENTKQVHTLVPVEIASYLLNEKRRAIHSIEKRHDVDVIV
VPNEGMETPHFGVFRVREGEEVH----ELSYNLVKLHQEKDEH------FVPE---ESLV
SRN-IETAALTSENVLESA--AVSMAIPA--PAPV-------------PEKK--VENKPS
LLTRILAKLKAIF-ADKPVVE---------------------------------------
------------------EKSKGNRPKS----NRNRRQQERRNQRRSRAENVERDSNTKR
QD----EVVEEVIRPRSERN--TKRNRK---ANHAVDTV---------------------
------------SVTENTLDTA------------TVESVEVEKVESVAPRRQRRDLRKKV
RISDDVHESA--LPLVETEISMPEAETVVEETVV----A-TELVPETVPVVEEGETEKRR
DN--NRRRLPRHLRVNNQRRRR-QN---QEF-----------KAPMPL-FAAVASPELAS
GK-VWPDFQPVV-----------------VKENQFLSVDELLEQQHQPKESAATI-----
PALDLVAEGSEKGVSPFNGFVVQP--ANESVEKKVKQSLQR--LEEEQALAIMQ------
-----------PLSVADTKIDEAEGETEHKPLNDVSTELSVKEKDENSLPQSPVEEVVEQ
VEMPAQGDEVKSIS-----------------------RLQRNYQFSGRLGTISAV---PH
T----------TSEMTLAKASDEPLE-----------MCQIGVWTESRYYF-HGKGSAGH
HSA-----ISHVYAGPTKAENK---G-E
>gi|119478177|ref|ZP_01618233.1|	   956 residues, 50 /line  ribonuclease E [marine gamma proteobacterium HTCC2143]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------------------------------MP
KSSAYSGFVSNMKRMLINATQPEELRVGLVDGQRLYDLDIENRTRVQMKDNIYKGTITRV
EPSLEAAFIDFGADRHGFLPLKEISRDYFYRQPS--------------------------
------------------------------------------------------------
-----------------------------------------------------------D
VQGRFKIRDVVKEGTEVIVQVDKEERGNKGAALTTFISLAGRYLVLMPNNPRAGGISRSI
-EGEERSDLKDALNNMAIPKGMGAIVRTAAVGRSAEELQWDLDYQAQIWDAIKK---AA-
---------EDQPAPLLLLQDSNVIIRAIRDYLREDIDQVLIDAEEAYTDAMNFVTRIMP
HYESRIRLYQDP-----VPLFNRYQIESQIETAFQRDVDLPSGGSIVIDPTEALVSIDIN
SAR-AT--KGGNIEETALQTNLEAADEIARQLRLRDMGGLIVIDFIDMSAAKNQRAVENR
MRDALNIDRARVQVGRISRFGLLEMSRQRLRPSLGETSAKVCPRCTGQGTIRDTKSLSLS
ILRLVEES----------ASKERSAEIRALVPVNVASYLLNEKRQPIHDIELRTGVRVVI
APIPQLETPHFELQRLRDDEI--GKDVEISYKMQTEIAD--ET------SIQ-VQQKAAA
P----QQAAVQSIAP-PAP--APLAAAKAN-IAPD--T----------------ATKSPG
LLSKIIGFFTGGD-KDDEKKDEQK------------------------------------
-------------------KP-EKRES------------TNRRP---QNRGGQQNNN---
RNRNRNRNKSRNESRNESNDRNEGNDRGTK------------------------DGNRNA
APQ------------QKKTHDKVEPREAP-AANESHEDKPQRRPSNRRPRSSQR-RR---
--NRGPNTENNEIENTSNE--LPKTPEAVNNGQDLQQ---------------LEP-----
-AIDHPVVAPIAAVSEVAEVSEVSAV-------------AEVAEVAQVAEV----AEVSE
VVEVAEVAEVTEISEVAEV----------AEVIVAPVTEVELIVESTPETVI----VDQQ
ETPASDEILEPDT--TAEAPSVDNAVVE------------TEMEPLEAAIANTA---SSA
IAEPP------------------VEEEAVVTDNAANTALTE--------APTESGTAEAS
-----------------PTSAEAPVGR----ASNDPRLTPKTIDAV-EIETEHLDTIPKA
PAAAAEPDS---EKAAPSRAPNDP-----RHK----------------------------
---------------------------R
>gi|90415858|ref|ZP_01223791.1|	   1008 residues, 50 /line  ribonuclease E [marine gamma proteobacterium HTCC2207]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------MKRMLINASHTEEVRVAMVDGQKLYDLDIENRTREQKKANIYKGKITRV
EPSLEAAFVDYGADRHGFLPLKEISREYFKGKSS--------------------------
------------------------------------------------------------
------------------------------------------------------------
DGGRVNIKDAIREGQEIFVQVEKEERGSKGAALTTFISLAGRYLVLMPNNPRAGGISRRI
-EGEERADLREAMRGLDIPEGMGAIVRTAGIGRATEELQWDLDYLLQLWNTIEA---EA-
---------EGAKAPHFLFQESNVIVRAIRDYLRQDVGEVIVDSQDAYNLAAAFIGTVMP
DFTNKVKFYQEQ-----IPLFNRYQIENQIETAFRREVSLPSGGSIVIDITEAMVSIDIN
SAR-AT--KGGDIEETAFNTNKEAAEEVARQLRLRDVGGLIVIDFIDMLNTRHQKEVENT
IREALKIDRARVQVGRISRFGLLEMSRQRLRPSLEETMSKICPRCKGQGTIRGTRSLALS
ILRLIEEE----------AQKEFSKEIRAIVPVSVATFLLNEKRSEIADIESRNKINVVV
LPNTQMETPHFEVVRIRAQDDD-DSDGEFSYKLAHELSS--KE------PEQ-DLERTSA
PL-PISEPAVKTLVP-HKP--APIMPEKAA-PTAAAAV----------------KTEKPG
LLKRIWESIFGGS-STEAKKTEDE------------------------------------
-------------------KKTRPRGS------------NSRRGGQNQDSRNRQGNR---
RPNNRNRNRNRNEGRNDSNRDAEGTETQAK----------SADKQGQGRGRN--DQSRPA
AKQDTRE--------QKVDSASTATQTAD-KGPETGEGGELKKRPNDKRRGPRR-RR---
--QRQD-VPANVTEQLSADIAVETSTVAADSSPSVES---------------KTA-----
-APETAAQVTTDTTAEATETKPARKRP--------ARRRKPKADVVETGET----AETGS
TEATPTAPVVADTQDSAAA----------PEEKPAPKPRALRKAPAKPKKVE----ADAS
SSAAASEATAAPE--KAEAPQSTEAEAP-KPT------EAEAPKPTEAEAPKPT----KA
DAPKP------------------AEKPKAPKKAAAVVEVIE--------KAAPKAEAKAT
-----------------AKPARAATAR----ASNDPRFKPKPVSDV-KVSTARVEKPAAV
ALDTSKPAPTAAPKAPVARASNDP-----RKNRASQA----TKADSAP------------
------SDTGSAKESTEKGPQ------A
>gi|119503336|ref|ZP_01625420.1|	   973 residues, 50 /line  DNA polymerase III delta prime subunit [marine gamma proteobacterium HTCC2080]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------MKKMLINATQPEEIRVAIVDGQRLNDLDIENRSRGSTKANVYKAKITRV
EPSLEAAFVDFGAERHGFLPLKEIAHQYYRSTAP--------------------------
------------------------------------------------------------
-----------------------------------------------------------E
GEGKTRIKDVLKEGTEVIVQVDKEERGTKGAALTTYISLAGRYMVLMPNNPKAGGISRRI
-EGDDRTELRDALSQLNIPDGMGVIIRTAGVGRSPEELQWDLDYLLQLWSSISS---AS-
---------DENKAPVLLYQESDVIIRSIRDYLRDDVDQVLIDDKAAWQQAHDFVTMVMP
KYAQRIRYYEDA-----TPLFNRFQVEGQIESAFQREVRLPSGGSIVIDPTEALISIDIN
SAR-AT--KGSDIEQTALQTNLEAADEVARQLRLRDMGGLVVIDFIDMNANKNQRAVENR
IRDALEVDRARVQVGRISRFGLLEMSRQRLRPSLGEISAMVCPRCTGKGTIRDTKSLALA
ILRLLQEE----------AAKDRTGEVRAVVPVEVAAFLLNEKRSAVNDIESSSGVRVLI
IPNPHMETPHFDVIRLRDDEVE--ESTTLSYEVAIETP--DPI------AVR-DEV--SA
IP-AAPQPLVRGVTP-QEP--APVAAEPEA-PAPMAETRDIKQQP------KTESPQKTG
ILTRMWGALFAP----APSEEADI------------------------------------
-------------------ETLTETED--------------------SGHEESSEPK---
ENANRQRR--SRGGRNRTRSRRPDSDVQAE----------DTD-----------E-----
---------------VDQTTVDADESDSS-ESNDDTDDRPKRNRRRRGRRGG--------
--QKRPLSDSSDVEANEGE--EHTGEDDIDDAVDNDV-----------QAAVAEE-----
-SKESARHRPSDKRSEGRRRRQRGPKP--------DIQAETQADTAGT----VTDAPVAG
TDENDAPIENAVSAEANQV----------PAPALSSVTDQIDLLAGTPEGAK----QTEE
PMVAASSVT-AQE--TDEANVTDEANVN-DDTAQSTQTAESEPAPVTDAVAATSEEI--A
SKEET------------------VKPEEIIATAATIAPATAEVD----------------
------------------RSGLTDAGR----AVNDPRVEPKPIGEV-NVATLRQALFLEQ
EAPPVS-IVSR----DIPRASNDP-----RGPKAGLA---FTAAKRSPDESN-EDTV---
---PDAQ-------------------AN
>gi|119897904|ref|YP_933117.1|	   1014 residues, 50 /line  probable ribonuclease E [Azoarcus sp. BH72]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------MKRMLFNATQAEELRVAIVDGQKLIDLDIESAAKEQRKSNIYKAVITRI
EPSLEAAFVDYGAERHGFLPFKEISRSYFQPG-V--------------------------
------------------------------------------------------------
-----------------------------------------------------------D
-AGKASIKEALREGQELIVQVEKDERGNKGAALTTYISLAGRYLVLMPNNPRGGGVSRRV
-EGDERAELRDVMDQLEVPGGMSLIARTAAIGRSAEELQWDLNYLLQLWTAIEG---AA-
---------TSQSGAFLIYQEGSLVIRAIRDYFQPEIGEILIDTDDIYEQARQFMAHVMP
GNVNRVKRYQDD-----VPLFSRFQIEHQIESAYSRQVGLPSGGAVVIDHTEALVSIDVN
SGR-AT--KGADIEETAFRTNLEAADEIARQLRLRDLGGLIVIDFIDMESQKNQREVENR
LRDALRHDRARVQTGKISRFGLLELSRQRLRPALAETSYIPCPRCNGTGHIRSTESSALH
IVRILEEE----------AMKENTGAVHLQVPVDVATFLLNEKRVDIARIEMRHKVQLII
VPNRHLETPQHEIIRLRHDQLNLEDIALASYQMVQKPAD-EEM------RLP-TKN--GD
KP-ARQEAAVKGISP-EQP--APIVEARAE-AAPAPAAVA--------------PAPRRG
LLDWILGLFRSEP-APAATPAPA-------------------------------------
-------------------ETPAKREA--------------------RPRGERNGDA---
RRGNGNRN--RREGQRERTERDGETPRARP----------ENG----RHARG--E-----
---------------RSESVEREKPQQER-AERPERADRPERTERGEGGRGRGR-GQ---
-RQARTDELNEKPADKAAE--VAAEVIAAA-ALASAN-----------DTEAVVP-----
-SGDDS--AGENAAPEKRRRRGRGRRD--------RRPAEVAGVDGVTENEGSADA-VAE
TADVLAPEAAPVVAEAEAV----------VQVAATVEAVEAPAVEAPAVEAP----AVEA
PAVEDAPAA-AEA--APASAELPVVASA-ATAVESIV--EAAPLPVAIETAVPTEEVAGA
HVTET------------------VAPETVPPLCVAEPPAAD--------HPEVSVEAEAV
-----------------ATTLETATVQ----PVAAPEAEPV-AEA-----PALVVAAEDS
IVPPAP-TETRAAGVEQKPAPSDPIDLGPALADSGLV---LIETSRDKLSKF-GTGAVEQ
S-VPLGRKPRQAMVIAEEPLQQVETR-K
>gi|56478531|ref|YP_160120.1|	   1007 residues, 50 /line  ribonuclease E (RNase E) [Azoarcus sp. EbN1]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------MKRMLFNATQAEELRVAIVDGQKLIDLDIESAAKEQRKSNIYKAVITRI
EPSLEAAFVDYGGERHGFLPFKEISRTYFAPG-A--------------------------
------------------------------------------------------------
-----------------------------------------------------------D
-AGKVRIQEALKEGQELIVQVEKDERGNKGAALTTYISLAGRYLVLMPNNPRGGGVSRRV
-EGDERTELRDVMDQLEIPSGMSLIARTAAIGRNAEELQWDLNYLLQLWRAIDG---AA-
---------QSQSGAFLIYQEGSLVIRAIRDYFQPEIGEILIDTDDVYEQARQFMSHVMP
ANVNRVKRYSDD-----VPLFSRFQIEHQIESAYSRQVTLPSGGAVVIDHTEALVSIDVN
SGR-ST--KGADIEETAFRTNLEAAEEIARQLRLRDLGGLIVIDFIDMESQKNQREVEGL
LRDALRHDRARVQTGKISRFGLLELSRQRLRPALAETSYIPCPRCNGTGHIRSTESSALH
ILRILEEE----------AMKENTGAVHLQVPVDVATFLLNEKRVDIAHIEVRHKIQLII
IPNRHLETPHHEIIRLRHDQLNQEEVALASYQMVGKPAE-IDL------RLP-SKE--DT
KP-PRAEAVVKGISP-AQP--APIVEPKTE---PVVAPGL--------------APKPAG
LFQRLFGWLRSEK--PAVTPQMAP------------------------------------
-------------------EIAPKPES--------------------RPRAERSDTR---
RGNNRNRR--DGQQRTERGERDESTSA-AQ----------TAR----GPVRG--E-----
---------------RAERPERSERTERS-DTGVDRGDRPARPERDNGGRTRQG-RG---
-QRTQPKQGEAAVVDNVVE--SPASTITIAPAPLAQM-----------EAAAIVP-----
-AAEDG--T-----PEKRRRRSRGRRD--------RRGTEQQAEVAASGDE-TGDT-WAE
TA-VPSIETAPETTQATSA----------EPVAEVAAELPLAAAETTAPLPV----AVTS
P--ESIAVT-AEA--AP----LPVSLHP-ATSIEAES--PAEAEPVTLETAAEPVAEREA
AIEPA------------------LEAKIAPEAAIEAAERARESLQAGLMEPLVHADTEPV
-----------------QVSAGEELVE----AEAEAEAEQAPTAA-----PAQNVVAPET
EVAVTE-AEVRTA---ESRLSSAPIDLGVNLAESGLV---MIETSRDKVQEL-ASTADET
PARPLGRRPRPAPVIVNEPLQQVETHSK
>gi|88705137|ref|ZP_01102849.1|	   1003 residues, 50 /line  ribonuclease E [gamma proteobacterium KT 71]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------MKKMLINATHAEEMRVALVDGQKLYDLDIENRTRLQKKANIYVGKITRV
EPSLEAAFVDFGAERHGFLSVKEIAREYFYRNPK--------------------------
------------------------------------------------------------
-----------------------------------------------------------D
VDGKFSIRDVVKEGTRLIVQVDKEERGNKGAALTTFISLPGRYMVLMPNNPRAGGISRRI
-EGDDRAELREALSALDIPDGMGVIIRTAGVGRSAEELQWDLNYLLQLWEAVSK---AG-
---------EENRSPVLLYQESNVIIRAVRDYLRDDVDQVLIDSPDAFKQAMDFVSMVMP
KYQQRIKLYEDN-----IPLFNRFQIESQIETAFQREVRLPSGGSIVIDPTEALVSIDIN
SAR-AT--KGANIEATALQTNLEAADEVARQLRLRDMGGLIVIDFIDMLAAKNQRAVENR
MRDALAIDRARVQVGRISRFGLLEMSRQRLRPSLGETSAIICPRCTGQGSIRDTKSLSLS
ILRLLEEE----------AIKDRTAEVRAIVPVDVAAYLLNEKRVALSEVESLTRVRVLV
IPNPNLETPHFEVTRLRDDEVEG--DQQTSYKVEIAVPD--AD------SIS-DSH--DH
SL-PTQEAVVQRIAPTAAP--APTAVADSEATEPASVSGAATSAATTAVAATAAVAAKPG
LAQRLWVSFFGDP-NANAEEAGAE------------------------------------
-------------------EAGA----------------VTTSDSNTSESADAEGDR---
PKRTRGRRRRGGQGRNQNRNAE--------------------------------DTDQNA
DSK---D--------SEASTDAAEARTGS-ASDEDGSEKPEDGTRRRRRRRS-R-GG---
-RRSGPDGQESTGESGVTQ-SEDSSDSDEAAAVASED-----------DNGESSDRDQDV
ASEHKPRKRPSNQRRGEPRRRR-------------RKPVTETA-------------EAVA
EEQTDQASTSVVESEAESS----------VEPVEAIEAV--TEVEAVAETAS----VVDE
SAVDASLND-AEA--SNSVAAADEALTG-EAATAT-DTVEAAETPVAEEATKPASAGSSI
EAAMGLSAATDGQTA-------IVEAEDSPEAVDDVSEVVADATADTAQAPAPAEPAAAT
LQVDAKAANA-------PGEGLTEEGR----AVNDPRVSPSPVQEL-HIETGQIVLFSET
AAPAVEA-----PDRQVPRASNDP-----RGPKDAVS---AE------------------
---------------------------A
>gi|83644954|ref|YP_433389.1|	   1056 residues, 50 /line  Ribonucleases G and E [Hahella chejuensis KCTC 2396]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------MKRMLINATQPEELRVALVDGQKLYDLDIESGTREQKKSNIYKGKITRI
EPSLEAAFVDFGAERHGFLPLKEISREYFKSQPQ--------------------------
------------------------------------------------------------
------------------------------------------------------------
KGGKMNIKDLLQEGQEIIIQVDKEERGNKGAALTTFISLAGRYLVLMPNNPRAGGISRRI
-EGDDRDQLKDAMSGLTVPKDMGLIIRTAGVGRSSKELQRDLDYLLQFWDSIRH---AS-
---------DSKPAPFLIYQESNVVIRATRDYLRQDIGEVLIDHPQVHQDALNFVKAVMP
NFENRIKLYQDD-----IPLFNRYQIESQIETAFQREVKLPSGGSIVIDPTEALVSIDIN
SAR-AT--KGGDIEETALQTNLEAADEIARQLRLRDIGGLIVIDFIDMTPNKNQREVENR
LKEALELDRARVQIGKISRFGLLEMSRQRLRPSLGETRNEMCPRCKGQGSIRGVESLALS
VMRLIEEE----------AFKERTAEVRAICPISVATYLLNEKRENLAKTQKRHGVKVIV
VPNSHMDTPHFEVQRIRDDNANV---SEISYNVRPEMEE--KN------PVE-SLL--HK
EV-VRQEAAVKTIVPSSTP--TP-------------------------------PSEEVG
LLKRLRQKVSKMF-SGEKKDSDLKI-TVA-------------------------------
-----------ESPQTSQDKDAGRRKVKVRDRQDGQRDNQRQGDSRQAESRDGGQDN---
RRGNRGRNDDRNQRRNERNDGQKDRRQRDR------------------------DSSKGD
SQR------------DQRGRNESAKADSG-SQEKSEFNRPRRDRSSGKPVPRPQ-RQDRP
ERQDKPEDQEKAVEEVAERRALTAAAASAAEEPAKSEIAKE-------VWNKSVEAIAES
ESTDNTRQAPPKAEEKGVEPAQQTAKQPHQPSEQSKAPQERASEQSAKQSDADSRQRKQD
DAEANQQNAGEDGQEKSAR----------RARADNDPRNKARRPKREAAEAK----SEEA
PKESQLERSVAQA--KANAPAMGNTSVE------------SKNKEDKKEG----------
RAAKASAIEQPKKEA-------TPEAKDKPDTAPATDK------GATKAAPEPTVEK---
KPSDKPAATA--------AQEEEEPKR----AFNDPREVRKRIQAQ-KVQAGNDASSALA
PQQIAAPKPPEAATIEPKMEAKEPEPKKAP----------AAEKPREEVEPP-KSAPSAP
EATVADVKAEDKPSS----QDSKASQ-A
>gi|90021266|ref|YP_527093.1|	   968 residues, 50 /line  DNA polymerase III delta prime subunit [Saccharophagus degradans 2-40]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------MKRMLINATQPEELRVALVDGQWLYDLDIENRLREQKKANIYKGRITRV
EPSLEAAFVDYGSERHGFLPLKEISREYFAKQPK--------------------------
------------------------------------------------------------
-----------------------------------------------------------D
IDGRIRIQDVVKEGMEVIVQVDKEERGNKGAALTTFISLAGRYLVLMPNNPRAGGISRRI
-DGDDRTELKDALSQIDVPAGMGIIVRTAGVGRRAEELQWDMNYLAQLWASIKT---AA-
---------EEKTAPEFLFQESNVIIRAIRDYLRPDIGEVIVDNQDAYNLATAFVEQVMP
NYRSKVKLYEEP-----LPLFNRFQIESQIETAFEREVKLPSGGSIVIDVTEALISIDIN
SSR-AT--KGGDIEETALQTNLEAADEIARQLRLRDMGGLVVIDFIDMQPVRNQREVENR
MRDALEMDRARVQVGRISRFGLLEMSRQRLRPSLGETTSKVCPRCSGQGTIRGTKSIALS
ILRLVEEE----------AQKERSAEIRAVVPVAVATYLLNEKRKVISGIEERQKTRIVI
IPSEKMTTPHFDVQRLRDDDVVS---SEISYKIEVPQGE-DEE------KIQ-DDA--AA
LA-KLPRPAVQAIPP-AQP--APEA------------------------------PKPDS
LLTKILKKLKELF-KTDDKKR---------------------------------------
-----------------KNTSKNSRGQ------------QRRRG-------NNSQNN---
RNRNRNRNGRGNDNRNKNRDDEITDNLS--------------------------------
------------------SRTKSDQSQQG-QGPSSDDNRPDRGNRKRGNRRRNNNRRNDQ
DRNDSPESNND--------------EQQNNNQPQEQN---------------------NA
PKEQGPNRRPNGRRGRGGRERK-------------REPVPQAAEESVTKDDSALAAEVTS
AIDTAE-KAFATNSPAELK----------QAKSEAKEQAKSEAKEQAKSEAKE--QAKQE
RAPQEAAIT-AET--PSEAKQPEATATAAEAKPEPSEKAKASQAPQAAEASDTTETVAET
KVEAPSAEAAPAKEA-------PVETAAETASEAETAEPVAAAETAEVAEVAVAEATEEA
SEAKEELAP--------AQAVRKQYSR----ATNDPRATPKPVANT-LVSNVVTQIRMSR
PLDTTQPANILRNPRDLSRPANDP-----RLKRN--------------------------
-------------------IEEVASD-A
>gi|146306650|ref|YP_001187115.1|	   1012 residues, 50 /line  ribonuclease, Rne/Rng family [Pseudomonas mendocina ymp]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------MKRMLINATQPEELRVALVDGQKLYDLDIESGAREQKKANIYKGRITRV
EPSLEAAFVDFGSERHGFLPLKEISREYFSK--A--------------------------
------------------------------------------------------------
-----------------------------------------------------------P
EGGRINIKDVLKEGQEVIVQVEKEERGNKGAALTTFISLAGRYLVLMPNNPRAGGISRRI
-EGEERNELREALNGLNAPADMGLIVRTAGLGRSSEEMQWDLDYLLQLWSAIKE---AS-
---------TSRPAPFLIYQESNVIIRAIRDYLRQDIGEVLVDSVEAQEEALSFIQQVMP
QYASKIKLYEDS-----VPLFNRFQIESQIETAFQREVKLPSGGSIVIDPTEALVSIDIN
SAR-AT--KGSDIEETALQTNLEAAEEIARQLRLRDIGGLIVIDFIDMTPAKNQRAVEEK
VREALEADRARVQVGRISRFGLLEMSRQRLRPSLGETSGIVCPRCNGQGIIRDVESLSLA
ILRLIEEE----------ALKDRTAEVRAQVPIPVAAFLLNEKRNSITKIELRTRARIVI
LPNDHLETPHFEVQRLRDDSPEA-LSGQTSYEIAATAENEEAAA---------HPAAATR
TL-VRQEAAIKA--APRSS--APVAAEPQ--PAPL-------------TPTK---APEPS
LFKGLVKSLVSLF-AGKEEEAQPA------------------------------------
---------------VT-EKKNNERPPR-EERRNGRQQSRNRGGRRDDERK----PREER
AP--------REERQARE--PREERQPREERAP----REERAPREPRE-GQENRRERKPR
EERAPR---------EERVRELREPLDTA------GNEQREERAE-RQPRAERQERQRPP
REERQPRA--------------EQAEALQDEALPNEEQL--------------QDDEQDN
NDGERPRRRSRGQRRRSNRRER-QR-----------------DADGNL-IESAENSEAA-
GNDAQAVTPVAVAT------------------AAAVVAESVDSSENVASEAPAS----EA
PAIEAPSVQVEEA------PAAQPV--EAQAEAAVSEVVEAA------PITEKAVEAEPA
AVETPAAVEAL--------VAEPVAQAE---------------------------PTVEV
AQEPAPAPVEQ--APAAAAVPANATGR----APNDPREVRRRQREAERLAREAAEAAAAA
P----------AVEAAPAVEASAPAEAEAAVVETAPAAEPVTEAQADPI---ASEQEAGE
AVE-----PAQPEAEPQDDKEEVKPQ-V
>gi|117619748|ref|YP_856763.1|	   1039 residues, 50 /line  ribonuclease E [Aeromonas hydrophila subsp. hydrophila ATCC 7966]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------MKRMLINATQEEELRVALVDGQQLYDLDIESPGHEQKKANIYKGKITRV
EPSLEAAFVDYGAERHGFLPLKEIARNYFPSG-Y--------------------------
------------------------------------------------------------
-----------------------------------------------------------S
YQGRPNIKEVVREGQEVIVQIDKEERGTKGAALTTFISLAGSYLVLMPNNPRAGGISRRI
-EGDERTELKEALSGLTVPDGMGLIVRTAGVGKSPEELEWDLNVLLNHWDSIHK---AS-
---------QSRSAPVLIHQESNVIVRAIRDYLRRDVGEILIDNPVIFERAKAHIELVRP
DFLNRVKLYKGE-----VALFNHFQIESQIESAFQREVRLPSGGSIVIDPTEALTSIDIN
SSR-AT--KGGDIEETALQTNLEAADEIARQLRLRDLGGLIVIDFIDMTPVRHQREVENR
LREAVHQDRARIQLGRISRFGLLEMSRQRLRPSLNESSSHICPRCQGQGVIRDNESLALS
ILRLIEEE----------AMKDNTEQVHGQVPVDVAAYLLNEKRASIASLEQRNDVRVYI
IPNQHLETPHYEVTRIRQNEIPE----AASYELKT--EIAKPV------YQPK---QAQV
I--EREQPLLQGFVQAP----QPAPAAPA--PVVA-------------PAAP--AAPEAG
LFGKLFKAISGLF-GSDTAPADVK--APA-------------------------------
-----------DKPAAQ----REARKDE--GHRHQRDETRSRGQRGRRDDNRGNRSPADA
AEKREA-GANREGGESRNRRPRKEREPRQEREARGEVREQRMEREPRE-AREPRQEREPR
APRPAREPRASREPRAEVVVDAVETVDTT----MVNDEPRLEKEQKVAERRERRQLRKQI
RVDAPASDVA----ALPADAPVVATEDASDSV---------------------EQHDEQA
EGQRRSRRTPRNQRIEGQRRKR-IN---EDARSQREDEEQSAEGATPT-LTAAAQADAAQ
VK-VEEPAVP----VITIPSAEAVAAALQ------------------ASAALTEHVVPEA
VVAEAHEQAEV--------VAAEPVVTEAVVAAVVAEEAQVA------------------
VVNEPVVAEVAAPVAA-------EVVAVEAPAIE-----------TAVVEAAPAAPAVEE
AAPAVVEQPAPVAEPVIADEASVATAV----AAPVAK-----QVKRGG-GLLAGA---RK
A----------SAPMATPAAAPALPV-----------REPVDHAPLVRSEV-ASSGRHGG
STA-----AVNVATSPAGR--------P
>gi|120554794|ref|YP_959145.1|	   1056 residues, 50 /line  ribonuclease, Rne/Rng family [Marinobacter aquaeolei VT8]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------MKRMLINATHPEELRVALVDGQRLFDLDIESSTREQKKANIYKGRITRV
EPSLEAAFVDFGAERHGFLPLKEISKEYFKKSPG--------------------------
------------------------------------------------------------
-----------------------------------------------------------Q
IEGKINIKDVVSEGQEVIVQVDKEERGNKGAALTTFISLAGRYLVLMPNNPRAGGISRRI
-EGDDRAQLKEAMNGVQVPKSMGIIVRTAGIGRTTEELQWDLDYLVQFWEAITQ---AA-
---------GERKAPFLIHQESNVIIRAVRDYLRQDIGEVLIDADNVYEDVLSFVRAVMP
TFENKIKLYKDE-----IPLFSRYQIEGQIETAFQREVKLPSGGSIVIDPTEALVSIDIN
SSR-AT--KGQDIEETALQTNLEAAEEIARQLRLRDMGGLIVIDFIDMTPAKHQREVEQK
MREALELDRARVQVGKISRFGLLEMSRQRLRPSLGETRSEVCPRCEGQGTIRGIESLALS
IMRLIYEE----------SSKEKTAEVRAMVPVSVATFLLNEKRKQLADIEARQGVAVVV
APVPNMETPHFEILRLRQDETSP--EHVSSHQVAQQYSEREEEAAVEVA---------SA
EKPVREQAAVKAIRP----------SAPA--PAPTA-------AA---PTAA--AEQEEG
LFRKLGKKIACFF-RGEEPEQEASHDTNR-------------------------------
-----------N--RSE--------------ERRNQARQDRRKSRVARDDQRTGGNRSGS
DRRQGSQQNRGDDNRGRNRGGRGDDQNRG--ERGGQNRSNRDDRSGDSKGNDNRRDNRK-
------DSQGRGQNRNRPQRDQKGPQDNREQQESQKGPSNDKQGGDDKQRKPRRQRNRDG
SPAETPASTPA-------ERKAERSEKHQKDTQPEKAADKTAPVDAKASEPRVDKAEQPA
ATTPETKTAPESRKPEQQEMAE-KPETKTEQ--------AEQKEAPSAEDKPEAKDESSR
KEKSDGRRGRS-------SGRQRKPRSADS-----------------------------A
EKSGAAEDKGDKESLPAEAEQK--QAAKPQRTEQVTATEA-E-QPAEKASAEPAKAEDKE
PVKAEAKAPRQAKAD----SPKASEPETGAASDQKAAEDKADKAPEQKAEAAKTEPEVDT
APEKQAGSSSEKPADKPEQPAEPVKAE----PAPASEKPAEQKEETQ--------EASAS
E----------AIPVTPGRAYN------------------------------DPREVRKR
QRA-----AEEAKKAEEAKQAG---S-N
>gi|59712355|ref|YP_205131.1|	   994 residues, 50 /line  ribonuclease E [Vibrio fischeri ES114]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------MKRMLINATQKEELRVALVDGQRLFDLDIESPGHESKKANIYKGKITRI
EPSLEAAFVDYGADRHGFLPLKEIAKEYFPQG-Y--------------------------
------------------------------------------------------------
-----------------------------------------------------------T
YQGRPNIKDVLKEGQEVIVQVEKEERGNKGAALTTFISLAGSYLVLMPNNPRAGGISRRI
-EGEERTQLKAALSTLELPQGMGLIVRTAGVGKSAEELEWDLNVLLNHWEAVKH---AS-
---------ESNQAPFLIHQESNVIVRAIRDYLRRDIGEILIDSPKIFDRARQHIQLIRP
DFLSRVKLYEGE-----VPLFSHYQIESQIESAFEREVRLPSGGSIVIDPTEALTSIDIN
SAR-AT--KGGDIEETALNTNLEAADEIARQLRLRDLGGLVVIDFIDMTPVRHQREVENR
MREAVRMDRARVQIGRISRFGLLEMSRQRLSPSLAEASHHICPRCTGTGVVRDNESLALS
VLRLIEEE----------SLKDNTTQVLAVVPVSIASYLLNEKRRSVQHIEKFHDVRVII
VPNSDMETPHFEVIRIRDGEEQE----MLSYLLPKKLEALREA------ESKEAPVVNIA
PKK-REEPVLQGFSAPTQAA---PVAKAQ--PEKK-------------AEAK--TEEKPG
IISRFFKAIANFF-SAPEVSEKTEKKVEE-------------------------------
-----------EKPAQP-QRRNQNRNND--RRRNNENGRNNRNNRRNGNDNRNENRRGKK
QDDANATTGK----------QAKANDNKP--TK---------------------------
------QPKVRKEIAEQGLKLAADAQQAP-AQNTEKQTEKREKTAQVKQRRQRRQLQKKV
RTGKAVEA---------------ENDAVVAAQVEAQQSN-TE--------VNTEKNTERK
EGQRRNRRSPRHLRASGQRRRR-RD---RRP-----------VNPSRL-SSGVASPEMAM
GK-AYPDFARILE----------------MKQAKQRQQEKFVDNETQAAQDKA-------
PKVNVQI-GGVAFPEMAMGKVLLP--YVEASVATIKEAVQAP-VVEEVKETTPA-PVEVA
VTEAPTATPVV------------------NVVAETPVEPAVAEVNEVAVAEAAVKPVVEV
EEVQPVVET----------------------------KVAPKT------------QYKGH
A----------SSGMTKATGPTEIKE-----------ITVTA--AEFRAER-FTPKQAGS
QTA-----TSQASAAMAKTAA------L
>gi|75428521|ref|ZP_00731723.1|	   962 residues, 50 /line  ribonucleases G and E [Actinobacillus succinogenes 130Z]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------MKRMLINATQKEELRVALVDGQHLFDLDIESPGHEQKKANIYKGRITRV
EPSLEAAFVDYGAERHGFLPLKEIAREYFPAD-Y--------------------------
------------------------------------------------------------
-----------------------------------------------------------V
YNGRPNIKDVIKEGQEVIVQVNKEERGNKGAALTTFVSLAGSYLVIMPNNPRAGGISRRI
-EGDERIELKEALSSLDVPEGVGLIVRTAGVGKSSEELQWDLKVLLHHWEAIKQ---VS-
---------ENRPAPFLIHQESDVIVRAIRDYLRRDIGEILVDSPKIYEKAKAHIKLVRP
DFINRIKLYQGE-----VPLFSHYQIESQIESAFQREVRLPSGGSIVIDATEALIAIDIN
SAR-ST--RGGDIEETALNTNLEAADEIARQLRLRDLGGLVVIDFIDMTPVRHQREVENR
MREAVRQDRARIQISRISRFGLLEMSRQRLSPSLGESSSHICPRCQGTGKVRDNESLSLS
ILRLIEEE----------ALKENSKQVQCIVPVQIASYLLNEKRKAIRSIEKRHNVDIVV
APNEAMETPHFSVFRLRDGEEAN----VLSYHLPKLHEVQEDV------FVAE---ESLI
SRN-IETAAVTAENMAESA--VLSMTIPE--AAPV-------------IEAK--KEAESS
LFARIVAAIKKLF-TTAPEA----EKVEE-------------------------------
------------QPV----VTRNNRNNR-R-ERNNERNNERRNSRRSRAERNTARNND--
------TAAEKPETPSRNERSNERNNRRN--ARRAALTD---------------------
------ETSANA----GTAEAV------------ETSEEKSPAPRQPRERRERRDLRKKV
RVSNET--VEQQ---AVEEVSAVAEETVTE--------------------QPSSESPRRE
RSERNSRRMPRHLRTNNSRRRR-NE-----------------VSSMPL-FAAVASPELAS
GK-VWIDSNTTSQK---------------TKESNFLSVDELLEQQTQNDEVEVST-----
PASSI-VEKAENNAQPL-GLVSQP--ANEAVEKKVQESLER--LNEEQRVLEQQ------
-----------AKASSVAEAAVE---------------------KENVIPEKKVNE----
-----PEISVKNGQ-----------------------KFDRTYRFNGRLGTISAV---RH
T----------KADMTLAKADNEVNV-----------PFDIVEWKDSRYYF-HGKGSAGH
HSA-----ISHVFSEPTKAEAK------
>gi|71282108|ref|YP_269009.1|	   1004 residues, 50 /line  ribonuclease E [Colwellia psychrerythraea 34H]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------MKRMLINATQSEELRVALVDGQKLYDLDIESPGHEQKKSNIYKAKITRI
EPSLEAAFVDYGADRHGFLPMKEIAREYFPKG-Y--------------------------
------------------------------------------------------------
-----------------------------------------------------------T
FQGRPNIKEVLHEGQEVIVQIDKEERGQKGAALTTFISLAGSYLVLMPNNPRAGGISRRI
-EGDERTELKASLSKLDLPKGMGLIVRTAGVGKDYEELKWDLSVLLHHWQAISD---AG-
---------KSRPAPFLIHQETNLILRAIRDYLRRDIGEVLIDRPKTFESVKKHIEVVRP
DFLNKIKLYTSD-----VPLFTHYQIETQIETAFQREVRLPSGGSIVIDPTEAMTSIDIN
SAR-AT--KGSDIEETAFNTNLEAAEEIARQLRLRDLGGLVVIDFIDMTPVRHQREVENR
MRDSVHQDRARIQLGKISRFGLLEMSRQRLRPSIGETSQGVCPRCSGTGHVRGVESLALS
ILRLMEEE----------AIKENTLHVQAQVPVPVATYLLNEKRRSVMHVEKHHNVRVLI
IPNPHMDTPQYEVLRVKNDETIV----EASYELPVKKAELEEA------KMPK---FDKV
AAK-RDEPLIQGMTSPTRAPK--ADESPV--KAEI-------------TTVS--KQTKPS
---GFFGWLKSLF-VAEEVVE---EVKEV-------------------------------
------------STT---QQPKKPQERR-G-----NQQAKRRNNRGNNRNRNDRNGE---
---------DATNRPIQKEN--EARDTR---PSRDEEVN---------------------
------------KPKRQPRKTI------------AVDKEKVVKEEKNTERRQRRNNRKKI
RVTPTDKVIETTEK-----LAVVSTPEIEQVNTPAVE---------------NVEVVATN
DDKPRNRRSPRHLRANGQRRRR-NN---AEN-----------NSEATQQDQALTTENITT
DESVEARYPATSV-----TEQEVVVTSTE------------EVAVETIAAAPVETKAVET
EAVETVIDVPLNDTKELDTTKTEEEVSTADVAEQVTEVQQE--LPLEQKQDVVVTTE---
--ESPEVKEAN--------AAAPVETDVTSPAI-------ETVKQETVNDTAPVAKSVEV
AETVIATQEDKVVAPKPAKKASSAVKK----AAPKDKKLARQVKKANRLSG--------H
A----------KAPMTKTETITTIKD-----------IPTNF-MADSERHV---HQSSGR
TAI-----IADVVNRSSAQATK-----P
>gi|90407029|ref|ZP_01215219.1|	   984 residues, 50 /line  ribonuclease E [Psychromonas sp. CNPT3]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------MKRMLINATQSEELRVALVDGQQLYDLDIESPGHEQKKANIYKGKITRV
EPSLEAAFVDYGADRHGFLPLKEISRNYFPNG-Y--------------------------
------------------------------------------------------------
-----------------------------------------------------------S
FKGRPNIKEVIKEGQEVIIQIEKEERGNKGAALTTFISLAGSYLVLMPNNPRAGGISRRI
-EGDERTQLKEALSHLKLPNGMGLIVRTAGVGKTAEELEWDLNVLVNHWHAIDE---AS-
---------KSKSAPFLIHRESNVIVRSIRDYLRRDIGEIVIDHAKTFEQAKKHIEMVRP
DYIDRLKLYQGE-----IPLFTYYQVESQIESAFQREVRLPSGGSIVIDPTEALTSIDIN
SAR-AT--RGGDIEETAFNTNLEAAEEIARQLRLRDLGGLVVIDFIDMTPARHQREVENR
MRESVRQDRARIQLGRISRFGLMEMSRQRIRPSLGESASRVCPRCHGQGTIRDNESLALA
ILRLIEEE----------GLKENTVQIQATVPVAVAAYLLNEKRSSIFKIEQRHNCEIFI
IPDANLLTPHFEIKRTRNDNQTE----INYDALQKQHQVYVPN------VVKNEQQ----
--K-EDEPILSGFSRPKNSPKQKHKNSTE--KAVQ-------------STQS--TEKPTS
LLSKIFASIGALF-SASPETAEP--KVEE-------------------------------
------------KPR---PRNNNNRNRN--RNRNTRTRNKNDNERSN-------------
---------DDVQKPSEENN--SRRVQK---PRDND------------------------
------------RIKKAPRKPQA-----------PIEAIE--QDGVVAVRRKRRNLRKKV
RIQQEPVITP----EVENVAVIIETEASQQTAT-----E-NVTIESSVNTAPD---LTEQ
NGVKMPNRRSRYLRNNGQRKKR-SI---SEA-----------IPGNISDESALTTDPV--
------------SSRYPDNQTEAALNVAAPVATDISTLDDHVTMAQDVEEMRND-ETPT-
QAPQILPDVN-----------VTP--EVVAVPEAVVAAPEV--VVAPEVVAAPEVVAAPE
VVATPEVVAAPAVVATPEVVATPEVVAAPEV---VAASEVVATPEVVATPE------VVA
TPEVVAA-------------------------------PEVAVITKKRIGTTSS--AKKS
V----------TAQMKKTVSSELDLS-----------APLKIEAATTRISIAKSTQQAGS
QFA-----SAKASSVTVKAV-------L
>gi|52425677|ref|YP_088814.1|	   960 residues, 50 /line  CafA protein [Mannheimia succiniciproducens MBEL55E]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------MKRMLINATQQEELRVALVDGQRLFDLDIESPGHEQKKANIYKGKITRV
EPSLEAAFVDYGAERHGFLPLKEIAREYFPDD-Y--------------------------
------------------------------------------------------------
-----------------------------------------------------------V
YQGRPNIKDIIKEGQEVIVQVNKEERGNKGAALTTFVSLAGSYLVIMPNNPRAGGISRRI
-EGDERLELKDALSSLDVPEGVGLIVRTAGVGKSSEELQWDLKVLLHHWEAIKQ---AS-
---------QSRPAPFLIHQESDVIVRAIRDYLRRDIGEILIDSPKVYEKAKAHIKLVRP
DFISRIKLYQGE-----VPLFSHYQIESQIESAFQREVRLPSGGSIVIDVTEALTAIDIN
SAR-ST--RGGDIEETALNTNLEAADEIARQLRLRDLGGLIVIDFIDMTPVRHQREVENR
MREAVRQDRARIQISRISRFGLLEMSRQRISPSLGESSHHICPRCQGTGKVRDNESLSLS
ILRLLEEE----------ALKENTKQVHTVVPVNIASYLLNEKRKAIHDIEKRHNVEILV
VPNKEMETPHFSVFRVRDGEEIN----TLSYNLVKVYEEQETT------FIAD---EPFT
TRV-TETAAVTTENVLESA--ALSMTISE--PAPT-------------IEVK--KEEQPS
LFVRIVAAIKGLF-ASEPKVE---EKVEE-------------------------------
------------APQ---PNTRNRRNNQ-E-HRNSRRNRNERNNRGNNEEPADKVQSE--
------KSAEKAERPARSER--TRRNNR---NRNAAAD----------------------
------DSLN----NESVIEAV-------------TNETTDDEAKAPQQRRQRRDLRKRV
RVTEEQVTVA--------------AEPVDKPSLAESVPV-EPVVEENV--------YQER
DRQDNRRRLPRHLRVNNQRRRR-NA----EQ-----------VSAMPL-FAAVASPELAS
GK-VWIESPTAPAK---------------PKESAFLSVDELLEQQSEVKQPGVT--TPA-
PATQVIFDKADNDIAPLASFVTQP--ANESVQKKVQESLDR--LEQTNGQQTEVKEDDNA
SN--------------------------------------------------MTLSDVTA
TESAVEKTEVLNLS---------------------------NYRFSGRLGTISAV---KH
T----------KAEMTLAKAADEVLP-----------PFEIVQWQDSRYYF-HGKGSAGH
NSA-----VSHVFTAATQAKAE------
>gi|68249015|ref|YP_248127.1|	   951 residues, 50 /line  ribonuclease E [Haemophilus influenzae 86-028NP]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------------------------------------------------------MRFIL
RFFKYLIRELTMKRMLINATQKEELRVALVDGQRLFDLDIESPGHEQKKANIYKGKITRV
EPSLEAAFVDYGAERHGFLPLKEIAREYFPDD-Y--------------------------
------------------------------------------------------------
-----------------------------------------------------------V
FQGRPNIRDILTEGQEVIVQVNKEERGNKGAALTTFVSLAGSYLVLMPNNPRAGGISRRI
-EGDERTELKEALSSLDVPEGVGLIVRTAGVGKSPEELQWDLKVLLHHWEAIKQ---AS-
---------QSRPAPFLIHQESDVIVRAIRDYLRRDIGEILIDSPKIFEKAKEHIKLVRP
DFINRVKLYQGE-----VPLFSHYQIESQIESAFQREVRLPSGGSIVIDVTEALTAIDIN
SAR-ST--RGGDIEETALNTNLEAADEIARQLRLRDLGGLVVIDFIDMTPIRHQREVENR
IRDAVRPDRARIQISRISRFGLLEMSRQRLSPSLGESSHHICPRCQGTGKVRDNESLSLS
ILRLLEEE----------ALKENTKQVHTIVPVQIASYLLNEKRKAISNIEKRHNVDIIV
APNEAMETPHFSVFRLRDGEEVN----ELSYNLAKIHCAQDEN--------TE---ESLL
SRN-VETTAVIEQPAVESA--VVALSISE--AAPT-------------PVER--KSNEPS
LLAKIIAKIKGLF-ATKSEE----------------------------------------
------------------NKPKNNRTSR-NPNRNQRRSQDRRSSRRPRSENN----ETER
TE-----------EQVRNVR--ERNQRR---PRRNLVEE---------------------
------------SIAESAVNST------------PVFEAKEERTEPVTQRRQRRDLRKRV
RVEDNETVVENN---FSTTEKMPEVDVI---------TV-QNNDEKPVHQ------NQRS
ERQERQRRTPRHLRAANNQRRR-RN---QEP-----------KSPMPL-FAAVVSPELAS
GK-AWIDYSTVNL----------------PKENHFLSVDELLEQEKTKKGFIT-------
PAMGIVVEEKSPDVKPALDFITQP--ANESVQKKVQESLDR--LSS---YKPQEVVESI-
-----------------------------------DPAINVDEP----------------
-------ETLEKVS-----------------------KFVRTYEFNGRLGTISSV---PH
T----------KAEMTLAKANDEMPE-----------AFPIRAWQDSRYYF-YGKGAAGH
HCA-----ISHVYSEPTRAKSE------
>gi|46143575|ref|ZP_00134935.2|	   992 residues, 50 /line  COG1530: Ribonucleases G and E [Actinobacillus pleuropneumoniae serovar 1 str. 4074]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------MLINATQKEELRVALVDGQRLFDLDIESPGHEQKKSNIYKGKITRV
EPSLEAAFVDYGAERHGFLPLKEISREYFPAD-Y--------------------------
------------------------------------------------------------
-----------------------------------------------------------V
FNGRPNIKDIIKEGQEVIVQVSKEERGNKGAALTTFISLAGSYLVLMPNNPRAGGISRRI
-EGDERLELKEALDCLDVPEDVGLIVRTAGVGKSPEELQWDLKVLLHHWEAIKK---AA-
---------ESRPAPFLIHQESDVIVRAIRDYLRRDIGEILIDNKKIFEKAKNHIRLVRP
DFINRVRLYEGE-----VPLFSHYQIESQIESAFQREVRLPSGGSIVIDVTEALTAIDIN
SSR-ST--RGGDIEETALNTNLEAADEIARQLRLRDLGGLIVIDFIDMTPVRHQREVENR
IREATRQDRARIQFSRISRFGLLEMSRQRLSPSLSEASSHVCPRCQGTGKVRDNESIALS
ILRLLEEE----------AIKENTAQVHTIVPVQIASYLLNEKRKAISSIEKRHDVQVVV
VPTESMETPHFSVYRLRENEVLP----TLSYDLAKHYHDREEDTQLNTHTVSE---EVLV
TRN---EPVITVESVLQSS--ELNL-QPA--PTPV-------------------EPAKPS
LLSRLIAKVKSFF-APEEKAE---------------------------------------
------------------EKPKPKARNQ-R-DRRNRRERPNRADRQERKQTQT-------
------QDEQKAQRQERNQE--RNEAKK---ARRQVVEE---------------------
------V------------------AGVQ-E---TQTEQRSNKDNATTERRQRRDLRKKV
RVENVETSIVTTEPITQPIEEKVQNIAQIQPL-----VA-QETQPETV----NEERQDVR
E-NGRQRRLPRHLRVGNQRRRD-NN---NRK--------ENVVAAMPL-AAAVASPEMAS
GK-IWVKFSEPVSTNKPNSKA--------EEKARFLSVDEMLEQQTTE--VNEPI-----
VESNIE-NNSASSVAPVVGFIKQQ--SDRDLVKENKARLHH--QVEESEQADEQ------
-----------LVEKAMAKHVAPLGGF----VSQHSDRDLVKEKNERVQKFQAQATQVPA
IGNATAEAISVPVS-----------------------NYQSDYSFNGRLGTFSRV---MH
T----------KAEMTVASAPEKALE-----------TVTVNEWTQSKYYF-YGKGFGGH
SSA-----VSHVHSAPRVANTD---H-E
>gi|27366289|ref|NP_761817.1|	   1033 residues, 50 /line  Ribonuclease E [Vibrio vulnificus CMCP6]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------MLINATQKEELRVALVDGQRLYDLDIESPGHESKKANIYKGRITRV
EPSLEAAFVDYGAERHGFLPLKEIAKEYFPDG-Y--------------------------
------------------------------------------------------------
-----------------------------------------------------------S
YQGRPSIKEVLTEGQEVIVQIEKEERGSKGAALTTFISLAGSYLVLMPNNPRAGGISRRI
-EGDERTELKSALSTLELPQGMGLIVRTAGVGKSAEELEWDLNVLLKHWAAIKD---AS-
---------ESNPAPFLIHQESNVIVRAIRDYLRRDIGEILIDSNTIYERAKEHIQLVRP
DFVNRVKKYDGE-----VPLFSHYQIESQIESAFQREVRLPSGGSIVIDPTEALTSIDIN
SAR-AT--KGGDIEETALNTNLEAADEIARQLRLRDLGGLVVIDFIDMTPVRHQREVENR
LREAVRLDRARVQIGRISRFGLLEMSRQRLSPSLAEASHHICPRCSGTGVVRDNESLALS
VLRLIEEE----------ALKDNTAQVLAVVPVPIASYLLNEKRRSVNHIERIQEVKITV
VPNSDMETPHFEVIRVREGEEVD----LLSYLLPKKLEAMKEA------EGKESPETEYK
PKK-IEEPVLKGF-----A--SPAQSVPA--PAPKA-------AVAKVANEKPQAEEKPG
LFGRLIKALGSFLFGSAEEKVEA-EKTER-------------------------------
------------KD----EREKGNRRQK-R-DRNDRRRNNRDNNRENNRDRDGKRRQRNR
DE-NVVETQDEAIKPRSQQK--RKQRPA---QNKADNAV---------------------
------ESKANAKVAEKGLQLAAEAQGAS-K---QEGQKTPSKAEKVKERRQRRKLNKPV
RVKDQLEQAE--ET-LMDAAPVVEAETFNKQNTPASEKA-EKVVADTVDAMDN---SENE
EKPRRNRRSPRHLRASGQRRRR-GR---DRR-----------PNPFRLRKGGVASPEMAM
GK-VMPRYIPKP-----------------VAKKEEMVKEEVVTAVTAVPAMQGGVACPE-
MAMGKVIIRRDITAA------------QTPTETKPKRSKSR--NNKPAKAAVVEVVTEEP
TVEN---AVVATIQETDVQKIEPQVESVSQP-------VEQVSV----ETTEVVAEIVET
TEVVAEVESATE-------------------------TVANETEATVAVVESSIKVIKAQ
A----------SAPMTKAPGPQELIE-----------IQVVAAPFKAER---YAQRGAGS
QVA-----TSQASAAMTKPEM------V
>gi|114326947|ref|YP_744104.1|	   949 residues, 50 /line  ribonuclease E [Granulibacter bethesdensis CGDNIH1]
----MSCHAPQALARIRLRLCVPFATIHR------HNVMPGGARRSR-------------
--------ISRVCTG---------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------AHYSMTKKMLIDASHAEETRVVVMDGNRLEDFDVEAASRKQIKGNIYLAKVVRV
EPSLQAAFVEYGGNRHGFLAFSEIHPDYYQIPVADRQRLLAMQEEEAREEEEAEEAEFSA
AEARRSASRPLNNAR------------EVIQADSEQPEASDPQEDGADHGVQDESAADFS
GEAGDEGSVPASAGEGDDQEESRQASRPARQKED-------------------RERRSPR
FLRNYKIQEVIKRRQILLIQVVKEERGNKGAALSTYISLAGRYCVLMPNSPRGGGVSRKI
TSATDRRRLKDIIGALEIPRGMGIIVRTAGGNRPKAEIMRDCEYLLRLWDDIRD---IT-
---------LRSSAPALIHEEASLIKRAIRDVYTSTIEEVLVDGEEGWRAARDIMRMLMP
SHARKVICWNADKERAGQPLFAHYQVESQLDAILAPNVSLKSGGYLVINQAEALVAIDVN
SGR-ST--KERGIEETALRTNLEAADEVARQLRLRDLAGLIVIDFIDMESRKHNGMVERR
LKEALKNDRARIQVGQISSFGLLEMSRQRLRPSLTETSMITCPHCNGLGLVRTTEGASVH
VLRAIEEE----------GARRRYAEIMVHAAADVAFYILNNRRDFLATLESRFGMKVLF
SADTQFSGSQLRIEKIRARAM--E----DVVRTPLIGVADPQPSVA--------GDLYDF
ADA-SDGFATFEAAPV------------A--ALPVAVQAE-------------------P
VGT---------------------AEEGNNGG--RLPSAEG-------------------
------------------------------------------------------------
----DSEPGPDDGERRRRRRRRRRGNRRNDGAENGMDARSEQDENG--------NPVEEG
EGVRHGDANT--SALPV---------------ETTELTV---------------------
------------------------------------AGVASKETSA-------ETQGDAI
DGTQAVSGEFGDEFAEDSRPRRRGRRGGRGR-----------R-----------------
------------------------------------------------------------
----------------------QPAQANGHDAGEVAYTGPTPADP-------FGQQPL--
------------------------------------DVFDVMDGIEQPMI----------
-------------RDGKVDQGSRSERHPDLVPEPVVVSEEQA--EP---YIAPPIQPVVI
EDTAP-R---------------ARR------------GWWKR------------------
----------------------------
>gi|77462682|ref|YP_352186.1|	   936 residues, 50 /line  Ribonuclease E [Rhodobacter sphaeroides 2.4.1]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------MAKKMLIDATHPEETRVVVVDGNKVEEFDFETVNKRQLAGNIYLAKVTRV
EPSLQAAFVDYGGNRHGFLAFAEIHPDYYQIPVADRKALL----EEERAYARAEDDEDHG
RSRRRSRPAPAAAASGDAVQSGDVAGMDVVDLGEETGADALYETDGSDAGAADSGQPEAP
DADEKPYRAMDHASDGDD--EIESVADEDVAEEI-------------------PAPRKPR
-SRRYKIQEVIKVRQIMLVQVVKEERGNKGAALTTYLSLAGRYCVLMPNTARGGGISRKI
TQAADRKKLKEIASELEVPEGAGLIIRTAGAKRTKQEIRRDYEYLLRLWEQIRD---LT-
---------LKSVAPAPIYEEGDLIKRTIRDLFNREIEEVLVEGETGYRTAKDFMRMIMP
AHARQVIRYDEP-----MPLFARYQVESYLSGMFNPVVQLKSGGYIVIGVTEALVAIDVN
SGR-AT--KEGSIEETALKTNLEAAEEVARQLRLRDLAGLIVIDFIDMEERKNNAAVEKR
LKDKLKTDRARIQVGRISGFGLMEMSRQRLRPGMLESTTQPCAHCHGTGLIRSDDSLALQ
VLRQLEEE----------GTRKRSKEVLLRAPIAVVNFLMNSKREHIAMIEARYGMAVRV
EADPSLSSPDYVIEKFKTATRVVP----EAVKVI--------------------------
-----SGSADLMGAPV------------D--------EPE-------------------D
DWV---------------------EEEPEIVEEAEEVADAA-------------------
------------------------------------------------------------
----EAAPSEGQPKKKRRRRRRRRNGVNGANGSDAQENGDEGDES------------DED
EGDAADEPEAVEAAAAV---------------PELAPEA---------------------
------------------------------------VVSAPEPAAA-------EPEPTPA
DPVAAPAAE----EPAAPRKRTRTRKPKVTE-----------E-----------------
------------------------------------------------------------
----------------------APAE----AAAEAPAEAPAAEAP-------AKEAKKPR
T---------------------RTSRSRKTAAAAEAVPAVEVAVTVDETP----------
-------------AEASLEIARTTEAA----PETTPRRPPPKPPPP---KRLWPKRLRRS
PSRWP-RRRARARTTSPSAAAGGRS------------AADLQRLTQGRLRA-PLFVPAGA
DGRLARWPTARAGGIPGLRDL------R
>gi|119025257|ref|YP_909102.1|	   937 residues, 50 /line  ribonuclease G [Bifidobacterium adolescentis ATCC 15703]
MPRSVVPTTNEGLDQVEAVVSSDNSTNNAASSAGSVSADPAPRRRRG-------------
--------GRRVVRGVGAAGASLELKVEEHAKAPLFEEPKLEPVQPARDSADF-----ND
ADDAEPSRPRRRRVTRYDDDDEMRDERPRRRRRSSVDVQDEDDRPSRRRRRISDEPRDDR
DDRDDYGNRGNRDES------SEDRALDAVSALPEGHETRHNPRP---MTSLLFQEPILP
AAPAGRGSSDD-----------DDADDTGRRGSDDARDSRDDRDDDRPTRRRRRRSHDTA
----DTDRTDASNDGRGRDDGNDRNNDAED-----------------DDHGDSRRSRRSR
RLNAQE--RRAAAEVEQIEEDLVLDGITYAPIDDESRNGNDDDDEQPTRTRRR----RRG
RGNHEEADEQQTSERE---SRRRHEDDDEEE-----------------GTVTRRRRRRRG
GSKAEESDETMSRRSR-------KQQYIDEITDVEGSTRLEAKKQRRRDNRRERSRQNQL
MEQDFLARREHVERLMVVRERERHTQISVIEDNVLVEHYVSDIQEVATVGNIYLGRVQNV
LPSMEAAFVDIGQARNGVLYAGEVNWDSARLE----------------------------
------------------------------------------------------------
------------------------------------------------------------
-GQPRRIELAFKSGDPVLVQVTKDPIGHKGARLTSQVTLAGRFLVLVPSGGMTG-VSRKL
-SERERARLKNIVSKI-APKDMGVIIRTAAEGASEEAITKDLENLVRQWERITA---KR-
------DEFLHGKRPKLLQGEPDVAIRVVRDIFNDDFSKMIVEGDRVYERIEEYLDTMAP
DLKDKLEKWDPAE-HDGKDVFDKWQIDSQLRKGMERQVYLPSGGSIVIDRTEAMTTIDVN
TGRFIG--RGKSLEETVTRCNLEAAEEIARQLRLRDIGGMVMIDFVDMVMPANRDLVLRR
LVECLARDRTKHQVAEVTSLGLVQMTRKRIGQGLVEAFSEECPTCKGRGFILHDEPTVSA
DY---DDP----------YALKGGDP-----------FVKTNKHGH--------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-GTDVQVPKGSSPDVKA---------------KLAQI-----------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---AAAAVAANNADLGEEEQE------E
>gi|125561084|gb|EAZ06532.1|	   1065 residues, 50 /line  hypothetical protein OsI_027764 [Oryza sativa (indica cultivar-group)]
MAARALGPP-----PPHALGATRQAPRCPHAAAADASAPPTHGYRRGAAALGSALSARRG
RHTLCSVQLMDALRGGNLQVEPNMLHSPKPL----MSTRRDDSAITCKGFCTISWNLKSD
VLDGYIIFVTGDPVTLGCWESDMAVQLSPSVESNNLWTA-EIKVPYGVHFKYNYFVREEN
DASSDIIWRPGPEYSLSIPPVGRKKHVIVVKDLWMKTSVAGIPTPS--WGSWLMEANFLE
DQFAKSGEHQN-------IVKAHSVIDTVDRASSVGEHIILRLGNGTPLHVKNISENPSA
SVHDDFTVTDKANSIKSSISEHERNQPVEEPWIL-GSVMAAKKSVAAGKHEKNRWKFVNK
KQNLSEVSENIPEQDQPVEEPWLFQSKVVAKKP---------------------------
------------------------------------------------------------
--------------------------------VVQTKGKIEAKDIIRKL-RKMDKPPAPL
EEDKATSGEPSSRVIVINSSVCTMQRIAVLEDGKLVELLLEPIKNNVQ------------
---CDSAFVDIGLSRPSLMSIKQNRDPFVYPQIVKNAKRD----SANFS---DYNDDSLP
-TYEDEDDDMTDGELAD---------EENDDESSAFPAEVVSENEEHMAFLPNSKINMIH
SAEFESISSYDEEK----DDEIDDHMEDEYNEDLLPGDQSEVSNDLKTLSSIQHALRESS
DDTNGSRWSQVRKGTKIMVQVVKEGLGSKGPTLSPFPCLRSRFWILVSRGNKVG-VSKKI
-TGIERTRLK-GITKLLRPPGFTLTARTVAAGHSWEELQKDLDRLLSTWKGIIE---HAQ
SAALAAEEGVEGAVPVMLHRSKGQALSVVQDDFNEKVKRLVVDSPRTYHEVTNYLQEVAP
ELCNRVDLYEKR-----TPIFDEYKIEKEIDNILCKRVPLHNGGSLVIEQTEALVSIDVN
GGH-SMFGQGTSQEKAILEVNLEAAKQIARELRLRDIGGIIVVDFIDMTD-----DIFEE
MKKAVEKDRSTVGVSELSKLGLMEITRKRVRPSVTFMISEPCPCCHGIGRVEALDTSFSK
IEREICRRLAASGHKSDPEKPKSWPRFVLRVDHEMCTYLTSGKKTKLGLLSSSLKVWIL-
----------LKIARGFARGA---------------------------------FELLPY
SD----------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------------EKETD-----------E-----------------
------------------------------------------------------------
----------------------RKEETSES----PPKEAGSPKLS-------VFP-----
------------------------------------------------------------
------------------------------------------------------------
IKKWM-SRAKRAK-----------------------------------------------
----------------------------
>gi|126640478|ref|YP_001083462.1|	   1041 residues, 50 /line  ribonuclease E [Acinetobacter baumannii ATCC 17978]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------MREIANSYFQADPR--------------------------
------------------------------------------------------------
------------------------------------------------------------
--QTSNIRELITEGTELLVQVEKEERGNKGAALSTFISLAGRYLVLMPNNPKGGGISRQI
-SGSVREELKEILASLNVPRGMSVIVRTAGIGRTQEELQLDLQHLLDLWAQIQG---TA-
---------SSGPSPMLVHQEAGVVTRAIRDYLRDDVAEILIDSEQAYNEAYNFVKAVMP
RQLDKLKTYTLN-----EPLFAHFGIESQIQTAYEREVKLPSGGSIVIDQTEALVSIDIN
SAK-ST--RGHDVEETALNTNLEAAEEIARQLRLRDIGGLVVIDFIDMTKERNQRMVEAK
LREATQSDRARIQFGQLSRFGLMEMSRQRLRPSLEEATGYVCPRCHGTGMVRDLRSLSLS
IMRKVEEI----------ALRERHGEVQVEVPVEIAAFLLNEKRHSLVYLEQTSGVRVTV
LPHPHLETPHYEIAYNPDGFAPSS----YERTEATRSSEKELGYES--------SEWHLE
EAD-HGHAHVTATASTHAAAQ--KKANHA--TQPVAQPSA-------------------Q
KAASPCAWLENLF-VQKQAQTVDQSRSAQNAAAAIEQMVNTGAVSRGQFGQVAVPAVAEV
APVQSNNAYISQSPVKQDVREHVEKDDKSQQQRQNNKKRKHKEQREQHHQSHEQQHQVHE
EVVQLSRQEQRELKRQQKRQQQQDQQHQNNDVQHTENAVPRRDR-N--------NQQRPN
RPNRHRDPSVLNENQNT---------------PVVVDEKQIKVDVIDAPKHDVMNTALII
NVDQGQSEIVALTPERRHVERVETTSTEVAQEPTPAPVVAEKAAVV-------ETKEEAQ
PSQEAAQPQI-KRASNDPRMRRRQQREAKHA-----------KAATPS-IAPSQIPTLAQ
HT-IGSLIRHVYGEDCTVLIEQFGLVPTFNRALQKF--------------------AEQY
ASTLVVEVTAET---EEKKPVTRDAELPSHKPAEEAEPAPVLPLT-------PPQAPAPR
VANDPRERRRLAKLAAEQAFEQVKQQHSAQEEVATPAPVAEETVAAPTAE----------
-------------TQATVEPAQQPLEL----NQSTEVVQPEAAPAE---EKATEETVAEA
PAAKE-PAPSKAASKAKAAAEETVA------------PAEATTDTESEDVK-ADKDKPSR
PRRPRG-----RPPKKANPVA------E
>gi|84498597|ref|ZP_00997360.1|	   1003 residues, 50 /line  hypothetical protein JNB_20433 [Janibacter sp. HTCC2649]
-------------------MATQDEPTTQNDASTTDGA---------ESAPAKAPRRRRA
TKKAAAPVIAETATDAGSEPAAEPAAD----EATEAAPKKKAAKKTAKKAAPRKRATKKA
VAQQEALLEEPTTVDEPLVEEDEALVEEPVVEPE----PEKVEAPKVVP-----------
------------------------------------------------SFGILFQAPDVT
AAPRRRRATAPAQAPSEGTIDSAPEAEAPAPTRDKSAKAEIDAPAEKPTRSRRGRAAKTV
------------------------------------------------------------
------------EAAEPTEDDQAVEDQSG---DDDSREDSGDEPQEGARRRRRGGRGRRG
RGGNERSDDNASDDATSSDSAESSDDSDESDDQDARADDGADNENGDGGTSRRRRRRRRS
GSSADGDDPPGTVTKVREPRKERERERSDEPTAVKGSTRLEAKKQRRREGREAGRRRTII
TEAEFLARRESVERIMTVRGKGDKTQIGVLEDGVLVEHYVSRETNASMAGNVYLGRVQNV
LPSMEAAFVDIGKGRNAVLYAGEVNWDAAGLEQN--------------------------
------------------------------------------------------------
------------------------------------------------------------
--RAKRIENAMGSGDTVLVQVTKDPIGHKGARLTSQISLPGRYLVYVPEGSMTG-ISRKL
-PDTERARLKAILKEV-VPEHAGVIVRTAAEGASEEELRADVERLTKAWEKIQQKVAAAS
SK-----KAGSGGAPVLLHGEADLTVRVIRDVFTEDFSELIVSGDQAWAEVSGYVEDVAP
DLAKRLTHWTSE-----EDLFSHHRVDEQISKAMDRKVWLPSGGSLVIDRTEAMTVVDVN
TGKFVG--SGGNLEETVTKNNIEAAEEIVRQLRLRDIGGIIVIDFIDMVLESNRDLVVRR
LLECLGRDRTKHQVAEVTSLGLVQMTRKRVGSGLIEVFSEQCEHCAGRGIIVQSEPVD--
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------------------------RTGTSNEHGHSNGAVG------
------------------------------------------------------------
------GQGGDKSGSASSRGRNRRGKADSGQASAPKDATVE-------------------
------------------------------------------------------------
----------DAPPVRSGPTAAQIAAAAHAAAIKSLSGESTDDDVA-------DLAGPAD
DESTQPTHTPVVESSEVSEPSE--------------------------------------
------------------------------------------------------------
------------------------------PSHTEPAEPAEPAEP-------TQVAPATV
IAEVGRP-----------------------------------------------------
------------------------------------------------------------
----------DSADDTEAVRPIVAE------------PAPIDQPVVRPRRK-RGRVVAPA
GPP-------KTADLEQGEND------R

Ad blocker interference detected!


Wikia is a free-to-use site that makes money from advertising. We have a modified experience for viewers using ad blockers

Wikia is not accessible if you’ve made further modifications. Remove the custom ad blocker rule(s) and the page will load as expected.