Fandom

Proteins Wiki

At2g04240.1/MSA

< At2g04240.1

47,922pages on
this wiki
Add New Page
Talk0 Share
--------MGLSSL------------P---GPSEGML-----------------------
------------------------------------------------------------
--CVILVNTALSISI---------------VKGIVRSFLGIVGISL--SPSSS-------
------------------------------------------------------------
-----------SPSSVTVSSE------NSSTSESFDFRVC------QPESYLEEFR--NR
TPTLRF-------ESLCR------------------------------------------
----------------------------------------------CKKQADNECSVCLS
KFQGDSEINKL-KCGHLFHKTCLEKWIDY--------WN--ITCPLCRTPLVVVPEDHQL
SSN---------------------------------------------------------
-----------------------------------------------------VW
>gi|108710109|gb|ABF97904.1|	   164 residues, 50 /line  Zinc finger, C3HC4 type family protein [Oryza sativa (japonica cultivar-group)]
--------MDPD--AA----------L---RVELVGV-----------------------
------------------------------------------------------------
-VAVGAVVVVLAAGAFPGGRWRK------RAAARVDDVERALGAAT--LMTYEQAA----
------------------------------------------------------------
------------------------------------------------------------
---------------------AAAA--------------------------------KKA
SSSSR-------------------------------------AAAAAEEQGEDRCAYCQS
EYAGADEVRVV-QCGHFFHAGCIDRWLR---------KH--RRCPLCRGGLSPLPPLPKP
GCR--PM----P------------------------------------------------
---PRTSRPAASSATAT-----------------ASA----------------AG
>gi|115460100|ref|NP_001053650.1|	   162 residues, 50 /line  Os04g0580800 [Oryza sativa (japonica cultivar-group)]
--------MSFP--LV----------C---FCRQIPR-----------------------
------------------------------------------------------------
--PIVALFKLLQAVA---------------LAFV--LILCFLGLYE--FPYTVEDH----
--------------------------------APLIHGRRR-----DPLGDD--------
--------------------------------------GL----------QPEAVK--RG
LPLVEY-------MQLADL-----------------------------------------
----------------------------------------SADCHDGESGYPATCRVCLE
RLEATDEVRRLGNCTHAFHIGCIDRWIDL--------GE--VTCPLCRSHLLPRQRR---
-GL------LGS------------------------------------------------
---R--------------------------------R----------------FG
>gi|140039895|gb|ABE93449.2|	   142 residues, 50 /line  Zinc finger, RING-type [Medicago truncatula]
------------------------------------------------------------
------------------------------------------------------------
-------MTLQGFVS---------------------LIFNLIGLAE--TQTNN-------
---------------------------------------------------D--------
--------------------------------------AI----------LPYIVA--TS
IVPNKT-------NQ---------------------------------------------
----------------------------------------QSSESSSTTNDVGLCCVCLS
MLNNKDEIRVL-PCSHEFHKVCVDSWLKG--------HH--KTCPLCRFSMGVEEKSHHR
AEM------FSE------------------------------------------------
---EMLIWFSSFHIAARYPNR-----------WTTME----------------FL
>gi|92893514|gb|ABE91788.1|	   151 residues, 50 /line  Zinc finger, RING-type [Medicago truncatula]
--------MGLS--NF----------P---YAAEGVV-----------------------
------------------------------------------------------------
--PVIVMNTVLSMVL---------------LKNM--FRSMLQVVGC--TSTTNSSY----
--------------------------------SPNIMEELE-----EEQVYS--------
--------------------------------------QE----------ISNSRE--RR
VSITQYKFLCYNRSNIARS-----------------------------------------
----------------------------------------SSSC--GWTSPMVECCVCLS
GFEANQEVSEL-PCKHFFHRGCLDKWFDN--------KH--SSCPLCRSM----------
------------------------------------------------------------
------------------------------------------------------D
>gi|66824627|ref|XP_645668.1|	   161 residues, 50 /line  hypothetical protein DDBDRAFT_0202843 [Dictyostelium discoideum AX4]
------------------------------------------------------------
------------------------------------------------------------
--------------M---------------AHNN--LRNFIENINI--------------
-----------------------------------RFDNQE-----EEIDIE--------
--------------------------------------RI----------KFALKH--RP
VPPISEYQFNEITEEI--------------------------------------------
------------------------------------------TINEKNKTRIGDCTICLC
EFPIDTEALKL-PCKHYFHHECLDSWLK---------TS--AACPNCRYPLPTIDAEYES
MVR------IVR------------------------------------------------
---DYELKNGSTNSSTTTNNNDDDNDNDRRYYSNNSM----------------YS
>gi|15233117|ref|NP_191705.1|	   170 residues, 50 /line  BRH1 (BRASSINOSTEROID-RESPONSIVE RING-H2); protein binding / zinc ion binding [Arabidopsis thaliana]
--------MGFP--VG----------Y-----TEVFL-----------------------
------------------------------------------------------------
--PKLFVQTLSILGF---------------IRTIVFSIFRFLGLSD--FLEMDQTW----
--------------------------------PDYTSYPTR-----IPETRS--------
--------------------------------------PF----------SALLIR--EI
LPVIKF-------EELTNS-----------------------------------------
-----------------------------------------------GEDLPENCAVCLY
EFEGEQEIRWLRNCRHIFHRSCLDRWMDH--------DQ--KTCPLCRTPFVPDEMQEEF
NQR------LWA------------------------------------------------
---ASGVHDFHC---------------------PVTE----------------LL
>gi|125532093|gb|EAY78658.1|	   133 residues, 50 /line  hypothetical protein OsI_032617 [Oryza sativa (indica cultivar-group)]
------------------------------------------------------------
------------------------------------------------------------
--MVVVVSHVMALLS--------------------------SALSG--KKAAAEG-----
-----------------------------------------------DGDDD--------
--------------------------------------G---------------------
-------GQCRCWRDG--------------------------------------------
------------------------------------------DGVGGGQVAAAGCCVCIS
GFRDGEEVRRL-PCGHAFHRDCVDRWLALY------CRR--RTCPLCRLHVGGAVVAAAV
AGL--DELQLGD------------------------------------------------
---DLVIWFSSLFVA--------------------------------------GF
>gi|15238072|ref|NP_198956.1|	   176 residues, 50 /line  zinc finger (C3HC4-type RING finger) family protein [Arabidopsis thaliana]
--------MGYP--VG----------Y-----TELLL-----------------------
------------------------------------------------------------
--PRIFLHLLSLLGL---------------IRTLIDTGFRILGLPD--FLESDPVS----
----------------SSSSWLE---------PPYMSTAAH-----HHQESSFF------
-------------------------------------FPV----------AARLAG--EI
LPVIRF-------SELTRP-----------------------------------------
----------------------------------------------GFGSGSDCCAVCLH
EFENDDEIRRLTNCQHIFHRSCLDRWMMGY-------NQ--MTCPLCRTPFISDELQVAF
NQR------VWS------------------------------------------------
---ESEL---------------------------LAE----------------SN
>gi|72536737|gb|AAZ73388.1|	   134 residues, 50 /line  At1g63840-like protein [Arabidopsis lyrata]
------------------------------------------------------------
------------------------------------------------------------
-----FLYLLSFLGL---------------IRKLISTMFKVIGLPD--FLEPEPVS----
----------------T--SWPD---------PPPTLT---------KPES---------
--------------------------------------------------AAILAG--EM
LPVVRF-------SDLNRP-----------------------------------------
--------------------------------------------------ESECCAVCLY
DFEKDDEIRRLTNCTHIFHRGCLDRWMMGY-------NQ--MTCPLCRTQFIPDHLQLEF
NQR------L--------------------------------------------------
-------------------------------------------------------
>gi|29367335|gb|AAO72540.1|	   250 residues, 50 /line  ring zinc finger protein-like protein [Oryza sativa (japonica cultivar-group)]
-------MVCVA--IE----------Y---RMRRGQR-----------------------
-------------DRAPASADEERGSDGSSSSSDDDVTEDDRRG----------------
-SCTDCVSIAKHLES---------------ANTMFSFIWWIIGFYW--ISAGGEDVI---
---RDAPQLYWLCIVFLAFDVFF---------VVFCVALAC-----IIGIAVCC---CLP
CIIAILYA-------------------VSD-------QEG----------ASEDDI--RQ
IPRYKF-------RRTDEPEKQTAD--------------------------------ETG
PFGGIMTEC---------------------------GT--NQPIEKVLAPEDAECCICLS
AYDDGAELREL-PCGHHFHCACIDKWLH---------IN--ATCPLCKFNIRKSGSSSGS
EE----------------------------------------------------------
------------------------------------------------------V
>gi|115446717|ref|NP_001047138.1|	   233 residues, 50 /line  Os02g0557300 [Oryza sativa (japonica cultivar-group)]
----------MSCTSP----------D---PPDYCSAASPELKLYQAF------------
------------------------------------------------------------
------------------------------------------------------------
----------IFSVPVFFTFVLLLFFYLFYLRRRR-----------ANWQSLRMRTNNL-
-----------------------------IRGDNPRLECG----------IKKEMR--EM
LPVVVF-------K----------------------------------------------
---------------------------------------------ESFLIRETQCSVCLA
DYQPDERLQRIPPCGHTFHIDCIDHWLST---------N--TTCPLCRVSLLPSPKTASI
D--------------PVDLEAQTVEENSSLDVQYQ--------------------EGRID
ENTRQEDQTLQQGSEGPTHQAEENEETSVRVTTEPQVE-AEGSPSTTCRPCKTKK
>gi|147784488|emb|CAN74950.1|	   245 residues, 50 /line  hypothetical protein [Vitis vinifera]
--------MAIL--VG----------P---RCSILRQPDLVA---------DGEDDEGLL
SDVFFMEFHVR---------------------DAILNYWLEDDSPIRLRDVNTIGPMRRR
LFVVRRDQLLRSQSL---------------AFEHVSLLLFLMGXPS--ILHASFVQEIRS
GAVL----LANETTNIGRRIIPMVVDIDLWYMGEEEEEEEE-----DEDESNEIMAEVM-
-----------------------------R--------SS----------LNDVTX--LS
VPATRA-------SI---------------------------------------------
------------------------------------EA--LEKIKFEDVNSTDKCIICLE
EFATESEVSRM-PCSHVYHKDCIIQWLER--------S---HMCPLCRFKMPAISS----
------------------------------------------------------------
-------------------------------------------------------
>gi|19173466|ref|NP_597269.1|	   252 residues, 50 /line  hypothetical protein ECU08_1410 [Encephalitozoon cuniculi GB-M1]
--------MCLQMSIY----------R---ASAYVILQMLDVSVYMPLYAIHGGNRLGEK
LTLKNVKIEARGAEELFGHLAKHGEEEGNYSVDSLEIYRIEDQGNVDSHG----------
--GASKDITFGTMSF---------------DFS---MLKTILSQNS--QQSPGYSPEVRI
KSIEIRIPLAVQIFLHIPIVLVAVIVFYLF---LSFGIE-------------------E-
-----------------------------R--------GG----------LSDKEI--EK
IPLCPY-------S----------------------------------------------
----------------------------------------------GQEFINKGCIICLE
DFEDGGYVRSL-DCGHAFHKECVDRWLR---------KN--FVCPICRSKMAVEYGRPGH
E--------------RRRVHI---------------------------------------
------------------------------------------------------L
>gi|92899044|gb|ABE94510.1|	   157 residues, 50 /line  Zinc finger, RING-type [Medicago truncatula]
--------------------------------MTILS-----------------------
------------------------------------------------------------
------------------------------------------------------------
---ELLYQLYVKTIVLFTYMLIELILVICYLKSTKNPIT-------------------T-
-----------------------------T--------QY----------L-NFIE--EK
NPTTRL-------K----------------------------------------------
----------------------------------------------KLAAEHIDCRVCLS
EFEEGDIVRSL-NCEHTFHKDCLDKWFLQ--------EQYCATCPLCRNKVLSDDVVSKY
C--------------LLQNQV--EFDV---------------------------------
--------------------IDDEFMTLLSSLRGGSIW-Y------------RYL
>gi|9743343|gb|AAF97967.1|AC000103_17	   131 residues, 50 /line  F21J9.24 [Arabidopsis thaliana]
--------MGLS--HF----------P---TASEGVL-----------------------
------------------------------------------------------------
------------------------------------------------------------
---PLLVMNTVVSITLLKNMVRSVFQIVASETESSMEID-------------------D-
-----------------------------E--------PE----------D-DFVT--RR
ISITQF-------K----------------------------------------------
------------------------------------SL--CENIEEEEEEKGVECCVCLC
GFKEEEEVSELVSCKHFFHRACLDNWFGN--------NH--TTCPLCRSIL---------
------------------------------------------------------------
-------------------------------------------------------
>gi|15228830|ref|NP_191828.1|	   257 residues, 50 /line  ATL5 (Arabidopsis T?xicos en Levadura 5); protein binding / zinc ion binding [Arabidopsis thaliana]
--------MG---------------------------NLFDSSKTLWGNMNHGSSR----
------------------------------------------------------------
-YSLNGKIMLASVII---------------LF----------------------------
---------------------VAVILILCFHSYARW----L-----FRRQNRRIRRRISA
HLRSLAAA-------------------RDPTQSSSSLSP-----------LDPTVL--EK
IPIFVY-------S----------------------------------------------
--------------------------------------------VKTHESPLEECSVCLS
EFEEDDEGRVLPKCGHVFHVDCIDTWFRS---------R--SSCPLCRAPVQPAQPVTEP
E----PVAAVFPSVKPIEDTEAGSSSSSDESESSTPSSSSGSPVRFPMEACEREPIDLVG
IIVEIPREF---------QDSNSDLPADNGSNRRASLK-R-----------LWII
>gi|125595785|gb|EAZ35565.1|	   155 residues, 50 /line  hypothetical protein OsJ_019048 [Oryza sativa (japonica cultivar-group)]
--------MGF---------------P---VGGYSGVPRLLLH-----------------
------------------------------------------------------------
--------LLFLLTH---------------LRRLSSCLLRLAGADI--DDSPT-------
------------------------------------------------------------
---AVDAE-------------------YDGS-YSYSSQSS----------QLLELD--DH
SPALRF-------DA---------------------------------------------
-----------------------------------------LSSSLQPPLHVATCAVCLR
DFHKSAQVRRAHRCRHVFHRACLDAWAHH--------GH--RTCPLCRSPLLPSSAPPVL
LPL--PLPA---------------------------------------------------
------------------------------------------------------S
>gi|15229284|ref|NP_189929.1|	   167 residues, 50 /line  zinc finger (C3HC4-type RING finger) family protein [Arabidopsis thaliana]
--------MTF----F----------I---EDTSLIISHVLYK-----------------
------------------------------------------------------------
--------TALIITV---------------LRWIFAWILRYRSRSS--SSS---------
------------------------------------------------------------
------------------------------SSQSSSSPSI----------SSQTIK--ES
LAVSAF-------RD---------------------------------------------
------------------------------------------AVERSPAAINDMCAVCLG
DLEDEDEIRELRNCTHVFHRDCIDRWLDYECCGGDDDNH--RTCPLCRTPLLPSFTDYST
VTQ--TSWA---------------------------------------------------
-------------------------VERLLYLFGDDLL----------------P
>gi|70994186|ref|XP_751940.1|	   232 residues, 50 /line  RING finger protein, putative [Aspergillus fumigatus Af293]
----------MRGWL---------------------------------------------
------------------------------------------------------------
------------------------------LATRVLTCLNSLGVPK--VGRSKVESSSAT
P-LGYIAPP----IVVFLFLLVWAVITIRYRSHR------------REAETRRLYFLG--
------------------------------------RTIL----------ADVDIN--RQ
FPLAKL-----------------SI--------------------------------WRA
LHRGK-----------------------------------QALGAESDVPDPILCSICME
QLRDDEDVRPL-PCEHIFHPECVDPWLTR--------YH--TSCPLCRVSLVEDDGKLDL
EDGRPPRLLTLPMPP-------------------------QPALIGFAGRFGWSVFL---
-----SLRDFMCPVIAVCL-------AADGSIRGIATG-V-------------TE
>gi|111059957|gb|EAT81077.1|	   166 residues, 50 /line  predicted protein [Phaeosphaeria nodorum SN15]
----------MASDTHS------------------------------------DHGLRGS
TVV-VAIVVP--------------------------------------------------
AVFVTIVLSLIVAAF----------------------ILPRFGRGG--KSFSAI------
--------------------------------------KGQRMQQRLEEIN--KVIKTQN
YYE---------------------------------------------------------
------------------------------------------------------------
--------W----------------------RTS--QR--SEKDSKTFLAPDPLCAICLE
NFAEDAQIRGLR-CSHAFHVHCLDEWFSR--------FN--EFCPLCHRTIIPGKKVAK-
------------------------------------------------------------
-----------------------------KEAYPESATVPLA----------FIV
>gi|119491379|ref|XP_001263244.1|	   156 residues, 50 /line  RING finger domain protein [Neosartorya fischeri NRRL 181]
--------MGLSASDGE------------------------------------MNSKNHH
MVI-VLGIGL--------------------------------------------------
GVVSLIIMCLLLTIF----------------------INRRE---R--TPTFKK------
--------------------------------------SRKDHSDKLRRLD--AVSPIRT
LEE---------------------------------------------------------
------------------------------------------------------------
--------W----------------------WSK--SK--GPLLPSEGADGQFICVVCLE
SVQRSQEIRELK-CLHVFHKECLDKWYLQ--------DH--FNCPLCHRAYYVQESRPS-
------------------------------------------------------------
-----------------------------------HDFVWM-------------V
>gi|126304059|ref|XP_001381810.1|	   165 residues, 50 /line  PREDICTED: similar to Rnf122 protein [Monodelphis domestica]
---------MVSALPSGWSPQF-RTQG---QRCACGLGLIYNN---RSCTMPPISFQDLP
LNIYMVIFGT--------------------------------------------------
GIFV-FVLSLIFCCY----------------------FISKLRHQA--QSER--------
------------------------------------------------------------
--Y---------------------------------------------------------
------------------------------------------------------------
--------G----------------------YKE--VV--LKGDAKKLHLYGQTCAVCLE
DFKGKDELGVLP-CQHAFHRKCLVKWLE---------VR--CVCPMCNKPISGPPEATQ-
------------------------------------------------------------
----------------------------SIGTLLD-----------------ELV
>gi|145512429|ref|XP_001442131.1|	   253 residues, 50 /line  hypothetical protein [Paramecium tetraurelia]
--------MTIFRSYF-------------------------------DCFLPELKEFNYQ
LWVKIIV-----------------------------------------------------
-IYKLVLPIMFLILY----------------------LLYRENYNE--TNHRIIISNIIL
LIIGVENGIGVFSWVISETFSLYTILFLILQCIIQLENAQQNIIDKEATFDINLQILFRH
FNEMMYKS-------------------F------------------------VWLNFATM
IPAIFM-------LI---LITICTC--------------------------------QLK
LFFQLIKRN----------------------TPD--QQ--TDVFYEYSGEEGAECSICME
ELKQMEKYVELP-CNHTFHSQCFSKWKN---------YK--QLCPVCRRTVKINDLGGI-
------------------------------------------------------------
-----------------------------NKQLQLSKIQD------------IEI
>gi|18397866|ref|NP_565376.1|	   196 residues, 50 /line  zinc finger (C3HC4-type RING finger) family protein [Arabidopsis thaliana]
--------MAGMLPGVECARRR-RFH----------------------GGAPPI------
------------------------------------------------------------
-----------------------------------------------------ESSNTAS
VAAAAG-----HVWTRRPSFSLYTTNHESHQAHVSFSERSVRNKSYGEDNDEKLDGAAKE
AKQRLNKR-------------------LRIPPRTRQNGKD----------KGNKLEQGKG
KPLGDL-------PT---EVVGLKK--------------------------------SRG
RLMEWF---------------------------------------KRRVREQQDCAICLD
RFKKGETLVHLP-CAHKFHSICLLPWLD---------TN--VYCPYCRTDIWN-------
------------------------------------------------------------
-------------------------------------------------------
>gi|83773278|dbj|BAE63405.1|	   168 residues, 50 /line  unnamed protein product [Aspergillus oryzae]
------------------MPDW-KTES---TSKKEG---------------TTANNDGLA
FQV-LLVVCL--------------------------------------------------
TVYVVTAIWLLLRSYCL--------------------AYSSLASGA--TDPAIA------
-----------------------------------NVSPQDSMERRLDCLE--RVAPTKP
FKI---------------------------------------------------------
------------------------------------------------------------
--------W----------------------WLS--IQ--TIRSPLKQSDHIFTCSICLD
KVRKKDPIHTLQ-CHHVFHRECLENWFLG--------FH--NQCPMCKKPFFEELDMSP-
------------------------------------------------------------
----------------------------E-----------------------CAV
>gi|53792036|dbj|BAD54621.1|	   192 residues, 50 /line  hypothetical protein [Oryza sativa (japonica cultivar-group)]
--------MMIPRAEFNYRALV-VVLP---AGAVVGVMLYLAG---AR------------
-----WVLLL--------------------------------------------------
LAAVTVLLCLQLSARDN--------------------A----------------VDGAAA
AAAAAG---------------------------------------PAQTADLPLQQPAAL
PREAPAEG-------------------DL------------------------RGLGASS
SPVFVV-------AV---------------------------------------------
--------L----------------------PAY--AW--RKKAAVDGDDGDGECAICLG
EVRRGQVVKQLPACTHLFHARCIDKWLIT--------SQ--GTCPVCRTPVDSAAAALQ-
------------------------------------------------------------
----------------------------A-VRVAD-----------------QPP
>gi|125606451|gb|EAZ45487.1|	   217 residues, 50 /line  hypothetical protein OsJ_028970 [Oryza sativa (japonica cultivar-group)]
---------MQPCGRR----------L---LGAGTALPPPLPG---LGSASAHSMDRAQR
AHMV--------------------------------------------------------
------------------------------------------------------------
------RALGVTTTVLFVASVSYIALTALYACFCDGGGRRRREDGG--------------
------------------------------SSSVRPEPSE----------ETKRAL--DG
IPVHVV-------QM---------------------------------------------
--------------------------------PP--RD--GGGGGADEEGGSGDCAVCLA
EYAAGDEVRVLPACGHGFHRECVDRWLLT--------RA--PTCPVCRAPVVARVEGPDD
---------------------DAKEDYCGDGESVERHGGGGGDIG---------------
----------------------------FLSVAGESRVLPA-------------I
>gi|115435834|ref|NP_001042675.1|	   204 residues, 50 /line  Os01g0266100 [Oryza sativa (japonica cultivar-group)]
--------MEIGGVLVSL------------------------------------------
------------------------------------------------------------
LFAAFSLPCLLLLLV---------------------------------------LAEAGL
RLASLALRGGRYAWPTRSDFLGYRIARRRRAA----------VSGGAGGADGE-------
------------------------------------EEAQ----------PT--------
------------------------------------------------------------
------AEC----------------------CDR--LA--VAMYRRGRDAAPVDCVFCLS
RVDDGEEVRELR-CRHVFHRACLDAWLVL--------PR--ATCPLCRDCLLPPPCEPPR
---------------------SFPLDYYDDDDDVHFGFNDF-SIT---------------
----------------------------SSTTTTTSAAAAVAYPHGVA---LWPM
>gi|115477050|ref|NP_001062121.1|	   167 residues, 50 /line  Os08g0492500 [Oryza sativa (japonica cultivar-group)]
--------MGISSM------------P---APKDSVVAYL--------------------
------------------------------------------------------------
-----LYNTAVSIAI---------------LADMVRAALVFLGLPV--PPSAWEDGDDQL
A-----------------------------------------------------------
---AIAAA-------------------AAAAAAAAGGPSL----------ADRFR---SR
FRPARF------------------------------------------------------
------------------------------------------GRRRGGGAGAADCRVCLA
RFEPESVVNRL-PCGHLFHRACLEKWLDY--------DH--ATCPLCRHRLLPATTESPS
PSPA--------------------------------------------------------
----------------------------------------TATPHFA------RI
>gi|112253249|gb|ABI14212.1|	   222 residues, 50 /line  RING finger domain protein-like [Pfiesteria piscicida]
---------MPPRFCGRLGGIS-HRRWFLR----QLPWRRTRALLLR-------------
--------------------------------------------EAP-------------
----------LGSPK---------------VRSTIEKRKKLHCCDIS-SWWDDSPMHIRT
LLPRRS-----LFVTRLGLGLLPEVDCLSDATLPCGLKQNEVLDLMYRDIKPEDFEMLSK
LDET-----------------------------LPKRDIV----------KRN-------
------------------------------------------------------------
--SLE-----------------------------------DLPTVPVRKCTASECGVCLA
AWGPNDEATKLP-CSHVFHGQCIKKWLS--------QCK--NACPLCSAPLDGHAVPVAT
A-----------------------------------------------------------
---------------------------AV--TGQLVA----------------AS
>gi|115723698|ref|XP_001201384.1|	   200 residues, 50 /line  PREDICTED: similar to RNF111 protein, partial [Strongylocentrotus purpuratus]
-----------ETELGTGVGPD-GRQHQHR----HLHHHLHHYHHNA-------------
--------------------------------------------PHPHLHTPNLSGTTV-
---------APLISN-----------------LLVPDIPPIHTGHP--FYAQAHPLSV--
---------------------------------------------MRALRVSPMYEELVQ
LGEH----------------------L-GQVNRGASRSTI----------ERNTLP--HK
YKLRHQ-------KES-----------------------------------------DSS
EETGE-----------------------------------VEGAAKIPDDDMEKCTICLS
YFEDDEDVRRLP-CMHLFHVECVDQWLV---------TN--KRCPICRVDIETRMQKE--
------------------------------------------------------------
------------------------------------------------------V
>gi|3822225|gb|AAC69857.1|	   190 residues, 50 /line  RING-H2 finger protein RHG1a [Arabidopsis thaliana]
--------------AYSRAGPL-FDRQG-------------DSVVGI-------------
--------------------------------------------PHPLRALAAASRGRS-
---------RLMVSQ---------------MQNVLDVMRRDANNNN--LRLEDVMLLN--
-----------------------------HSVLFDGATGHDRYRDMRLDVDNMSYEELLA
LEER----------------------I-GDVCTGVNEETI---------------S--NR
LKQRKY-------KSN-----------------------------------------TK-
-----------------------------------------------SPQDAEPCCVCQE
EYTEGEDMGTLE-CGHEFHSQCIEEWLK---------QK--NLCPICKTTGLNTAKKRRI
------------------------------------------------------------
------------------------------------------------------A
>gi|66865944|gb|AAY57606.1|	   159 residues, 50 /line  RING finger family protein [Arabidopsis thaliana]
----------------MGLPED-F----------ITELQIPSYILKI-------------
------------------------------------------------------------
---------LYVIGF---------------FRDIVDALCPYIGLPR--FLDH--------
--------------------------------------------------------NETS
APDL----------------------T--RHALSTSASLA---------------N--EL
IPVVRF-------S----------------------------------------------
---------------------------------------------DLPTDPEDCCTVCLS
DFESDDKVRQLPKCGHVFHHYCLDRWIVD-------YNK--MKCPVCRHRFLPKEKYTQS
D------------------------------WG---------------------------
-----------------------SGSDWF--SDEVER----------------PT
>gi|125535731|gb|EAY82219.1|	   199 residues, 50 /line  hypothetical protein OsI_036178 [Oryza sativa (indica cultivar-group)]
--------MEVDASAVARALPR-DFPPIEN----LSFEGIPRYTFKI-------------
--------------------------------------------GNRIHCTNLMYRPGS-
---------RTLL-----------------------------------------------
----------------------------------TQEEGHEIIRE---RLRSDIRRGRIE
LDADFLQQ-----LVDQVRDHILQRQR-RGTATAIAMD------------GVVEVE--DA
YRNGGF-------GAV-----------------------------------------PAS
SKAMA-----------------------------------ELQEAMASEARESDCAVCLE
DFEAGEKLRRMP-CSHCFHATCILDWLR---------LS--HRCPLCRFPMPTQDQSY--
------------------------------------------------------------
-------------------------------------------------------
>gi|18379162|ref|NP_565253.1|	   147 residues, 50 /line  RHA2B (RING-H2 FINGER PROTEIN 2B); protein binding / zinc ion binding [Arabidopsis thaliana]
--------MGLQGQLS-------------D----VSSDSIPLML----------------
------------------------------------------------------------
---------LALLAT---------------FFRHVRSLLLFPSSAP--------------
----------------------VVVVTSNLSVLA--------------------------
----------------------------------------------------------DQ
LNLNR-------------------------------------------------------
-----------------------------------------LFSYRYSDNAASDCIVCLS
KLKTGEEVRKLD-CRHVFHKQCLEGWLQ--------HLN--FNCPLCRSPLLPHHHQGHG
S------------------------------DA---------------------------
-----------------------SISAFPLRSTSTAS----------------SH
>gi|67522403|ref|XP_659262.1|	   238 residues, 50 /line  hypothetical protein AN1658.2 [Aspergillus nidulans FGSC A4]
--------MAQDSDEPSGATLG-YLAPICVAVFFIFVWYLPCLILSC-------------
--------------------------------------------LSPRL-----------
---------ILNSFR---------------YRIVFGTRQRFRGPNRQ-LDPESWPMGFSH
AILTSA-----ELEKRFPLIKFRAWTA---------ASGHQAKHSERSEVDPD-------
-----------------------RDST-SQAPGSIPAPAS---------------N--LA
LPLNAS-------EKE-----------------------------------------V-Q
VSASV-----------------------------------EHEVASSHGDAHRECAICME
DFDDDDSIRALT-CDHIYHATCLDPWFT--------KRQ--ARCPLCKTCYYPEINPAVP
V------------------------------RP---------------------------
-----------------------ATALIR--NQIFPR----------------VL
>gi|125559653|gb|EAZ05189.1|	   181 residues, 50 /line  hypothetical protein OsI_026421 [Oryza sativa (indica cultivar-group)]
--------MEILV-----------------SALLLLLVPPLSALLAV-------------
--------------------------------------------AAPSLAWPSGSSSVR-
---------KLI------------------------------------------------
----------------------------AKKVAPEQAA----------------------
------------------RDELLRVARYSSASAAAAASAV----------QQ--------
---------------------------------------------------------PGG
GESSR-----------------------------------PAAAAADDGGRPDQCAVCLS
DIEEGDEVRELR-CRHLFHRGCLDRWWLSA------RPP--ATCPLCRCRLLQSPSAAAD
D---------------------DDGDGEEDSDS---------------------------
-----------------------DMVMFMAYLRSSST----------------WL
>gi|115447941|ref|NP_001047750.1|	   164 residues, 50 /line  Os02g0682300 [Oryza sativa (japonica cultivar-group)]
--------MGF---------------PLVCYCMAIPK--PLIA-----------------
------------------------------------------------------------
--------LAKLLAAI---------------REALQLMLFVVGIC---------------
------------------------------------------------------------
----HHPERSGRPAAVDAP-------------------------------LPDEVK--DR
LPPLEF-------AQLLA----------------------------------ASEHGCHG
CDD---------------------------------------------DEAVAGCIVCLE
RLEADDVVRRLGNCAHAFHRGCIDRWIDL--------GR--LTCPLCRSTLLPRARPAAG
PR----------------------------------------------GRLG--------
----------------------------RLATRLTG----------------VVW
>gi|125583607|gb|EAZ24538.1|	   255 residues, 50 /line  hypothetical protein OsJ_008021 [Oryza sativa (japonica cultivar-group)]
MVSFLWWIIGFYWVVSGGDVLEQDAPRLYWYCGPKPV--PITD-----------------
------------------------------------------------------------
--------YFMIVQSNVHMLSVVFLAFDVFFAVFCVAMACFIGIA---------------
------------------------------------------------------LCCCLP
CVIAILYALAGQEGASDADIGFLPRYRYSDPSEDGQKGTD------EGVMIPVLNN--SG
TSTSER-------ILLHEDAEGASDADIGFLPRYRYSD--------------PSEDGQKG
TDEGVMIPV-----------------------LNNSGT--STS-ERILLHEDAECCICLS
SYEDGAELSAL-PCNHHFHWTCITKWLRM---------H--ATCPLCKYNILKGSESA--
------------------------------------------------------------
-------------------------------------------------------
>gi|147789499|emb|CAN69586.1|	   166 residues, 50 /line  hypothetical protein [Vitis vinifera]
MISAVDEI---------RRLLESSSEESI-------------------------------
------------------------------------------------------------
----------------YRSLTTTICAFVAGFGMAFVF-----------------------
------------------------------------------------------GAFIVS
CTIR-------------------RLRGYGDESQHHGSTAS------A-------------
----------------------------------------------------ASSSGQRR
REHVVAIPV----------------------HIYGPGP--SSSCAATTSYELQACAICLC
EYENGERVSVLPRCKHMFHKDCIEQWVPV--------KS--VNCPICRAPTVGGDACSAW
MN----------------------------------------------------------
------------------------------------------------------C
>gi|125540686|gb|EAY87081.1|	   212 residues, 50 /line  hypothetical protein OsI_008314 [Oryza sativa (indica cultivar-group)]
--------MGFP--VG----------Y-----SELLL-----------------------
------------------------------------------------------------
--PRLLLQVLLLLGH---------------LHRFLLWAFHAVGLGD--LIDNPPGL----
------------------------------------------------------------
--------------AATEQDMMLQGRGGGMAEGWASSSALQHRRPEFRAIPPMAIE--EA
LPVVRF-------DELVAS-----------------------------------------
--------------------------------------------APAAVCGGGDCAVCLS
GICGRDEVRRLSNCRHVFHRGCLDRWMAH--------EQ--RTCPLCRAPLIPDELLPAA
SGL---------------------PDPSDYDLSYYPSPLP----LAPTPTLLRPHELLLN
GL-------------------------------------------------GGFQ
>gi|76446335|gb|ABA42952.1|	   158 residues, 50 /line  RING-H2 finger protein [Poncirus trifoliata]
--------MGLASM------------P---SASEGML-----------------------
------------------------------------------------------------
--CLILMNTAMPISI---------------VKGIFRSILKVVGFQL--------------
------------------------------------------------------------
------AESSSTPYSYFASPQ-------------VVSAEPYDVNLSPPLSYVEEFR--NQ
NPAIKY-------ETLLH------------------------------------------
-----------------------------------------------CEDAEHDCSVCLT
EFEPQSDINNL-SCGHLFHKVCLEKWLDY--------LN--VTCPLCRTPLIPEFEDDPS
------------------------------------------------------------
----------------------------------------------------CFW
>gi|15228108|ref|NP_178507.1|	   162 residues, 50 /line  XERICO; protein binding / zinc ion binding [Arabidopsis thaliana]
>gi|83769055|dbj|BAE59192.1|	   242 residues, 50 /line  unnamed protein product [Aspergillus oryzae]
--------MGDHSDKHSPAAPLGYLAPVCAGLLVI-------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------SVWYRHF------------------------------
--------RRDRRNAGFLDLESVPFRRGSTVI------------------SSGEVD--KQ
FPLMKY--------------------SDWWAGRSRKESIAKETIGSLSSASEDPKNGLED
KEIAITVPEGHVQKTNSAENAPDTQIDKAQERVRGSGNACEHDTDDAASETGCLCAICMD
SFEGETYIRPL-TCGHIFHSSCVDPWLTK--------RR--ASCPLCNKSFGDHEASNRE
ET----VAHIFP------------------------------------------------
---VLAVPRAAMLR-----------------SDVFPR----------------TI
>gi|145500868|ref|XP_001436417.1|	   150 residues, 50 /line  hypothetical protein [Paramecium tetraurelia]
MIQIVQEGQGKH--CD----------Q-----YQINK-----------------------
------------------------------------------------------------
--KDKNL--KLMIIN---------------LGDGNKLLINIDKRYQQKLSNYDYQL----
------------------------------------------------------------
-------------------------------------LEQQLWQTN--IDKVFQKG--KG
VPKKLQ-------QKLRK------------------------------------------
---------------------------------------------MKMGKSNRQCSICCN
NFSKDETIIQLP-CKHIFHQSCLFSWLDH---------S--TKCPNCRSDVLEGLKSEE-
------------------------------------------------------------
------------------------------------------------------K
>gi|145502416|ref|XP_001437186.1|	   129 residues, 50 /line  hypothetical protein [Paramecium tetraurelia]
MKQVLEEQQRSE--FE----------V-----EEVPL-----------------------
------------------------------------------------------------
-----------------------------------RIWEQVTNQIRQEIVS---------
------------------------------------------------------------
-------------------------------------LQNQLWQSN--IDKVFQKG--NG
VPKILQ-------KKLRM------------------------------------------
---------------------------------------------MKMGKSNRQCSICCN
SFEKDETIIQLP-CKHIFHKSCLFSWLDH---------S--TKCPNCRSDVLDLLMSQE-
------------------------------------------------------------
------------------------------------------------------R
>gi|87162911|gb|ABD28706.1|	   180 residues, 50 /line  Zinc finger, RING-type [Medicago truncatula]
--------MGFP--VG----------Y-----PEVSV-----------------------
------------------------------------------------------------
--PNIFLYTLSLLSF---------------LRSLTISFLSLLHLSD--LLDTDFST----
------------------------------------------------------------
-------------------------------------TTLPDSHIHRPTLSAILIR--QF
LPIITF-------NDLAE------------------------------------------
----------------------------------------------GDSSPPVGCAVCLN
EFAGEEEIRCMANCRHMFHRTCVDRWIDH--------DQ--KTCPLCRTHFVPYHKMEDY
NQR------LWN--------DAASEDDIDDDVSLFSHRHD--------------------
------------------------------YYYIANA----------------SL

Ad blocker interference detected!


Wikia is a free-to-use site that makes money from advertising. We have a modified experience for viewers using ad blockers

Wikia is not accessible if you’ve made further modifications. Remove the custom ad blocker rule(s) and the page will load as expected.