FANDOM


>gi|18395648|ref|NP_565308.1|	  unknown protein [Arabidopsis thaliana]
MATIAGGSFG---------------------------------------------VPSSR
ISITTPTLSSSS---LLPPLTLQ----------------------SGTRKDNLLRC-ALQ
ESST-SAVAT-------------------------EKKNKEEGEE---------------
----------STVAVPA--KKPKPAAKAA--AVAKPLRQMMEEDVIPPLQAILESQDDIS
DIDLSFQDDK--LEG------------FFL-KK-SIPYSFWAFFPTGNLTG-AKGFSISS
HGSGPSTVEPFLVDER---KPTANHVVFWVEKRL-AAQGIIPVW----------NQ----
----------
>gi|113475477|ref|YP_721538.1|	  hypothetical protein Tery_1808 [Trichodesmium erythraeum IMS101]
------------------------------------------------------------
------------------------------------------------------------
--------------------------------MPEEQQK---------------------
--------AKKTETKPAGGKVKPE-KPP--AVESKPFAEFVQQDYLPALQKALLEQG-ID
DLDLSLVKEKLPMIGFSSSEECWQVVGKFK-KG---QRQFNIYFPKKDIKG-PRAFSCAD
NGSKPATLEPFLIDER---KITLKLLVFGVTQRL-NAQKWLSLN----------------
----------
>gi|23125299|ref|ZP_00107239.1|	  hypothetical protein Npun02006772 [Nostoc punctiforme PCC 73102]
MADQ-TNHNQAGEVAP--------------------------------------------
-----------------------STVDKQAPSVAEEHAPST-------------------
----DSPEATD---------LPTANTPDPKAANPETNPNAAKTTATPPKREKPAAKAAVG
---E-KP-AAATEEKPAAKAAKKE-KAP--AVEDKPFVEFIEQDYLPALQKAIAQQG-VQ
DLQVSFAKQKVPITGFESAEECWQIIGSWKETG---ARQFNLYFPEEDIQG-KKGFSCN-
EGKKPSTLESFLIDER---KITLDLLVFGLVQRL-DGQKWLGIN----------------
----------
>gi|119485084|ref|ZP_01619469.1|	  hypothetical protein L8106_06539 [Lyngbya sp. PCC 8106]
MSEE--------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------TEAKKPAA---KKE-KPP--AVEDKPFAEFIEQDYIPALQDALTSQG-LE
DLELKFAKEKFPASV-GTSEPCWQVMGQWK-GG---KRQFNVYFPNEDIKA-QKVFSLAD
NGSKPSGIEPFLGDER---RINLSLLVFGVVQRL-NAQKWLNRN----------------
----------
>gi|119510377|ref|ZP_01629512.1|	  hypothetical protein N9414_15977 [Nodularia spumigena CCY9414]
MAEE-KNHNQTGEAAP--------------------------------------------
-----------------------SNVDKQ--------VPST-------------------
----NEPVATN---------LPTANTPDPKAANPEVNPNAATTKTAPPKAEKPPA-----
----------------AAKAAKKE-KPP--AVEDKPFVEFMEQHYLPTLQNAIAQEG-VE
DLQLAFAKQKLPIAGFQSAEECWQVIGSWQ-NG---QRQFNVYFPEESITG-KKGFSCN-
EGKRPSTLESFLIDER---KITLDLLVFGLVQRL-NGQKWLGRN----------------
----------
>gi|17230789|ref|NP_487337.1|	  hypothetical protein alr3297 [Nostoc sp. PCC 7120]
MADP-TNQNQPGDTVP--------------------------------------------
-----------------------STVDQKAPTVAEENAPST-------------------
----SEPVATN---------LPTANTPDPEAANPKTNPNTAKPTAAAPKEEKPAA-----
----------------AAKAAKKE-KAP--SVEDKPFVEFMEQDYLPALQKAITAEG-VK
DLQLSFAKQKLPIAGLSSAEEYWQVIGSWQ-NG---QRQFNVYFPDEDIQG-KKGFSCN-
EGRRPSTLESFLIDER---KITLDMLVSRLVYRL-NGQKWLGRN----------------
----------
>gi|75911152|ref|YP_325448.1|	  hypothetical protein Ava_4956 [Anabaena variabilis ATCC 29413]
MADP-TNQNQPGDAVP--------------------------------------------
-----------------------STVDQKAPTVAEENAPST-------------------
----SEPVATN---------LPTANTPDPQAANPKTNPNAA----APPKEEKPAA-----
----------------AAKAAKKE-KAP--SVEDKPFVEFMEQDYLPALQKAITAEG-VK
DLQLSFAKQKLPIAGLSSAEEYWQVIGSWQ-NG---QRQFNVYFPDEDIQG-KKGFSCN-
EGRRPSTLESFLIDER---KITLDMLVSRLVYRL-NGQKWLGRN----------------
----------
>gi|126658804|ref|ZP_01729948.1|	  hypothetical protein CY0110_08131 [Cyanothece sp. CCY0110]
------------------------------------------------------------
------------------------------------------------------------
----------------------------------------------M-------------
----------AEETKPKA---KKE-KPP--AIEEKPFTEFMEEHFTPTLKESLINQG-LD
DIELSFTKADISIAGATSDEPCWQVIGTWN-QG---QRQFKLYFLEEDIKG-QKAFSYAV
NGKPPSTIESFMIDER---KINLDLMVLYTLQRL-NGQKWLTRN----------------
----------
>gi|67920789|ref|ZP_00514308.1|	  conserved hypothetical protein [Crocosphaera watsonii WH 8501]
------------------------------------------------------------
----------------------------MKPYIFDNN-----------------------
----------------------------------------KITGTIM-------------
----------AEETKPVA---KKG-KPP--AIEKKPFTEFMEEHFTPTLKESLTKEG-LN
DIELSFTKAPVSIPGAISDEPCWQVIGTWD-KG---KRQFNIYFPGEDIKG-QKAFSYAV
NGKPPSTIESFMIDER---KVTLDLMVLYTLQRL-NGQKWLTRN----------------
----------
>gi|116070611|ref|ZP_01467880.1|	  hypothetical protein BL107_13235 [Synechococcus sp. BL107]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------MSEAP-------
---------------AN-KPAAKP-KPP--KPEDKPFPEFIDTLFLPAVAKQLLENG-IT
ADRLERIDGDRPVVG----GRCPMVVGDLP--G---GRRFWLCFAKEDISS-GKVIALAD
PGSEPTLLESFLIDEK---RMSLPLLVSRLLQRL-NGQKWLGGN----------------
----------
>gi|33865733|ref|NP_897292.1|	  hypothetical protein SYNW1199 [Synechococcus sp. WH 8102]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------MSDTP-------
--DT-AS-AAAQEDTKA-APKPKP-KPP--KPEDKPFPEFIDTLFIPAVSKQLEDNG-IQ
ADRLERVEGERPVVG----GSCPMVIGELP--G---GRRFWLCFGSADITS-PKLIALAE
AGSEPTLLESFLIDEK---RMSLPLLVSRLLQRL-NGQKWLGRN----------------
----------
>gi|78184737|ref|YP_377172.1|	  hypothetical protein Syncc9902_1164 [Synechococcus sp. CC9902]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------MSEAP-------
---------------AN-KPAAKP-KPP--KPEDKPFPEFIDTLFLPAVAKQLLENG-IT
ADRLERVEGDRPVVG----GRCPMVVGDLP--G---GRRFWLCFAKEDINS-GKVIALAD
PGSDPTLLESFLIDEK---RMSLPLLVSRLLQRL-NGQKWLGSN----------------
----------
>gi|78212841|ref|YP_381620.1|	  hypothetical protein Syncc9605_1311 [Synechococcus sp. CC9605]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------MSETP-------
--VE-KQ-SSGQE-APA-KPAPKA-KPP--KPEDKPFPEFIDTLFLPAVAKQLAEHD-IT
ADRLERIEGQRPVVG----GECPMVVGELP--G---GRRFWVCFSKADINS-SKVIALAD
AGSEPTLLESFLIDEK---RMSLPLLVSRLLQRL-NGQKWLGGN----------------
----------
>gi|148242576|ref|YP_001227733.1|	  hypothetical protein SynRCC307_1477 [Synechococcus sp. RCC307]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------MSDSA-------
--AT-PDKPTDQPQAAK-APPAKA-KPP--KPEDKPFAEFVPQLLMPALAKEIESYG-GP
APALELEQAAMPVVG----ETCWQIRGELP--G---DRRFWLCFTKDDIQA-PKTFAIAE
SGAPPSLLESFLIDEK---RITLALLVSRTVQRL-NGQKWLGPN----------------
----------
>gi|116074905|ref|ZP_01472166.1|	  hypothetical protein RS9916_30264 [Synechococcus sp. RS9916]
------------------------------------------------------------
------------------------------------------------------------
-----MPRAD--------------------YSSASE---------GNLVSETP-------
--AK-A---TPTPA-------EKPAKPP--KPEDKPFDAFIQEDLLPAVRKGIVDRG-IT
PSVLDLRQGERPVVG----GSCWMLYGELP--P---GRRFWLCFSEPSIGA-DKTIALAD
PGTDASLLESFLIDEK---RMSLALLQSRLLQRL-NGQKWLGGN----------------
----------
>gi|148239439|ref|YP_001224826.1|	  hypothetical protein SynWH7803_1103 [Synechococcus sp. WH 7803]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------MSETP-------
--AK-PK-GETKPAGEG---KAKPAAKP--KLEDKPFASFMQEDFLPSLTKALDDRG-QR
AVSLSLIEGERPVVG----GSCWMVKGELS--G---ERRFWLCFESDAITS-GKTIALAE
SGTAPSLLESFLIDEK---RITLALLQSRLLQRL-NGQKWLGGN----------------
----------
>gi|88808724|ref|ZP_01124234.1|	  hypothetical protein WH7805_03502 [Synechococcus sp. WH 7805]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------MSETP-------
--AK-PK-GTTKPAGEG---KAKPAAKP--KPEDKAFASFIQEDFLPSLSKALADRG-HA
PVSLSLSEGERPVVG----GLCWMVKGELS--S---ERRFWLCFESDAITS-GKTIALAE
SAAEPSLLESFLIDEK---RMTLALLQSRLLQRL-NGQKWLGGN----------------
----------
>gi|124023148|ref|YP_001017455.1|	  hypothetical protein P9303_14441 [Prochlorococcus marinus str. MIT 9303]
MN----------------------------------------------------------
--------------------------------------------DNDNRV----------
-----NPNAD--------------------AEKPAE---------QKPTLENP-------
--VK-TN-P-TEDQQEG--AKPQSAKPPAAKVEDKPFETFIRDDFLPNIKQALTERG-MP
PSTLELIQGNRPVVG----DPCWMVCGEIP--L---GRRFWLCFASDSIAS-KKTISLAE
TGTEPSLLEPFLIDEK---KMTLILLRSRLLQRL-NGQKWLTAN----------------
----------
>gi|33863041|ref|NP_894601.1|	  hypothetical protein PMT0769 [Prochlorococcus marinus str. MIT 9313]
MN----------------------------------------------------------
--------------------------------------------DNDNRV----------
-----NPNAD--------------------GQKPAE---------QKPTLENP-------
--VK-TN-P-TEDQQEG--AKPQTAKPPAAKVEDKPFETFIRDDFLPNIKQALTERG-MP
PSTLELIQGDRPVVG----DPCWMVCGEIP--L---GRRFWLCFASDSIAS-KKTISLAE
TGTEPSLIEPFLIDEK---KMTLTLLRSRLLQRL-NGQKWLTAN----------------
----------
>gi|87125806|ref|ZP_01081649.1|	  hypothetical protein RS9917_00280 [Synechococcus sp. RS9917]
MS----------------------------------------------------------
--------------------------------------------DT--------------
------PAA---------------------------------------------------
-------------------ATPKP-KPP--KLEDKPFAAFIAEDFLPGLRKGLADHG-LT
PTSLDLIEGERPVVG----GSCWMVCGELP--P---GRRFWLCFNEAAIQS-GKTIALAD
PGTEPSLIESFLIDEK---RITLPLLLSRLLQRL-NGQKWLGGN----------------
----------
>gi|37520443|ref|NP_923820.1|	  hypothetical protein glr0874 [Gloeobacter violaceus PCC 7421]
MPE--ENQAPPPAEAA--------------------------------------------
-------------------------------------------------------ATQTP
ESPTDTKAAD--------------ATPAPDGEAPAPKPRPPR--------PRPAAASAEG
DATEAAPAAAEGEAAPARPP--RP-KPG--DAPAKPLPQYIQEDILPLLEKRMKAEG-AA
DVALTAGEADFTATW---------------DNG---NKTFTIYFDEGNLEG-RKTIAYNE
VKSPGRVLQMFMPPERGFKGVDAKQIVVMILQQFTTTLTWIKKQPAAAGGGAAAKGKPPR
PERPAKSVAS
>gi|16331085|ref|NP_441813.1|	  hypothetical protein sll0272 [Synechocystis sp. PCC 6803]
-MAL-IPFYVYGDRLP--------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------K-LMTEAKAPAE---KKA-KPP--AVEEKPFTEFINQDFLPALQSALGKIG-LG
PVALDFSKKPIAIPGADN-TPYWQVQGTWS-GDRQISKQFNLYFFQEDIKG-PKGFAYSV
DNRPPSTLESFMIDER---KVTLDLMVLYTLQRL-NGQKWLGGN----------------
----------
>gi|22298015|ref|NP_681262.1|	  hypothetical protein tlr0472 [Thermosynechococcus elongatus BP-1]
------------------------------------------------------------
----------------------MAVACKGECYHAEEMVPCR-------------------
------------------------------SAMAEETPT---------------------
------------------QAPKKE-KPP--AIEDKPFAEFINEAFLPALKNALSAK--VG
DVTLRLEGN--------------TVMGEWG-KG---MYQFRLYFLEGNIQG-PKVFVCSS
GGIAPSTLEPFLGDER---KVTLDLLVFGVMQRL-NGQKWLGGN----------------
----------
>gi|33240441|ref|NP_875383.1|	  hypothetical protein Pro0991 [Prochlorococcus marinus subsp. marinus str. CCMP1375]
------------------------------------------------------------
-------------------------------------------MENNQDLS---------
------------------------------ANNPPLSPEARKS-----------------
------------SQLEGEKSLIKK-KPP--KLEEKPFEEFVNKHLIPEISNSLSSKG-IS
LESIILKKDQRPVVG----GECWIVYGELL--N---GKRFWITFNSDDIKS-TKNICLAE
SSSEAALLESFLIDEK---KITLQLLTSRFMQRL-NGQKWLGDN----------------
----------
>gi|56752196|ref|YP_172897.1|	  hypothetical protein syc2187_d [Synechococcus elongatus PCC 6301]
MS----------------------------------------------------------
-EEQ--------------------------------------------------------
------------------------VVPTPE------------------------------
-----------AAAKPAA---KKE-KPP--ALEDKPFKEFVQTDLLPAVQQALSDRG-LA
DLDLQFVEAPLPVTG----DRCWQLQGSWA-KG---QRRFLLGFSEESLTA-PKVFSLAD
GKATPATLEAFLGDER---KITLPLLLNRILSRL-NGQKWLEQN----------------
----------
>gi|84518016|ref|ZP_01005365.1|	  hypothetical protein P9211_04167 [Prochlorococcus marinus str. MIT 9211]
ME----------------------------------------------------------
--------------------------------------------ESHQDQIKGDNSQALS
ESSS--------------------------------------------------------
------------NVV---TQEVKE-KPL--KIEEKPFDVFILDHFIPGLKSSLHKFG-IS
APVITLKEDERPVTG----GKCWMVYAKLP--K---DRKFWICFSTNQISS-LKNFAISE
SGAEPSLLESFLIDER---KTTLPLLISRTLQRL-NGQKWLGRN----------------
----------
>gi|86606710|ref|YP_475473.1|	  hypothetical protein CYA_2070 [Synechococcus sp. JA-3-3Ab]
------------------------------------------------------------
------------------------------------------------------------
----------------------MSGEPTPAQETAVEKPARVE-------AANPAP-----
-----KE-TDTAQASPK----AAA-KKP--AKEEKPFEQLIAEDVIPATIAAFQKRG-VT
DLQLRLEGKT--------------LIGSFA-GG---KKQFSVLFAEGSLNG-PKFFRCAI
EGSPASTIESFMIDER---RVDVPLFVFYLLQRL-YAQQWY-------------------
----------
>gi|86608133|ref|YP_476895.1|	  hypothetical protein CYB_0645 [Synechococcus sp. JA-2-3B'a(2-13)]
------------------------------------------------------------
------------------------------------------------------------
----------------------MSGEPTPE-AAAAEKPAE---------AAKPA------
-----------AEDSPK----AAA-KKV--AKEEKPFEQQITEEVIPAAIAAFQKRG-VS
DLELRLEGKT--------------LVGAFA-GG---KKQFSVLFAEGSLNG-RKFFRCTT
EGSPASTIESFMIDER---RVDVNLFVFYLVQRL-YAQQWY-------------------
----------
>gi|87302400|ref|ZP_01085225.1|	  hypothetical protein WH5701_09364 [Synechococcus sp. WH 5701]
---------------------------------------------------------MQC
FELR--------------------------------------------------------
----LQPVS--------------------DSASPAPNP----------------------
---------------------VKV-KPP--APEDKPFAEFIPQLFLPALLKEIEAFG-GA
TPQLSFEQGAMPVVG----SPCWLVMGSFP--G---DRRFWLCFTEASISS-AKTIALAE
AGSEPSLLESFLIDEK---KTTLALLISRVVSRL-NSQKWLGPN----------------
----------
>gi|123966154|ref|YP_001011235.1|	  hypothetical protein P9515_09211 [Prochlorococcus marinus str. MIT 9515]
--ME-ENVDSIGDSYINEKDTFKKDNKNTNKEKVAKEKSNEVNKEINEEKVAKENSNEVN
IEINEEKISEENSKEVNKDINKEKVAKEKSNEVNKEINEEKVAKENSNEVNIEINEEKVA
KEKSNEVNKEINEEKISEENSKEVNKDINKEKVSKENSKEVNKDINKEKVAKENSKEVNK
DINK-EK-VAEENLKP--LKIKPK-KEI--PIEKKPFKEFINEHLLPSIIQEFKLRG-FE
VKEINLKNTSRPIAG----DKCWVVFCEIK--D---ICNFWLSFEKEDISS-SKSISLCK
SNQKPSVIESFLIDEK---RITLKLIISRILQRL-NGQKLIGIN----------------
----------
>gi|126696361|ref|YP_001091247.1|	  hypothetical protein P9301_10231 [Prochlorococcus marinus str. MIT 9301]
--ME-ENLDINNKVNN--------------------------------------------
---------------------------EKSDNITKSNSEEI-------------------
----REPRSEG-----------DTNTVSN--------------NSNPQRN-SDSKDNLKN
D--------IDTPVKP---VIKPK-KEL--PIEKKPFQEFINIHLIPALVEEINIRG-LK
VNNINLTNTNRPIAG----DKCWVINCEIK--D---TCNFWLSFEKEDISS-LKSISLSK
PNQKPSIIESFLIDEK---RITLKLIISRVLQRL-NGQKLIGVN----------------
----------
>gi|33861402|ref|NP_892963.1|	  hypothetical protein PMM0845 [Prochlorococcus marinus subsp. pastoris str. CCMP1986]
--ME-ENVESIEESIKREDDPLKK------------------------------------
------------------------------------DIIDI-------------------
------------------DSPKETSTLI---------------NANSQ------------
DSNK-QK-VGGENSIP--LKIKPK-KEL--PIEKKPFNEFINDHLLPSIIQEFKVRG-LE
VADINLKNTSRPIAG----DKCWVIFCEIK--D---ICNFWLSFEKDDISS-LKSISLCK
SDQKPSVIESFLIDEK---RITLKLIISRILQRL-NGQKLIGIN----------------
----------
>gi|123968557|ref|YP_001009415.1|	  hypothetical protein A9601_10241 [Prochlorococcus marinus str. AS9601]
--ME-ENLDKNNEVNK--------------------------------------------
---------------------------EIPDKTTKSNSEEI-------------------
----KEPKSEK-----------AIILDKN--------------------GDSATKIAIKN
E--------INTPEKP---ITKPK-KEL--PVEKKPFQEFINLHLIPSLTEEINQRG-LE
INNINLTNTNRPIAG----DKCWVINCEIK--D---TCNFWLSFEKDDISS-LKSISLSK
PNQKPSIIESFLIDEK---RITLKLIISRVLQRL-NGQKLIGVN----------------
----------
>gi|78779339|ref|YP_397451.1|	  hypothetical protein PMT9312_0955 [Prochlorococcus marinus str. MIT 9312]
--ME-ENLEPNSEVNN--------------------------------------------
---------------------------ETTNIPNKSNTEET-------------------
----KEPKSEK-----------VLNMSEN--------------NANSPNN-SVQKVDMKK
E--------NVIPAKS---ISKPQ-KEL--PIEKKPFQEFINIHLIPELIDEINQRG-LE
IKNINLKKTTRPIAG----DKCWVINCEIK--D---TCDFWLSFEKEDISS-LKSISLSK
PKQKPSIIESFLIDEK---RITLKLIISRLLQRL-NGQKLLGVN----------------
----------
>gi|124025752|ref|YP_001014868.1|	  hypothetical protein NATL1_10451 [Prochlorococcus marinus str. NATL1A]
---M-ENQNPSNEIDS--------------------------------------------
---------------------------SKKVTRSQSDSLDK-------------------
----NEPASEG---------KKDLNTLDKP------------------------------
--EK-SS-LLNSNAPA--IAKKPV-KPP--KLEDKPFKEFISNFLIPGLKASIEDKG-TV
VCEIKLIEGQRPVVG----GNCWMVFCELS--E---QRKFWLCFSKDIITS-DKTILLAE
SNSDPSIVESFLIDEK---KTTLPLLISRVLQRL-NGQKWIGVN----------------
----------
>gi|72382203|ref|YP_291558.1|	  hypothetical protein PMN2A_0363 [Prochlorococcus marinus str. NATL2A]
---M-ENQNPSNEIDS--------------------------------------------
---------------------------SKKVTRSQSDSLDK-------------------
----NEPAFEG---------KKDLNTLDKP------------------------------
--EK-SS-LLNSNAPA--IPKKPV-KPP--KLEDKPFKEFISNFLIPGLKASIEDKG-TV
VCEIKLIEGQRPVVG----GNCWMVFCELS--E---QKKFWLCFSKDIITS-DKTILLAE
SNSDPSIVESFLIDEK---KTTLPLLISRVLQRL-NGQKWIGAN----------------
----------
>gi|125559127|gb|EAZ04663.1|	  hypothetical protein OsI_025895 [Oryza sativa (indica cultivar-group)]
MASQPLRLVRPSP-------------------------------------LAGRHAAACK
CSAAIPLVFGRQRLPLLVAFPRG----------------------SGSGSGSGASCSAVQ
ESSS-AAAATT---------V---------S----EKKDAADAKK---------------
----------EATAEAK--PAAKPAAKPK-KPPVKPLPEMMQEEIIPPLKAALEAEDDVS
QVELSFEDNR--LEG------------SFI-KD-EVPYYFWAFFPNGDLTG-PKGFALSS
YGTEVSTIEPFLIDEK---RANAKYVVFWVYKRL-AGQGILPVW----------KEEEGE
GEGEGESS-A
>gi|125601029|gb|EAZ40605.1|	  hypothetical protein OsJ_024088 [Oryza sativa (japonica cultivar-group)]
MASQPLRLVRPSP-------------------------------------LAGRHAAACK
CSAAIPLVFGRQRLPLLVAFPRG----------------------SGSGSGSGASCSAVQ
ESSS-AAAATT---------VPPPNF----S----EKKDAADAKK---------------
----------EATAEAK--PAAKPAAKPK-KPPVKPLPEMMQEEIIPPLKAALEAEDDVS
QVELSFEDNR--LEG------------SFI-KD-EVPYYFWAFFPNGDLTG-PKGFALSS
YSTEVSTIEPFLIDEK---RANAKYVVFWVYKRL-AGQGILPVW----------KEEEGE
GEGEGESS-A
>gi|34395135|dbj|BAC84849.1|	  unknown protein [Oryza sativa (japonica cultivar-group)]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------------------------MMQEEIIPPLKAALEAEDDVS
QVELSFEDNR--LEG------------SFI-KD-EVPYYFWAFFPNGDLTG-PKGFALSS
YSTEVSTIEPFLIDEK---RANAKYVVFWVYKRL-AGQGILPVW----------KEEEGE
GEGEGESS-A
>gi|147819041|emb|CAN71628.1|	  hypothetical protein [Vitis vinifera]
MAIRAIGVSSFPS-------------------------------------SSYFTRKSEA
TSSTLPLCLRHGQCMHQMA---G----------------------KPVTSRRIIACSAVQ
ESST-PTDEWK---------GLDWSSMYSTC----FYLVAAETKE---------------
----------VKPAQEK--GPAKPKP-PA-KAPVKPLPQMMEEDVIPSLKSILEAQDDLS
EIELSFQDNR--LEG------------SFQ-KK-GIPYSFWAFFXNGVLTG-PKGFSLSS
YGSGSSTVEPFLIDEK---RITAKHVVFWVEKRL-AAQGIIPVW----------KE----
----------
>gi|145328262|ref|NP_001077877.1|	  unknown protein [Arabidopsis thaliana]
MATIAGGSFG---------------------------------------------VPSSR
ISITTPTLSSSS---LLPPLTLQ----------------------SGTRKDNLLRC-ALQ
ESST-SAVAT-------------------------EKKNKEEGEE---------------
----------STVAVPA--KKPKPAAKAA--AVAKPLRQMMEEDVIPPLQAILESQDDIS
DIDLSFQDDK--LEG------------FFL-KK-SIPYSFWAFFPTGNLTGEQKDFQFPH
TGQVRAPWNHFLSTRG---NQLRTTLCFGSRSVL-LHKGSSPFG----------TN----
---EVFVH-L
>gi|30678093|ref|NP_849933.1|	  unknown protein [Arabidopsis thaliana]
------------------------------------------------------------
---------------MHKTECLA----------------------QKFEKSNFLVL-FL-
-------VAT-------------------------EKKNKEEGEE---------------
----------STVAVPA--KKPKPAAKAA--AVAKPLRQMMEEDVIPPLQAILESQDDIS
DIDLSFQDDK--LEG------------FFL-KK-SIPYSFWAFFPTGNLTG-AKGFSISS
HGSGPSTVEPFLVDER---KPTANHVVFWVEKRL-AAQGIIPVW----------NQ----
----------

Ad blocker interference detected!


Wikia is a free-to-use site that makes money from advertising. We have a modified experience for viewers using ad blockers

Wikia is not accessible if you’ve made further modifications. Remove the custom ad blocker rule(s) and the page will load as expected.