FANDOM


>gi|15228059|ref|NP_178487.1|	   780 residues, 50 /line  CR88 (EMBRYO DEFECTIVE 1956); ATP binding [Arabidopsis thaliana]
--------------------------------------------------MAPALSRSLY
TSPLTSVPITPVSSRLSHLRSSFLPHG-GALRTGV-SCSWNLEKRCNR---FAVKCDAAV
AE-KETTEEGSGEKFEYQAEVSRLLDLIVHSLYSHKEVFLRELVSNASDALDKLRFLSV-
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------TEPSLLGDGGDLEIRIKP--DPDNGTITIT---------DTG
IGMTKEEL-IDCLGTIAQSGTSKFL----KALKENKDLGADNG-LIGQFGVGFYSAFLVA
EKVVVSTKSPKSDKQYVWESVADSSSYLIREETDPDNILRRGTQITLYLREDDKYEFAES
TRIKNLVKNYSQFVGFPIYTWQEKSRTIEV--EEDE----PVKEGE--------------
------------------------------------------------------------
----------E--GEPKKKKTTKTEKYWDWELANET------------------------
------------------------------------------------------------
--------------KP--------LWMRNSKEVEKGEYNEFYKKAFNEFLDPLAHTHFTT
EGEVEFRSILYIPG------------------MGPLNNED-VTNPKTK--------NIRL
YVKRVFISDDFDGELFPRYLSFVK-GVVDSDDLPLNVSREILQESRIVRIMR-KRLIRKT
FDMIQEISESENKED--YKKFWENFGRFLKLGCIEDTGNHKRITPLLRFFSSKNEEELTS
LD----DYIENMGENQKAIYYLATDSLKSAKSAPFLEKLIQK------------------
-----DIEVLYLVEPIDEVAIQNLQTYKEKKFVDISKEDLELGDEDEVKDR---------
---EAKQEFNLLCDWIKQ-QLGDKVAKVQVSNRLSSSPCVLVSGKFGWSANMERLMKAQA
L---GDTSSLEFMRGRRILEINPDHPIIKDLNAACKNAPESTEATR--------------
------------VVDLLYDTAIISSGFTPDSPAE--------------------LGNKIY
EMMAMAVGGRWGRVEEEEESSTV-------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------------------------------------N----------------------
------------------------------------------EGDDKSGE---TE-----
------------------------------------------------------------
----------------------------VVEPSE--VRAESDPWQD--------------
-------------------
>gi|126640478|ref|YP_001083462.1|	   1041 residues, 50 /line  ribonuclease E [Acinetobacter baumannii ATCC 17978]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
MREIANSYFQAD--P-RQTSNIRELITEGTELLVQVEKEERGNKGAALSTFISLAGRYLV
LMPNNPKGGGISRQISGSVREELKEILASLNVPRGMSVIVRTAGIGRTQEELQLDLQHLL
DLWAQIQGTASSGPSPMLVHQEAGVVTRAIRDYLRDDVAEILIDSEQAYNEAYNFVKAVM
PRQLDKLKTYTLNEPLFAHFGIESQIQTAYEREVKLPSGGSIVIDQTEALVSIDINSAKS
TRGHDVEETALNTNLEAAEEIARQLRLRDIGGLVVIDFIDMTKERNQRMVEAKLREATQS
DRARIQFGQLSRFGLMEMSRQRLRPSLEEATGYVCPRCHGTGMVRDLRSLSLSIMRKVEE
IALRERHGEVQVEVPVEIAAFLLNEKRHSLVYLEQTSGVRVTVLPHPHLETPHYEIAYNP
DGFA-PSSYERTEATRS--SEKELGYE-----SSEWHLEEADHGHAHVTATA----ST-H
AAAQKKA-NHATQ-----------PVA---QPSAQKAASPCAWL-ENLFVQKQAQ-TVD-
------QSRSAQNAA-------AAIEQ----MVNTGAVSRGQFGQVAVPAVAEVAPVQSN
NAYISQSPVKQDVRE----HVEKDDKSQQQRQNNKKRKHKEQREQHHQSHEQQHQVHEEV
VQ-----LSRQEQRELKRQQKRQQQ------QDQQHQNNDVQHTENAVPRRDRNNQQRPN
RPNRHRDPSVLNENQNTPVVVDEKQIKVDVIDAPKHDVMNTALIINVDQGQSEIVALTPE
RRHVERVETTSTEVAQEPTPAPVVAEKAAV----VETKEEAQPS---------QEAAQPQ
IKRASN--DPRMRRRQQREAKHAKAA--------TPSIAPSQIPTLAQHTIGSLIRHVYG
EDCTVLIEQFGLVPTFNRALQKFAEQYASTLVVEVTAETEEKKPVTRDAELPSHKPAEEA
EPAPVLPLTPPQAPAPRVANDPRERRRLAKLAAEQAFEQVKQQHSAQ-------------
--------EEVATPAPVAE----ETVAAPTAETQATVE--PAQQPLE------------L
NQSTEVVQPEAAPAEEKATEE-------------TVA--EAPAAKEPAPSKAASKAKAAA
EETVAPAEATTDTESEDVKAD--KDKPSRPRRPRGRPPKKANPV----------------
-------------AE----
>gi|6755863|ref|NP_035761.1|	   802 residues, 50 /line  tumor rejection antigen gp96 [Mus musculus]
MRVLWVLGLCCVLLTFGFVRADDEVDVDGTVEEDLGKSREGSRTDDEVVQREEEAIQLDG
LNA---------------------------------------------------------
--SQIRELREKSEKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISL-
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------TDENALAGNEELTVKIKC--DKEKNLLHVT---------DTG
VGMTREEL-VKNLGTIAKSGTSEFLNKMTEAQED----GQSTSELIGQFGVGFYSAFLVA
DKVIVTSKH-NNDTQHIWESDSNEFSVIADP-RG--NTLGRGTTITLVLKEE-ASDYLEL
DTIKNLVRKYSQFINFPIYVWSSKTETVEEPLEEDEAAKEEKEESDD-------------
------------------------------------------------------------
-----EAAVEEEEEEKKPKTKKVEKTVWDWELMNDI------------------------
------------------------------------------------------------
--------------KP--------IWQRPSKEVEEDEYKAFYKSFSKESDDPMAYIHFTA
EGEVTFKSILFVPT------------------SAPRGLFDEYGSKKSD--------YIKL
YVRRVFITDDFH-DMMPKYLNFVK-GVVDSDDLPLNVSRETLQQHKLLKVIR-KKLVRKT
LDMIKKIA--DEKYN---DTFWKEFGTNIKLGVIEDHSNRTRLAKLLRFQSSHHSTDITS
LD----QYVERMKEKQDKIYFMAGSSRKEAESSPFVERLLKK------------------
-----GYEVIYLTEPVDEYCIQALPEFDGKRFQNVAKEGVKFDESEKTKESRE-------
---ATEKEFEPLLNWMKDKALKDKIEKAVVSQRLTESPCALVASQYGWSGNMERIMKAQA
YQTGKDISTNYYASQKKTFEINPRHPLIRDMLRRIKEDEDDKTVMD--------------
------------LAVVLFETATLRSGYLLPDTKA--------------------YGDRIE
RMLRLSLNIDPEAQVEEEPEEEPEDTSEDAEDSEQDEGEEMDAGTEEEEEETEKESTEKD
ELEISREYFSKA-PE-GGRINIKDVLKEGQEVIVQVEKEERGNKGAALTTFISLAGRYLV
LMPNNPRAGGISRRIEGEERNELREALNGLNAPADMGLIVRTAGLGRSSEEMQWDLDYLL
QLWSAIKEASTSRPAPFLIYQESNVIIRAIRDYLRQDIGEVLVDSVEAQEEALSFIQQVM
PQYASKIKLYEDSVPLFNRFQIESQIETAFQREVKLPSGGSIVIDPTEALVSIDINSARA
TKGSDIEETALQTNLEAAEEIARQLRLRDIGGLIVIDFIDMTPAKNQRAVEEKVREALEA
DRARVQVGRISRFGLLEMSRQRLRPSLGETSGIVCPRCNGQGIIRDVESLSLAILRLIEE
EALKDRTAEVRAQVPIPVAAFLLNEKRNSITKIELRTRARIVILPNDHLETPHFEVQRLR
DDSPEALSGQTSYEIAA--TAENEEAAA----HPAAATRTLVRQEAAIK--A----AP-R
SSAPVAA-EPQPA-----------PLTPTKAPEPSLFKGLVKSL-VSLFAGKEEEAQPA-
------VTEKKNNER-------PPREE----RRNGRQQSRN-------------------
-------------------RGGRRDDERKPREERAPREERQAREPREERQPREERAPREE
RA------PREPREGQENRRERKPR------EERAPREERVRELR--EPLDTAGNEQREE
RAE--RQPRAERQERQRPPRE-ERQPRAEQAEALQDEALPN-------------------
-------------------------------------EEQLQDD---------EQDNNDG
ERPRRR--SRGQRRRSNRRERQRDAD--------GNLIESAENSEAAGNDAQAVTPVAVA
TAAAVVAESVD-----------SSENVASEAPASEAPAIE--APSVQVEEAPAAQPVEAQ
AEAAVSEVVE--------------AAPITEKAVEAEPAAVETPAAVE-------------
--------ALVAEPVAQAE----PTVEVAQEPAPAPVEQAPAAAAVPA-----------N
ATGRAPNDPREVRRRQREAERLAREAAEAAAAAPAVE--AAPAVEASAPAE----AEAAV
VETAPAAEPVTEAQADPIASEQEAGEAVEPAQPEAEPQDDKEEVKP--------------
-------------QV----
>gi|113868542|ref|YP_727031.1|	   1024 residues, 50 /line  Ribonuclease G and E [Ralstonia eutropha H16]
------------------------------------------------------------
------------------------------------------------------------
-----------------------MKRMLFNATQQ--------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------------EELRV----------------------------
------------------------------AIVD----GQKLIDI---------------
------------------------------------------------------------
--------------------------DIETAGREQRKG----------------------
------------------------------------------------------------
-------------NIYKGVITRIEPSL---------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------EACFVNYGEERHG--------FLPF
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-KEVARAFFKEG-ID-VRNARIQDALHEGQELIVQVEKEERGNKGAALTTFISLAGRYLV
LMPNNPRGGGVSRRIEGEDRQELRETMAQLTVPEGMSIIARTAGIGRSAEELQWDLNYLL
QLWKAIDGAAGDNKAPLLIYLESSLVIRAIRDYFQPDIGEILIDTDEIYEQARAFMSVVM
PDNMNRVKKYRDDVPLFSRFQIEHQIESAYSRMVMLPSGGAIVIDHTEALVSVDVNSARA
TKGADIEETALRTNLEAADEIARQLRLRDLGGLIVIDFIDMESGKAQKDVETRLKDALRH
DRARVQMGKISRFGLMELSRQRLRPSLSEGSHITCPRCNGTGHIRDTESSALQVLRIIQE
EAMKENTAAIHCQVPVEVAAFLLNEKRQEINLIELRFKVNVLLIPNKHLETPHYKLERLR
HDDPRLEESTASYRMAE--AAAKELEADTSY-SSRRKEEAKPRQEAAVKGI-----TP-E
QPAPVSVPRPERA---PKPEAP--VAPPVPATQPVVSGGFIAWL-KGLFGARPATPPVVE
------P-AKPAVAT-------EARSAEGRRERGQRGEGRGL-----RGERGDRAERG--
ER-AERGERQGRG-Q---------RGDRAERAERGERQGAERGEQREGRGERQGRQP---
RQ---------QGEGQ-ATPALARQGE-------AVQAERAQGER----VEGRQ------
---EGRRD---RNQERRERQRERQRERSELREAE---AGEA-------------------
PRPE------AVAAA--------------------QALGVLP-QAVTEE-----TQAVRA
ELPEGAE-STAETAEGEERRRRNRRGRNRYRRERDESVQVAQGEG---DEEAAAAEAVAP
VRAEAPV----PAEPAPQA----AVA-VAAAAEAVEAIRIAVPEDV--TPAPVAEAAPV-
------------------------TAPV--------------------------------
---------AEPAPQQAAPVAVAVTEA----IAAEAIVETTASVAVEAAPVVAAP--AAA
PVAAPVAEAAPAEVFA---------PAAPVVAAAPATPA--ALENLES---MLATAGLQW
VHTDSDKLRSAQEAAARIAPAPRVQRERKALPP--LPHGPMILVETG-GREVE------M
------ASQ-----Q----
>gi|94311376|ref|YP_584586.1|	   1037 residues, 50 /line  ribonuclease, Rne/Rng family [Ralstonia metallidurans CH34]
------------------------------------------------------------
------------------------------------------------------------
-----------------------MKRMLFNATQQ--------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------------EELRV----------------------------
------------------------------AIVD----GQKLIDI---------------
------------------------------------------------------------
--------------------------DIETAGREQRKG----------------------
------------------------------------------------------------
-------------NIYKGVITRIEPSL---------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------EACFVNYGEERHG--------FLPF
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-KEVARAFFKDG-VD-VRNARIQDALHEGQELIVQVEKEERGNKGAALTTFISLAGRYLV
LMPNNPRGGGVSRRIEGEDRQELRETMAQLQVPEGMSIIARTAGIGRAAEELQWDLNYLL
QLWKAIDGAAGDNKAPLLIYLESSLVIRAIRDYFQPDIGEILIDTDEIYEQARAFMSVVM
PDNMSRVKKYRDDVPLFSRFQIEHQIESAYSRMVMLPSGGAIVIDHTEALVSVDVNSARA
TKGADIEETALRTNLEAADEIARQLRLRDLGGLIVIDFIDMESGKAQKDVETRLKDALRH
DRARVQMGKISRFGLMELSRQRLRPSLSEGSHITCPRCNGTGHIRDTESSALQVLRIIQE
EAMKENTAAIHCQVPVEVAAFLLNEKRQEINLIELRFKVNVLLIPNKHLETPHYKLERLR
HDDPRLEESTASYRMAE--AAAKELEADTSY-SSRKKEETRPRQEAAVKGI-----TP-D
APAPVSVPRPERV----RPEAP--AARPAPATQPVASGGFIAWL-KGLFGAKPATPPE-A
------P-AKPAAET-------PSRGGEGRRERGQRGEGRGE-------GREGREGRE--
GR-EGRGQRGERGEQ---------RGDRQGRGQRGERSEQQRGEQREQREPREQRGERPA
RA---------PREGQ-ATPAI------------------AQPER----AEARQ------
---EGRRE---RSQERRERQRERQRERNEARETDEALSTEA-------------------
PQLAVGAAQVAPVAA--------------------AAAAAAAAAMVAVT-----TEADTT
ELPAGV--EGAETGEGEERRRRNRRGRNRYRRDRDDTAQNAEGID---GDEANLAEVSAG
VTESESE----STGFQP-A----VAE-ADESVKAVETAVAVTPAEV-APAAPVAPVAPVA
SEPVFAAVAEPQ------------AAPV--------------------------------
---------VTPAPVETAPVVAAPVAAAP--VISEPVIATPDVAPAPVAAPVAAP--VAA
PVAAPVAAVVETVAVV---------SAATQVTAAPS------AENLEP---MLAAAGLEW
VRTDGDKHRAAQEAASQIVPAPRVPRERKPLPP--LPEGPMVLVETG-GVQQA------A
AQQQ--QQQ-----Q----
>gi|124265849|ref|YP_001019853.1|	   998 residues, 50 /line  putative ribonuclease E (RNase E) protein [Methylibium petroleiphilum PM1]
------------------------------------------------------------
------------------------------------------------------------
-----------------------MKRMLINATQS--------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------------EERRL----------------------------
------------------------------AIVD----GQKLLDF---------------
------------------------------------------------------------
--------------------------ETEIEGREQRKG----------------------
------------------------------------------------------------
-------------NIYKAVVTRVEPSL---------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------EACFVDYGEDRHG--------FLPF
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-KEISKQFFKEG-VT-VRDAKIQDVISNGTELLVQVEKEERGNKGAALTTFVSLAGRYLV
LMPNNPRGGGVSRRIEGEDREELKENLDQLEYPKGMSLIARTAGIGRSAPELQWDLNYML
KLWSAIDGAAKAGKGAFLIYQESSLVIRAIRDYFHADIGEILIDTDDIYEQAQQFMNHVM
PESASRVKRYKDDAPLFSRFQIEHQIETAFSRTVNLPSGGAIVIDHTEALVSVDVNSARS
TRGSDIEETATRTNLEAADEIARQMRLRDLGGLIVVDFIDMEESKNRREVETRLRDALRT
DRARVQFSSISKFGLLELSRQRLRPALSEGSHITCPRCNGTGHIRDTESSALQILRIIQE
ESMKENTAAVHVQVPVEVTSFLLNEKRTEITKIELRQRTTVLLVPNKHLETPNYKLERLR
HDDPRLENLQASYTMIE--EPDDEV----GI---TRREKAKAKQEPVIKGV-----LP-D
LPAPVAAPKPEPVAKAPVAAAPPVVAAPVPASRDAGGGGFFGWL-KKLFGGDVPPAAAPA
------V-SAPAAQP-------AK----PAREGG-----RDGQRDGGRGRRGGRDGQRGE
RT-EARGERGERGEDRNR-RGGGAGEQRDGRGRRSERPEGAVAE---TAGLSA-------
-----------DRPPR-NEPRR---GPRPESAPASAAEDLTLPLA----AEGVAAADAT-
ENAEGGEG-----ARRRRRRGGRGRGER------DEARSDA-------------------
PE----------GAV--------------------EGAAVDAAPSTDED-----SLPPRA
EGEAAPDDE--TAGEGGEPRRRRRGGRGRRERGE--GDNGAPVAAAPLSDVAGGDDAAAS
SSAADTV----KPWWEATP----TAE-------------------------PTAAAEPAV
AAPTPPQPA----------------------DVAL-QALAD-------------------
--------VVSRPPVATPPASVP-V-------------AAPVVARAPAPAPVAIE-PV-A
DAAPPAAAA---------------------ALPPY----ALPIDDLAA---VATSAGLQW
VNSDADKVRAVQQAMADAPKPVHVPREPKPVVA--IDDGPLVLVETR-KDLSQ------I
KLPFEG--------R----
>gi|89900509|ref|YP_522980.1|	   1007 residues, 50 /line  ribonuclease, Rne/Rng family [Rhodoferax ferrireducens T118]
------------------------------------------------------------
------------------------------------------------------------
-----------------------MKRMLINATQA--------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------------EERRL----------------------------
------------------------------AIVD----GQKLLDY---------------
------------------------------------------------------------
--------------------------EIEIEGCEQRKG----------------------
------------------------------------------------------------
-------------NIYKAVVTRVEPSL---------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------EACFVDYGEDRHG--------FLPF
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-KEISRQYFQPG-VA-VGQARIQDAIREGQELLVQVEKEERGNKGAALTTFVSLAGRYVV
LMPNNPRGGGVSRRIEGEDRADLKEALDQLEYPNGMSIIARTAGIGRSAPELQWDLNYLL
KLWAAIDGAAKGAKGAFLIYQESSLVIRAIRDYFNNDIGDILIDTDDVFDQAQQFMAHVM
PEHADRVKRYRDDAPLFSRFQIEHQIESAYARTVQLPSGGAIVIDHTEALVSVDVNSARA
IKGSDIEETATRTNLEAAEEVARQMRLRDLGGLIVIDFIDMEESRNRRDVENRLRDSLRQ
DRARVQFATISKFGLMEMSRQRLRPALSEGASIPCPRCGGSGHIRDTESSALQILRIIQE
ESLKDNTASVLCQVPVEVASFLLNEKRAEIAKIELKQRINVLMVPNKTLETPNYKLERLK
HDDPRLDNIESSYKLAD--QMEDAT----AV--TRRSQEPTNKQTPIIKGV-----LP-D
APAPVAPPRPEPVKPAVAARTAPRPVPASVAPVPPVEGGFFGWL-KRLFAPEATPVVPAQ
------P-KADSAQA-------DKREERPSREGARRGEPRSDGRDEGRGGRGGR----GG
RG-DGRGDG--RGDG----RGDGRGDGRGGRTGRGERPASGPRERFDGEGRPA-AMDTGA
SQVQTSLNGTGQEASR-TEPGQERPARNSERGGRGGRGGRGRSER----VDGVESTSPA-
EREELRPD---LRNERRPERNRRPDANV------ANVPSDA-------------------
FN------------Q--------------------ESNRTDVLLAVSRE-----NVADLE
PGLAAQATERPEGTPTREKRSRDRYGRDRAPRGE--RPEQGERQDQPSRDSQPSAE----
PSAQEPR----KSYF--------TAS-------------------------PEAAATPAE
PTPVAATPA---------------------------------------------------
----------------AAPAAIP-V-------------AVSSAAPEPVATPVTVS-MVAA
PAAEPVAAA---------------------AAMPRLEQFELPLGELVQ---VAQSSGLSW
VNSDPEKIAAVQAAIAAEPKPVHVPRERPAVVK--VEGGPLVLVETK-RDLRN------M
TLPFEEKEP-----Q----
>gi|134095278|ref|YP_001100353.1|	   973 residues, 50 /line  RNase E: endoribonuclease for rRNA processing and mRNA degradation [Herminiimonas arsenicoxydans]
------------------------------------------------------------
------------------------------------------------------------
-----------------------MKRMLFNATQQ--------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------------EELRV----------------------------
------------------------------AIVD----GQKLIDI---------------
------------------------------------------------------------
--------------------------DIETTGREQRKS----------------------
------------------------------------------------------------
-------------NIYKGVITRIEPSL---------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------EACFVSYGEDRHG--------FLPF
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-KEVARTYFKEG-VD-VRNASIKDALREGQEIMVQVEKEERGNKGAALTSFVSLAGRYLV
LMPNNPRGGGVSRRVEGEDRQELRETMDKLDLPQGMSVIARTAGIGRNVDELQWDLNYLM
QLWRAIEGAGQSGAGAFLIYQESSLVIRAIRDYFQPDIGEILIDTDDIYEQAQQFMSHVM
PDMVHRVKRYRDDVPLFSRFQIEHQIETAYSRTVPLPSGGAIVIDHTEALVSVDVNSARA
TRGSDIETTAFHTNCEAAEEVARQLRLRDLGGLIVIDFIDMENSKNQREVETRLKDALHY
DRARVQMGKISRFGLMELSRQRLRPSLSEGSHVTCPRCNGTGHIRDTESSALQVLRIIQE
EAMKENSASIHVQAPVDVAAFLLNEKRGEILKIETRHRVSVILIPNKHLETPHYKLERIK
HDDPRLEEVQASYAMTE--QADTDI----SY-DKRLKVEAKPRQEAMVKGI-----TP-D
H-APVVERKPVEMATA----------------AAPAEKGFFQKL-MAFFSGSPEQPKAA-
--------------P-------AQAVQEDKNQRNQRGERKDGGRNQRNRSRGGRGGR--E
RG-EEREETATKPAPAAS-------ETQNARPPRPPREPREPREPRDGNEGRR-------
-----------------------------ERTPRPPREERKEVVA----ED---------
---------------------------A------SLLPVDA-------------------
V-----------VAT--------------------TAAARTTPPAAEAN-----GNVAVV
LDENGIPVEA-VEGEEQPRRRRRRGGRNRNRRDRDNTESGTENESNEDGVVALQDDSLQD
EAAQTPA----TAHVSATE----MAS-TVASTVRQETVAHVTEASI-ASEAPVSALTSAI
AAPLIPQEVMPQ------------AEPEVAAPVVA-VPAAP-------------------
--------APEPEPVVAAPAFVA-VEAAPVVEAVPAIEPAPVAAVTPAPMPQPAP--VIA
PVPAPVATV---------------------SAAPAASTS--KVDDLSE---VLQSAGLVL
ASTDPEKLRAAQEEAAKFVPPPRVPRERKPLPP--QSTEPLVQMETK-R-----------
-------------------
>gi|82702193|ref|YP_411759.1|	   977 residues, 50 /line  ribonuclease, Rne/Rng family [Nitrosospira multiformis ATCC 25196]
------------------------------------------------------------
------------------------------------------------------------
-----------------------MKRMLFNATQP--------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------------EELRV----------------------------
------------------------------AIVD----GQKLIDL---------------
------------------------------------------------------------
--------------------------DIESAGKEQRKS----------------------
------------------------------------------------------------
-------------NIYKAVITRLEPSL---------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------EAAFVEYGGERHG--------FLPF
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-KEISRSYLKES-PD-PGRVRVQDALHEGQELIVQVDKDERGTKGAALTTYISLAGRYLV
LMPNNPRGGGVSRRIEGEDRAELRDVMSHLNIPQGMSIIARTAGIGRTEEELQWDLNYLL
QLWRAIEDASKGQSGAFLIYQESSLVIRAIRDYFNQEIGEILIDTESIYEQACQFMGHVM
PGNVARVKLYRDDVPLFSRFQIEHQIETAYSRQVTLPSGGAIVIDHTEALVSVDVNSARA
TRGSDIEQTALATNLEAADEIARQLRLRDLGGLVVIDFIDMEVSRNQREVENRLHDALRY
DRARVQMGKISRFGLLELSRQRLRPSLGESSYISCPRCHGTGHIRGTDSSALHILRIIQE
EAMKENTAVLHAQVPVDVATYLLNEKRAEIHAIEARLKVSVVLIPNIHLETPNYSITRLR
HDDVKLGEVQTSYQMVE--KPAQDI----PL-PSSGQEPKPMRQQAAVRGI-----TP-A
QPAPVREQKPQH---------EPEPL--------SLLDKIFGWF-KQGGVGEKT-VRHEP
------P-VAA-----------AHPEERGQGRRDRREGR------IGENEKAARAVQR--
----PRDARAERGAEISP-SG-APDLTREAVPQRQERSEAKTQ----GERAAA-------
-----------------------------KKHPRSQREEKPRTEL----KPSSELPPATE
EAVQPSEE-----GSRRRRRGGRQRDRS------E-RLDRA-------------------
AR----------EAR--------------------QAIAKDSPLQQSAE-----QV----
--------------------------------------------------------AHEE
NPAADLI----SGAINGIP----PLI-LASTPLEQKEASKESPAGA-KNNTPSELLRTDR
TLPVIMPEAVSE------------ASPEVVPQVAA-MESTSAPAVTIAEKVALANEQQIT
PESPDR--LPEDRREAATAAAVT-VTGAPILIASEPLVEVEAARVVPEDIPSQIP-LSAL
ETAMPHTKIEQEEVPA---------KEGH-QAVPPQQPGAT--PSLD-----LGAAGLIM
IETLPEKIRPAETEAEGEAMKAQPRRRRTPPPPVIEQQEALVQVETH-K-----------
-------------------
>gi|17545759|ref|NP_519161.1|	   1014 residues, 50 /line  PROBABLE RIBONUCLEASE E (RNASE E) PROTEIN [Ralstonia solanacearum GMI1000]
------------------------------------------------------------
------------------------------------------------------------
-----------------------MKRMLFNATQQ--------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------------EELRV----------------------------
------------------------------AIVD----GQKLIDI---------------
------------------------------------------------------------
--------------------------DIETAGREQRKG----------------------
------------------------------------------------------------
-------------NIYKGVITRIEPSL---------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------EACFVNYGEERHG--------FLPF
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-KEVARAYFKNG-VD-VRTARIQDALAEGQELIVQVEKEERGNKGAALTTFISLAGRYLV
LMPNNPRGGGVSRRIEGEDRQELRETMAQLQVPEGMSIIARTAGIGRSAEELQWDLNYLM
QLWKAVDGAAVENKAPLLIYLESSLVIRAIRDYFQPDIGEILIDTDDIYDQARAFMSVVM
PDNMNRVKKYRDDVPLFSRFQIEHQIESAYSRMVMLPSGGAIVIDHTEALVAVDVNSARA
TKGADIEETALRTNLEAADEIARQLRLRDLGGLIVIDFIDMESSKAQKDVETRLKDALRH
DRARVQMGKISRFGLMELSRQRLRPSLSEGSHVTCPRCNGTGHIRDTESSALQVLRIIQE
EAMKENTAAIHCQVPVEVAAFLLNEKRPDINLIETRFKVNVLLIPNKHLETPHYKLERLR
HDDPRLDDNKASYKMAE--EAAKELEADTAY-ST-RKEAAKPRQEAAVKGI-----TP-E
QPAPVSVPRSERPARAEAT-----PAAPQAAAPVPAQGGFVSWL-KSLFGGKPAEPVVAA
------P-VETPKRA-------EDGNRRDRGNRQDRGG-----RTGQRGERGERQGQQ--
QA-GRDGQRQGQG------RDGGRNEAREGQAQREGQREGQRG-GRDRNRQPAETAERET
------VEARQPQQGQEAREGQGRRERSQERRERAPREGR--------------------
EGREPREG----------REPRESRDNREGRERDTQQAKEG-------------------
ASAAAATAVEGLIDP--------------------TAAAQVPQTLLDTT-----VPAEAI
TAEVAAP-DAEGSGEGEERRRRGRRGRNRYRRDREG----AEGVR---TEGEGESEGEGE
TAAGEPA----VETPPAVE----AAQ-P-AAPVQHETVAAPV-QPV-ETPAPVETAAPVV
QEPVQAAE----------------------------------------------------
-------------AVKPAPTLPAAQPAEPV--------AAVVAATPPTE-----------
-TAADTIVTALAEVPA---------PVASTVAKAPA----LPIGTLQA---VVADAGMTW
VHTDEQKLQAAKEDAARTVTPPRVPRERKPLPP--IQQGPMVLVETS-RPTDG------A
--------D-----Q----
>gi|33591687|ref|NP_879331.1|	   1042 residues, 50 /line  ribonuclease E [Bordetella pertussis Tohama I]
------------------------------------------------------------
------------------------------------------------------------
-----------------------MKRMLFNATHQ--------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------------EELRV----------------------------
------------------------------AIVD----GQKLIDL---------------
------------------------------------------------------------
--------------------------DIETAGREQRKG----------------------
------------------------------------------------------------
-------------NIYKGVITRIEPGL---------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------EACFVNYGEDRHG--------FLPF
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-KEVARSFFKEG-VD-VRTARIQDALREGQELIVQVEKEERGNKGAALTTFISLAGRYLV
LMPNNPRGGGVSRRVEGEDRQELRDTMEQLDVPQGMSIIARTAGIGRNVDELQWDLSYLL
QLWTAIDGAARDNAAPILIYLESSLVIRAIRDYFSPEIGEILIDTDEIADQATAFMSVVI
PDNVQRVKRYRDDIPLFSRFQIEHQIETAYSRTVQLPSGGAVVIDHTEALVAVDVNSARS
TRGADIEETALRTNLEAAEEVARQLRLRDLGGLIVIDFIDMEDSKNQRAVEQRLRDALHF
DRARVQMGKISRFGLMELSRQRLRPALNEGSHITCPRCNGTGVIRDAESSALHVLRLLQE
EAMKENTAAVHAQVPVDVATFLLNEKRADITKMEARLKVNLVLIPNKHLETPHHHIERLR
HDDPRLEETKTSFELAE--APATDL----TW-QP-REHEIKARPEALVKGI-----TP-A
QPAPVSTPAPAKA---------PA----AAAAAQGGLGGWFKRL-TSWLGGSAEPAKTET
------K-SEDEKRG-------ANRARRAHDGQNRRGERHGSDRN------------RHR
RN-EPRGEHAESGDARHHVRGGRRQEE---RGERGERGQKE------------ARTEREQ
TQQQQA-----AGQPRQERPSTAETGEEGGRGRGRGRRGRGRGRR----EEGQTDTPMT-
---------------EQENMVAALAETVATALPEKRQAAPA-------------------
PAAAAAAALTVAEAA--------------------SS-----NEQAPVT-----EDADGI
DGIDANADAGAETGTDPERKRRRRRSRRGRRSQEDGSTVNAEGVE---GADDEQADAPAG
VADIETP----AQPAEPET----VAAPVAVSVAADEPAATIETAAA-EPAAPQATEAPQ-
AEPVVAA---AD------------TAPQAVQPVQAELTPVETPQAQAQ------------
----------PAEPAAAAPVETAPVETAPVE--TAPVETTPVEAPVKPAEQAAAP----V
EAEAPVAQPEKTPEPA------AVRPAAAIVVPAQAAAP--ATGALHD---VLDAAGLTW
VETDPERHAQTQMRIAAAATPARLGRERKPVAS--VSNEPLVQVETR-H-----------
-------------------
>gi|119503336|ref|ZP_01625420.1|	   973 residues, 50 /line  DNA polymerase III delta prime subunit [marine gamma proteobacterium HTCC2080]
------------------------------------------------------------
------------------------------------------------------------
-----------------------MKKMLINATQP--------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------------EEIRV----------------------------
------------------------------AIVD----GQRLNDL---------------
------------------------------------------------------------
--------------------------DIENRSRGSTKA----------------------
------------------------------------------------------------
-------------NVYKAKITRVEPSL---------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------EAAFVDFGAERHG--------FLPL
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-KEIAHQYYRSTAPEGEGKTRIKDVLKEGTEVIVQVDKEERGTKGAALTTYISLAGRYMV
LMPNNPKAGGISRRIEGDDRTELRDALSQLNIPDGMGVIIRTAGVGRSPEELQWDLDYLL
QLWSSISSASDENKAPVLLYQESDVIIRSIRDYLRDDVDQVLIDDKAAWQQAHDFVTMVM
PKYAQRIRYYEDATPLFNRFQVEGQIESAFQREVRLPSGGSIVIDPTEALISIDINSARA
TKGSDIEQTALQTNLEAADEVARQLRLRDMGGLVVIDFIDMNANKNQRAVENRIRDALEV
DRARVQVGRISRFGLLEMSRQRLRPSLGEISAMVCPRCTGKGTIRDTKSLALAILRLLQE
EAAKDRTGEVRAVVPVEVAAFLLNEKRSAVNDIESSSGVRVLIIPNPHMETPHFDVIRLR
DDEV-EESTTLSYEVAI--ETPDPI----AV--RDEVSAIPAAPQPLVRGV-----TP-Q
EPAPVAAEPEAPA---PMAETR--DIKQQPKTESPQKTGILTRMWGALFAPAPSEEADIE
------TLTETEDSG-------HEESSEPKENANRQRRSR-GGRNRTRSRRPDSDVQAED
TD-EVDQTTVDADE----SDSSESNDDTDDRPKRNRR-----------------------
------------------------------------------------------------
---------------RRGRRGGQKRPLSDSSDV------EA-------------------
NEGE----------E--------------------HTGEDDIDDAVDND-----VQAAV-
---------AEESKESARHRPSDKRSEGRRRRQRGPKPDIQAE--TQADTAGTVTDAPVA
GTDENDAPIENAVSAEANQ----VPAPALSSVTDQIDLLAGTPEGAKQTEEPMVAASSVT
AQE--------------------------------------TDEANVTDEANVNDDTAQS
TQTAES----EPAPVTDAVAATSEEIASKEETVKPEEIIATAATIAPATAEVDRS-G-LT
DAGRAVNDPRVE---------------------------PKPIGEVN----VATLRQALF
LEQEAPPVSIVSRDI---PRASNDPRGPKAG--LAFTAAKRSPDESN-ED----------
TVPDAQA-------N----
>gi|117619748|ref|YP_856763.1|	   1039 residues, 50 /line  ribonuclease E [Aeromonas hydrophila subsp. hydrophila ATCC 7966]
------------------------------------------------------------
------------------------------------------------------------
-----------------------MKRMLINATQE--------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------------EELRV----------------------------
------------------------------ALVD----GQQLYDL---------------
------------------------------------------------------------
--------------------------DIESPGHEQKKA----------------------
------------------------------------------------------------
-------------NIYKGKITRVEPSL---------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------EAAFVDYGAERHG--------FLPL
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-KEIARNYFPSG-YSYQGRPNIKEVVREGQEVIVQIDKEERGTKGAALTTFISLAGSYLV
LMPNNPRAGGISRRIEGDERTELKEALSGLTVPDGMGLIVRTAGVGKSPEELEWDLNVLL
NHWDSIHKASQSRSAPVLIHQESNVIVRAIRDYLRRDVGEILIDNPVIFERAKAHIELVR
PDFLNRVKLYKGEVALFNHFQIESQIESAFQREVRLPSGGSIVIDPTEALTSIDINSSRA
TKGGDIEETALQTNLEAADEIARQLRLRDLGGLIVIDFIDMTPVRHQREVENRLREAVHQ
DRARIQLGRISRFGLLEMSRQRLRPSLNESSSHICPRCQGQGVIRDNESLALSILRLIEE
EAMKDNTEQVHGQVPVDVAAYLLNEKRASIASLEQRNDVRVYIIPNQHLETPHYEVTRIR
QNEI---PEAASYELKT--EIAKPV----YQ---PKQAQVIEREQPLLQGF-----VQAP
QPAPAA-PAP---VVAPAA-----PAAP----EAGLFGKLFKAI-SGLFGSDTAPADVKA
------PADKPAAQR-------EARKDEG--HRHQRDETR------SRGQRGRRDDNRGN
RSPADAAEKREAGAN----REGGESRNRRPRKEREPRQEREAR-----GEVREQRMEREP
REA---REPRQEREPRA---------PRPAREPRASREPRAEVVV-----DAVETVDTTM
VNDEPRLEKEQKVAERRERRQLRKQIR-----------VDA-------------------
PASDV-AALPADAPV--------------------VATEDASDSVEQHD-----EQAEGQ
RRSRRT--PRNQRIEGQRRKRINEDARSQ----REDEEQSAEGAT-PTLTAAAQADAAQV
KVEEPAVP----------V----ITIPSAEAVAAALQASAALTEHV----VPEAVVAEAH
-----EQAEVVA------------AEPVVTEAVVAAVVAEEAQVA---------------
---------VVNEPVVAEVAAPVAAEVVAV---EAPAIETAVVEAAPAAPAVEEAAPAVV
EQPAPVAEPVIADEAS------VATAVAAP--------------------------VAKQ
VKRGGGLLAGARKASAPMATPAAAPALP-VREP--VDHAPLVRSEVA-SSGRHGGSTAAV
NVATSPAGR-----P----
>gi|119478177|ref|ZP_01618233.1|	   956 residues, 50 /line  ribonuclease E [marine gamma proteobacterium HTCC2143]
------------------------------------------------------------
------------------------------------------------------------
----------MPKSSAYSGFVSNMKRMLINATQP--------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------------EELRV----------------------------
------------------------------GLVD----GQRLYDL---------------
------------------------------------------------------------
--------------------------DIENRTRVQMKD----------------------
------------------------------------------------------------
-------------NIYKGTITRVEPSL---------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------EAAFIDFGADRHG--------FLPL
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-KEISRDYFYRQPSDVQGRFKIRDVVKEGTEVIVQVDKEERGNKGAALTTFISLAGRYLV
LMPNNPRAGGISRSIEGEERSDLKDALNNMAIPKGMGAIVRTAAVGRSAEELQWDLDYQA
QIWDAIKKAAEDQPAPLLLLQDSNVIIRAIRDYLREDIDQVLIDAEEAYTDAMNFVTRIM
PHYESRIRLYQDPVPLFNRYQIESQIETAFQRDVDLPSGGSIVIDPTEALVSIDINSARA
TKGGNIEETALQTNLEAADEIARQLRLRDMGGLIVIDFIDMSAAKNQRAVENRMRDALNI
DRARVQVGRISRFGLLEMSRQRLRPSLGETSAKVCPRCTGQGTIRDTKSLSLSILRLVEE
SASKERSAEIRALVPVNVASYLLNEKRQPIHDIELRTGVRVVIAPIPQLETPHFELQRLR
DDEI-GKDVEISYKMQT--EIADETS---I----QVQQKAAAPQQAAVQSI-----AP-P
APAPLAAAKANIA-----------PDTA--TKSPGLLSKIIGFF-TGGDKDDEKKDE---
-----------------------QKKPEKRESTNRRP------Q--NR--GGQQNNNRNR
NRNRNKSRN---ESRNESNDRNEGND----RGTKDGNRN-AAPQQKKTHD---KVEPREA
------------PAANESHEDKPQRRPSNR------------------------------
----------------RPRSSQRRRNRGPNTENNEIENTSN-------------------
ELPKTPEAVNNGQDL--------------------QQLEPAIDHPVVAP---IAAVSEVA
EVSEVSAVAEVAEVAQVAEVA------EVSEVVEVAEVA----EVTEISEVAEVAEVIVA
PVTEVELIVESTPETVIVD----QQET------------PASDEILEPD-----------
---T------TA------------EAPSVDNAVVETEM------EPL------E----AA
IANTAS--SAIAEP-------PVEEEAVVT---DNAANTALTEAPTESGTAEASPTSAEA
PVGRASNDPRLTPKTI---------------------------DAVEIETEHLDTIPKAP
AAAAEPD-----SEKAAPSRAPNDPRHK--------------------------------
--------------R----
>gi|90415858|ref|ZP_01223791.1|	   1008 residues, 50 /line  ribonuclease E [marine gamma proteobacterium HTCC2207]
------------------------------------------------------------
------------------------------------------------------------
-----------------------MKRMLINASHT--------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------------EEVRV----------------------------
------------------------------AMVD----GQKLYDL---------------
------------------------------------------------------------
--------------------------DIENRTREQKKA----------------------
------------------------------------------------------------
-------------NIYKGKITRVEPSL---------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------EAAFVDYGADRHG--------FLPL
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-KEISREYFKGKSSD-GGRVNIKDAIREGQEIFVQVEKEERGSKGAALTTFISLAGRYLV
LMPNNPRAGGISRRIEGEERADLREAMRGLDIPEGMGAIVRTAGIGRATEELQWDLDYLL
QLWNTIEAEAEGAKAPHFLFQESNVIVRAIRDYLRQDVGEVIVDSQDAYNLAAAFIGTVM
PDFTNKVKFYQEQIPLFNRYQIENQIETAFRREVSLPSGGSIVIDITEAMVSIDINSARA
TKGGDIEETAFNTNKEAAEEVARQLRLRDVGGLIVIDFIDMLNTRHQKEVENTIREALKI
DRARVQVGRISRFGLLEMSRQRLRPSLEETMSKICPRCKGQGTIRGTRSLALSILRLIEE
EAQKEFSKEIRAIVPVSVATFLLNEKRSEIADIESRNKINVVVLPNTQMETPHFEVVRIR
AQDDDDSDGEFSYKLAH--ELSSKEP---EQ-DLERTSAPLPISEPAVKTL-----VP-H
KPAPIMPEKAAPT-----------AAAAVKTEKPGLLKRIWESI-FGGSSTEAKKTE---
----------------------DEKKTRPRGSNSRRG---GQNQ--DS--RNRQGNRRPN
NRNRNRNRN---EGRNDSNRDAEGTETQAKSADKQGQGR-GRNDQSRPAA---KQDTREQ
KVDSASTATQTADKGPETGEGGELKKRPND------------------------------
----------------KRRGPRRRRQRQ-DVPANVTEQLSA-------------------
DI-----AVETSTVA--------------------ADSSPSVESKTAAP--------ETA
AQVTTDTTAEATETKPARKRPAR-RRKPKADVVETGETA----E-TGSTEATPTAPVV-A
DTQDSAAAPEEKPAPKPRA----LRKA------------PAKPKKVEADASSSAAASEAT
AAPE------KA------------EAPQSTEAEAPKPTEAEAP-KPT------E----AE
APKPTK--ADAPKP--------AEKPKAPK---KAAAVVEVIEKAAPKAEAKATAKPARA
ATARASNDPRFKPKPV---------------------------SDVKVSTARVEKPAAVA
LDTSKPAPTA--APKAPVARASNDPRKNRASQATKADSAPSDTGSAK-E-----------
--STEKGPQ-----A----
>gi|87118929|ref|ZP_01074827.1|	   1029 residues, 50 /line  ribonuclease E [Marinomonas sp. MED121]
------------------------------------------------------------
------------------------------------------------------------
--------------------------MLINATQQ--------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------------EELRV----------------------------
------------------------------ALVD----GQRLYDL---------------
------------------------------------------------------------
--------------------------DIESGSREQTKA----------------------
------------------------------------------------------------
-------------NIYKGRITRIEPSL---------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------EAAFVDYGADRHG--------FLPL
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-KEISKTYFSKKPNHGDGRINIKDVLSEGQEVVVQVDKEERGNKGAALTTFVSLAGRYLV
LMPNNPRAGGISRRIDGDDRTQLKEAMSGLNMPDNGGLIVRTAGVGRSTEELQWDLDYLN
TLWNSITGAASEKPAPFLIYQESNIVIRAIRDYLREDIGEVLIDEKSVYQDAMNFVMQVM
PHFKSRIKQYTDQTPLFNRFQIESQIETAFQREVRLPSGGSIVIDPTEALVSIDINSARA
TKGGDIEETALQTNLEAADEIARQLRLRDIGGLVVIDFIDMTPVRNQKEVENRMKDALEA
DRARVQLGRISRFGLLEMSRQRLRPSLGETSGIVCPRCTGQGFIRDVESLALSVLRLIEE
ECAKERTAQIRAVLPVSVATFLLNEKRTNIAKIEKRNHVHIILVPNPHMETPHFEVERIR
DDSSSVVQNENSYTLVE--TPEQPPY---E----PRQTDQETRQKAAVTSI-----AP-A
APAPAP---SDIK-----------PVSK-KAQPVGFFKRILNAI-FGVEENKEEKQT---
-----------------------ENKPSTKKTNPRNN----------R--NTKNRNTRGN
NRNVKQVHT---EEVESKDSRSTRKSRREQAEAKTNNRKPSRNQQQENKN---NNDETQS
KQQRPQRKEKVIPEVKERKRERNQNKRRNGKLKDEANKANEEALAAKAQQQASEEAAAAE
KANKPTQENGEAVR--EKRNPSRRTRRGGQNRNRD---QAK-------------------
EEVQTTEATATAVTE--------------------VKAEPRVEAKVET----------EA
KVETVATPETAPEVTAEAKTEALPDTAPEAKVEEAVSEV----K-VEATPETKVEEAAP-
----EVKVEEAAPEAKVE------VEV------------EATPEAKVEEAAPEVKVEEAP
EAK-------VE------------EAPEAKVEAAPKAKVEAAPKAKV------E----AA
PEAKVE--EAAPEAKA-----KAEEAEAVT---EKATPEAVAVTEAEVAESTDTTSAKKR
APRRARGKPTIKAEAP--------------------------KAAVELPQAVIDQQEKQK
AERAKRNAEAKPRRSRSESRVKNDPRAA------KQESAPSTTAETA-N-----------
-------LS-----E----
>gi|83644954|ref|YP_433389.1|	   1056 residues, 50 /line  Ribonucleases G and E [Hahella chejuensis KCTC 2396]
------------------------------------------------------------
------------------------------------------------------------
-----------------------MKRMLINATQP--------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------------EELRV----------------------------
------------------------------ALVD----GQKLYDL---------------
------------------------------------------------------------
--------------------------DIESGTREQKKS----------------------
------------------------------------------------------------
-------------NIYKGKITRIEPSL---------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------EAAFVDFGAERHG--------FLPL
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-KEISREYFKSQPQK-GGKMNIKDLLQEGQEIIIQVDKEERGNKGAALTTFISLAGRYLV
LMPNNPRAGGISRRIEGDDRDQLKDAMSGLTVPKDMGLIIRTAGVGRSSKELQRDLDYLL
QFWDSIRHASDSKPAPFLIYQESNVVIRATRDYLRQDIGEVLIDHPQVHQDALNFVKAVM
PNFENRIKLYQDDIPLFNRYQIESQIETAFQREVKLPSGGSIVIDPTEALVSIDINSARA
TKGGDIEETALQTNLEAADEIARQLRLRDIGGLIVIDFIDMTPNKNQREVENRLKEALEL
DRARVQIGKISRFGLLEMSRQRLRPSLGETRNEMCPRCKGQGSIRGVESLALSVMRLIEE
EAFKERTAEVRAICPISVATYLLNEKRENLAKTQKRHGVKVIVVPNSHMDTPHFEVQRIR
DDNANV--SEISYNVRP--EMEEKNP---VE---SLLHKEVVRQEAAVKTI-----VP-S
S-TPTP-----------------------PSEEVGLLKRLRQKV-SKMFSGEKKDSDLKI
------TVAESPQTSQDKDAGRRKVKVRDRQDGQRDNQRQGDSRQAES--RDGGQDNRRG
NRGRNDDRN---QRRNERNDGQKDRRQRDRDSSKGDSQRDQRGRNESAKADSGSQEKSEF
NRPRRDRSSG-KPVPRPQRQDRPERQDKPEDQEKAVEEVAERRALTAAAASAAEEPAKSE
IAKEVWNKSVEAIA--ESE----------STDNTRQAPPKA-------------------
EEKGVEPAQQTAKQP--------------------HQPSEQ----SKAP---QERASEQS
AKQSDADSRQRKQDDAEANQQNAGEDGQEKSARRARADN----D--PRNKARRPKREAAE
AKSEEAPKESQLERSVAQA----KANA------------PAMGNTSVESKNKED------
----------KK------------EGRAAKASAIEQPKKEATPEAKD------KPDTAPA
TDKGAT--KAAPEPTV---------------------------EKKPSDKPAATAAQEEE
EPKRAFNDPREVRKRIQAQKVQAGNDASSALAPQQIAAPKPPEAATIEPKMEAKEPEPKK
APAAEKPR----EEVEPPKSAPSAPE--ATVADVKAEDKPSS------------------
--QDSKASQ-----A----
>gi|90021266|ref|YP_527093.1|	   968 residues, 50 /line  DNA polymerase III delta prime subunit [Saccharophagus degradans 2-40]
------------------------------------------------------------
------------------------------------------------------------
-----------------------MKRMLINATQP--------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------------EELRV----------------------------
------------------------------ALVD----GQWLYDL---------------
------------------------------------------------------------
--------------------------DIENRLREQKKA----------------------
------------------------------------------------------------
-------------NIYKGRITRVEPSL---------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------EAAFVDYGSERHG--------FLPL
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-KEISREYFAKQPKDIDGRIRIQDVVKEGMEVIVQVDKEERGNKGAALTTFISLAGRYLV
LMPNNPRAGGISRRIDGDDRTELKDALSQIDVPAGMGIIVRTAGVGRRAEELQWDMNYLA
QLWASIKTAAEEKTAPEFLFQESNVIIRAIRDYLRPDIGEVIVDNQDAYNLATAFVEQVM
PNYRSKVKLYEEPLPLFNRFQIESQIETAFEREVKLPSGGSIVIDVTEALISIDINSSRA
TKGGDIEETALQTNLEAADEIARQLRLRDMGGLVVIDFIDMQPVRNQREVENRMRDALEM
DRARVQVGRISRFGLLEMSRQRLRPSLGETTSKVCPRCSGQGTIRGTKSIALSILRLVEE
EAQKERSAEIRAVVPVAVATYLLNEKRKVISGIEERQKTRIVIIPSEKMTTPHFDVQRLR
DDDV--VSSEISYKIEV--P-QGEDE---EK-IQDDAAALAKLPRPAVQAI-----PP-A
QPAPEAP------------------------KPDSLLTKILKKL-KELFKTDDKKRK---
-------NTSKNSRGQQRRRGN----------NSQNNRNRNRNRNG------RGNDNRNK
NRDDEITDNLSSRTKSDQSQQGQGPSSDDNRPDRGNRKRGNRRRNNNRRNDQDRNDSPES
NNDEQQNNNQPQEQNNAPKEQGPNRRPNGR------------------------------
----------------RGRGG-RERKREP-VPQAAEESVTK-------------------
DDSALAAEVTSAIDT--------------------AEKAFATNSPAELK---QAKS----
--------EAKEQAKSEAKEQAKSEAKEQAKQERA------------------PQEAAIT
AETPSEAKQPEATATAAEA----KPEP------------SEKAKASQAPQAAEASDTTET
VAET------KV------------EAPSAEAAPAKEAPVE------------------TA
AETASE--AETAEPVA-------AAETAEV---AEVAVAEATEEASEAKEELAPAQAVRK
QYSRATNDPRATPKPV---------------------------ANTLVSNVVTQIRMSRP
LDTTQPANI--LRNPRDLSRPANDPRLKRN------------------------------
--IEEVASD-----A----
>gi|94416761|ref|ZP_01296585.1|	   1055 residues, 50 /line  hypothetical protein PaerP_01001599 [Pseudomonas aeruginosa PA7]
------------------------------------------------------------
------------------------------------------------------------
--------------------------MLINATQP--------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------------EELRV----------------------------
------------------------------ALVD----GQRLFDL---------------
------------------------------------------------------------
--------------------------DIESGAREQKKA----------------------
------------------------------------------------------------
-------------NIYKGRITRVEPSL---------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------EAAFVDFGAERHG--------FLPL
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-KEISREYFKKS-P--EGRINIKEVLSEGQEVIVQVEKEERGNKGAALTTFISLAGRYLV
LMPNNPRAGGISRRIEGEERNELREALNGLNAPADMGLIVRTAGLGRSTEELQWDLDYLL
QLWSAIKEASGERGAPFLIYQESNVIIRAIRDYLRQDIGEVLIDSIDAQEEALNFIRQVM
PQYASKVKLYQDSVPLFNRFQIESQIETAFQREVKLPSGGSIVIDPTEALVSIDINSARA
TKGGDIEETALQTNLEAAEEIARQLRLRDIGGLIVIDFIDMTPAKNQRAVEERVREALEA
DRARVQVGRISRFGLLEMSRQRLRPSLGETSGIVCPRCNGQGIIRDVESLSLAILRLIEE
EALKDRTAEVRARVPFQVAAFLLNEKRNAITKIELRTRARIFILPDDHLETPHFEVQRLR
DDSPELVAGQTSYEMATVE-----HEDAQPV----SSTRTLVRQEAAVKTV------APQ
QPAPQA----------QEPVEAP-KPMP----EPSLFQGLVKSL-VGLFAGKEQPAAKPA
------ESAKPAAER-------QSRQDE---RRNGRQQNR------RRDGRDG------N
RRDEERKPREER-------------------AERQPREERADRPNREERNE----RRREE
RAERPNREERQPREAREERTERPAR------EERQPREGREERSE-------RRREERAE
RP-------AREERQPREGREERAERP-----------VRE-------------------
ERQPREERQARDAA---ALEAEAL-----------PNEEALEQD---------DQDDTDG
ERPRRR--SRGQRRRSNRRERQREVS---GEQEGSEAAENGAAPLNTVAAAAAA-GIAVA
SEAQESS-----AEQAPLA-----SEIAPESASETAPTGEASESS-------ESAEASAS
EAAATDTPV---------------------VVSLIENEADQSTLL-VAQS---AEEALSI
SESVEARSVIESVPAADTTEETAAPAA-PATVEAAPSEPAVTEEPTPAPA-----ATPAN
ATGRALNDPREKRRLQREAERLAREAAAAAEAATQAIPA--AIEESPVA-------ASEA
PTVQEEPTVAQVKEEAVQA-EAPAQEQA-QEAVQASPEASNETETETETETETAEEEHAK
KPEESETSRPH-A------
>gi|114773717|ref|ZP_01450745.1|	   968 residues, 50 /line  ribonuclease E [alpha proteobacterium HTCC2255]
------------------------------------------------------------
------------------------------------------------------------
-----------------------MKRMLINATQS--------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------------EELRV----------------------------
------------------------------ALVD----GQKLYDL---------------
------------------------------------------------------------
--------------------------DIESPGHEQKKA----------------------
------------------------------------------------------------
-------------NIYKGTITRVEPSL---------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------EAAFVDYGADRHG--------FLPL
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-KEIARHYFPKN-YTFEGRPNIRDAVKEGQEVIIQIDKEERGQKGAALTTFISLAGSYLV
LMPNNPRAGGISRRIEGDERSELKATLDQLELPKGMGLIVRTAGVGKSFEELAWDLKVLL
THWEAITAVAEERPAPFLIHQESNVIVRAIRDYLRRDVGEIIIDKPAIFEQALQHIELVR
PDFANRVKPYTGDVPLFSHYQIESQIESAFQREVRLPSGGSIVIDPTEALTSIDINSARA
TKGGDIEETAFNTNLEAADEIARQLRLRDLGGLVVIDYIDMSVNKHQREVENRMKDAVSG
DRARIQLGRISRFGLLEMSRQRLRPSLGESAHNVCPRCAGTGTVRGTESLALSVLRIIEE
ECIKDNTGQVEAQLPVDVATYILNEKRKALREMEERNKVEVLVLPNPNLSTPNFQIERRR
PEDK---VSGISYQLELAE----SNEQI----QEAASAVPVQREEPALKGMI--------
--APKAAPSP---KP-------A-EAKA----TPSLIAGFIAWL-TALFAPKPAPKAKGK
GRGRNNN--------------------Q---RRQGQNRNR------NRNQRNRNQGDKND
ARDNNVNAKDNR----------------------------------------------EL
HDSNDAKEGKSNPRRNT-RNRKRHD--NDEGDNG-QQKRRQPRAT-------ETSD----
------VNDAPAPKERRKRRDNRKNVR-----------VTN-------------------
EASTAEEVNTIASTSEP-VQSEVIT----------TGDESVNTNVEAN----DTVPTDKK
TRSRRS--PRHARAAGQKRKQEEQA-----------ETENV---SQTVEGQTALPLEEPT
GA----------QIQAIVE-ENQQIALSADHGEDTTTESTSLSNEELEVKRNNSLIE---
---SDNAVE---------------------SSNDVIQATSEAIDK--AKE---DLDSVS-
-------EVVD-TPIQALLDISEETEVTSTEASTAIVSEAVTP------------VD-TI
SAPEEITAPTSVPA----------------------------------------------
------VLAPKAHASHPMALPAVLAQEF-GEI-VVKQKDNSERYEYV-KTEKRADMQSVT
SRVSAPTTLPLS-VD----
>gi|149192305|ref|ZP_01870514.1|	   1014 residues, 50 /line  ribonuclease E [Vibrio shilonii AK1]
---------------------------------------------------------MGS
GTT---------------------------------------------------------
--TYENCDKSNDENKENTTRISVMKRMLINATQK--------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------------EELRV----------------------------
------------------------------ALVD----GQRLFDL---------------
------------------------------------------------------------
--------------------------DIESPGHESKKA----------------------
------------------------------------------------------------
-------------NIYKGRITRVEPSL---------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------EAAFVDYGAERHG--------FLPL
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-KEIAREYFPEG-YTYQGRPSIKDVLSEGQEVIVQVEKEERGSKGAALTTFISLAGSYLV
LMPNNPRAGGISRRIEGEERTELKAALSTLELPQGMGLIVRTAGVGKSAEELEWDLRFLL
NNWENIKGAADQNPAPFLIHQESNVIVRALRDYLRRDIGEILIDSNTIYERARQHIQLVR
PDFVNRVKKYEGEVPLFSHYQIESQIESAFQREVRLPSGGSIVIDPTEALTSIDINSARA
TKGSDIEETALNTNLEAADEIARQLRLRDLGGLVVIDFIDMTPVRHQREVENRLREAVRI
DRARVQIGRISRFGLLEMSRQRLSPSLAEASHHICPRCTGTGVVRDNESLALSVLRLIEE
EALKDNTSQALAIVPVPIASYLLNEKRRSINHIERVQEVKITIVPDSDMETPHFEVIRVR
EGEE---QDLLSYLLPKKLEALKEAEAK----EAEVEAKPRKIEQPALQGF-----ATPT
QNAPTPAPKP---SKPA-KVEVK-KEEK----QPGLISRILSAI-GSLFSSNEEPKKEPE
KKEEAPK------NR-------NGR--Q---RRNRNNDQR------RRNSKDSR----DN
DR----------------------------NKNRRNKPARDEEKES-------------K
DNAQESRKQQNRRGKQQDRRNKKRD--EESGKSKVEEQGQQIAAD-------VQAEKKAP
----RSEEKAAKVKERRQRRKLSKQVR-----------VKD-------------------
QKAQQEEQAAQVTSVET---------------AQTAVEKPQAPEAATEA---PVKEEGKQ
RRNRRS--PRHLRASGQRRRRGR-D-----------RRPNP---FRLRKGGVASPEMAMG
KVMPSYGIVKPKAKAKPE--------AEVKELV-----------TTTGVAMPEMAMGKVI
VMRKPEAIE---------------------APVVTEPKVEQTV------------VEAVV
EPV----QVVA-EPVAEVATAIVEPAT-EAVVETEPMVEISVA------------ENAVV
EEQPTIVEPTPVTPVV--------------------------------------------
-EKA--VVSFKGHASAPMA-KAEGKQEL-GEIIINAAPVKAERYQQ-----KGAGSQVAT
NSASAVMTKPN-Y------
>gi|28898836|ref|NP_798441.1|	   1023 residues, 50 /line  ribonuclease E [Vibrio parahaemolyticus RIMD 2210633]
------------------------------------------------------------
------------------------------------------------------------
-----------------------MKRMLINATQK--------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------------EELRV----------------------------
------------------------------ALVD----GQRLFDL---------------
------------------------------------------------------------
--------------------------DIESPGHESKKA----------------------
------------------------------------------------------------
-------------NIYKGRITRIEPSL---------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------EAAFVDYGAERHG--------FLPL
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-KEIAREYFPEG-YTYQGRPSIKEVLTEGQEVIVQVEKEERGSKGAALTTFISLAGSYLV
LMPNNPRAGGISRRIEGDERTQLKAALSTLELPQGMGLIVRTAGVGKSAEELEWDLNVLL
NHWSAIKGAADSNPAPFLIHQESNVIVRAIRDYLRRDIGEILIDSNTIYERAKEHIQLVR
PDFINRVKKYEGEVPLFSHYQIESQIESAFQREVRLPSGGSIVIDPTEALTSIDINSARA
TKGGDIEETALNTNLEAADEIARQLRLRDLGGLVVIDFIDMTPVRHQREVENRLREAVRL
DRARVQIGRISRFGLLEMSRQRLSPSLAEASHHICPRCSGTGVVRDNESLALSVLRLIEE
EALKDNTAQVLAVVPVPIASYLLNEKRRSVNHIERIQEVKITVVPNSDMETPHFEVIRVR
EGEE---FDLISYLLPKKLEAMKEAEGK---EPSETDIKPKRIEEPVLKGF-----AAPA
QTAPAPVSKP---APVA-KKKEV-EQEA----KPGLFSRLFKAL-GSFLFGGSEEVKEEP
KQEEKKSN------R-------DNK--R---NKRDRNDRR------RSNQRDN-------
---------------------------------REGRENRDNRRRRKPREEQANEQNEAQ
QPANKQQPNRSQKRKPKPQQAEKAQ--EPKANAKVAEKGLQLAAE-------ARSEVKPE
ENKAKANAKTEKVKERRQRRKLNKSVR-----------VKD-------------------
QLADEQVEETAVKAIEPV---------------ESQVDQAVDTAADAQQD--NKQGESKQ
RRNRRS--PRHLRASGQRRRRGR-D-----------RRPNP---FRLRKGGVASPEMAMG
KVMPRYIPKPAPKKEERV----------QEETVVAIATVPAM---QGGFACPEMAMGKVI
IRREQPAVA---------------------EAPVVEPKVQETVEAK-AES---PIVEAVA
PE--------K-AEPVAVDQAPVEP---IVEVAEAPVA---------------------E
ATTETVVEEAPVQEPVVAETVEEAA-----------TEV--AVETPVAA-------PEMK
AEVI--NVVAKPRASAPMT-KAPGPQEL-REIEVAAAPFKAERYQA-----KGAGSQVAT
NRASAAMTKPNFN------
>gi|84394339|ref|ZP_00993061.1|	   1061 residues, 50 /line  ribonuclease E [Vibrio splendidus 12B01]
------------------------------------------------------------
------------------------------------------------------------
-----------------------MKRMLINATQK--------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------------EELRV----------------------------
------------------------------ALVD----GQRLFDL---------------
------------------------------------------------------------
--------------------------DIESPGHESKKA----------------------
------------------------------------------------------------
-------------NIYKGRITRIEPSL---------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------EAAFVDYGAERHG--------FLPL
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-KEIAREYFPEG-YTYQGRPSIKEVLREGQEVIVQVEKEERGSKGAALTTFISLAGSYLV
LMPNNPRAGGISRRIEGDERTQLKAALSTLELPQGMGLIVRTAGVGKSAEELEWDLNVLL
NHWGAIKQASDSNAAPFLIHQESNVIVRAIRDYLRRDIGEILIDSNTIFERAQAHIQLIR
PDFMNRVKKYDGEVPLFSHYQIESQIESAFQREVRLPSGGSIVIDPTEALTSIDINSARA
TKGSDIEETALNTNLEAADEIARQLRLRDLGGLVVIDFIDMTPVRHQREVESRLRDAVRL
DRARVQIGRISRFGLLEMSRQRLSPSLAEASHHICPRCTGTGVVRDNESLALSVLRLIEE
EALKDNTAQVLAVVPVPIASYLLNEKRRSVNHIEKNQEVKITVVPNSDMETPHFEVIRVR
EGEE---FDLLSYLLPTKLEALKEAESK---EPVEQTIRPKKIEEPALKGF-----AAPA
QSAPTPAPAP---KAVEEKKVEP-AATQ----EPSLIGRFFKAI-GSFLFGSSTQE---E
KKEEEKQEEKPKNNR-------NNGN-R---QRRDRNDNR------RRNQRGDR----GE
QRNERGDRSEQR-----------NERGDNRNENRDNKRRRKPVRDEKTEE-QKEAAPQQ-
--TRQPRKPKQDRRNKPRDE-QKQQ--EEQVPSKLAEEGLQLAAE-------AQADKPEA
P-KAKPEAKAVKIKERRQRRKLNKLVR-----------VKD-------------------
QQAQAEADNNADNASK-EQKAQTANHEQAVAQEQKVVEQVGATQVNAEQ---TEQEEPKQ
RRNRRS--PRHLRASGQRRRRGR-D-----------RRPNP---FRLRKGGVASPEMAMG
KVMPRFIPKPHHNQTKPE-------------VAEMDVAVEAQVATETQVAVPAK-----E
NAPQSNVVM---------------------AG-GFACPELAMGKV--IIS---REDAVVA
EETRSEAQV-T-EAPVVVEEAPVVV---ETEKVEAPV---IV-------------EATKV
EAAVAVEETTPVVE----------------AEAPKAESA--KVEEAPVV-------KAEA
PQVAPKATVAKKQAGSPMT-KAPGPQEI-KEIEVVAAPFRAER--FV-P--KGAGSQAAS
NQAGAGMTKPN-Y------
>gi|126511000|gb|EAZ73594.1|	   963 residues, 50 /line  ribonuclease E [Vibrio cholerae NCTC 8457]
------------------------------------------------------------
------------------------------------------------------------
-----------------------MKRMLINATQK--------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------------EELRV----------------------------
------------------------------ALVD----GQRLFDL---------------
------------------------------------------------------------
--------------------------DIESPGHESKKA----------------------
------------------------------------------------------------
-------------NIYKGRITRIEPSL---------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------EAAFVDYGAERHG--------FLPL
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-KEIAREYFPDG-YSYQGRPNIKDVLNEGQEVIVQIEKEERGSKGAALTTFISLAGSYLV
LMPNNPRAGGISRRIEGDERTELKSALSSLELPQGMGLIVRTAGVGKSAEELEWDLNVLL
KHWSAIKQASDSNPAPFLIHQESNVIVRAIRDYLRRDIGEILIDSNSIYERALEHIRLVR
PDFVNRVKKYEGEVPLFSHFQIESQIESAFQREVRLPSGGSIVIDPTEALTSIDINSARA
TKGGDIEETALNTNLEAADEIARQLRLRDLGGLVVIDFIDMTPVRHQREVENRLREAVRV
DRARVQIGRISRFGLLEMSRQRLSPSLAEASHHICPRCKGTGVIRDNESLALSVLRLIEE
EALKDNTSQVLAVVPVSIASYLLNEKRRSINHIEKAQQVRITIVPNSDMETPHFEVIRVR
EGEE---QDVLSYLIPKKLEAMKEAEGK---EVVDVELKPKRIEEPVLKGF-----AAPA
EAVPAPTPKP---KAEPQPVAEV-QQPA----QPGFFSRVFKAI-ASLFSATPEAAKVEA
PVTQNSEQDKPRRER-------NDR-----------NNDR------RRNPRDKN------
-----------------------RRRGNEENNERNDKETSNSNRKPQERKPKQERGERN-
--ERNDRNERPETERPERQDRRNKR--DESKTAKLLEQGRQLAAE-------AQQEVKAV
--EP-KEEKAAVVKERRQRRKLSKQIR-----------VKD-------------------
QLAAEELDNLSTAPVDNAFDAP------APVNL--PVTDDFADSAQED----NEQDDQKQ
RRNRRS--PRHLRASGQRRRRGR-D-----------RRPNP---FRLRKGGVASPEMAMG
KVMPRYDLAPRP--------QSRHETAEGA----------QHVTHVTP-----TAATAVV
ESEKVAAPR---------------------VLGGVAFPEMAMGKV--IVR---RETAAVQ
PEPVVQEPVIT-DVIAETLIAPVEP---V-------------------------------
---------------------------------------------VVEA-------TVIE
APVIEE--SATETAALETV-VAKVAE------------VEDERENY--------------
-----KLIQKR---K----
>gi|90407029|ref|ZP_01215219.1|	   984 residues, 50 /line  ribonuclease E [Psychromonas sp. CNPT3]
------------------------------------------------------------
------------------------------------------------------------
-----------------------MKRMLINATQS--------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------------EELRV----------------------------
------------------------------ALVD----GQQLYDL---------------
------------------------------------------------------------
--------------------------DIESPGHEQKKA----------------------
------------------------------------------------------------
-------------NIYKGKITRVEPSL---------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------EAAFVDYGADRHG--------FLPL
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-KEISRNYFPNG-YSFKGRPNIKEVIKEGQEVIIQIEKEERGNKGAALTTFISLAGSYLV
LMPNNPRAGGISRRIEGDERTQLKEALSHLKLPNGMGLIVRTAGVGKTAEELEWDLNVLV
NHWHAIDEASKSKSAPFLIHRESNVIVRSIRDYLRRDIGEIVIDHAKTFEQAKKHIEMVR
PDYIDRLKLYQGEIPLFTYYQVESQIESAFQREVRLPSGGSIVIDPTEALTSIDINSARA
TRGGDIEETAFNTNLEAAEEIARQLRLRDLGGLVVIDFIDMTPARHQREVENRMRESVRQ
DRARIQLGRISRFGLMEMSRQRIRPSLGESASRVCPRCHGQGTIRDNESLALAILRLIEE
EGLKENTVQIQATVPVAVAAYLLNEKRSSIFKIEQRHNCEIFIIPDANLLTPHFEIKRTR
NDNQ---TEINYDALQKQHQVYVPN------VVKNE---QQKEDEPILSGF-----SRPK
NS-PKQKHKN---STEKAVQSTQ-STEK----PTSLLSKIFASI-GALFSASPE-TAEP-
KV-----EEKPRPRN-------NNNR----------NRNR------NRN-----------
-----------------------TRTRNKNDN------------------ERSNDDVQK-
--PSEENNSRR--------VQKPRD--NDR----IKKAPRKPQAP-------IEAI----
-------EQDGVVAVRRKRRNLRKKVR-----------IQQ-------------------
EPVITPEVENVA----VIIETEASQQTATE-------NVTIESSVNTAPDL---TEQNGV
KMPNRR--SRYLRNNGQRKKRSISE-----------AIPGN---ISDESALTTDP---VS
SRYPDNQTEAALNVAAPVA----TDISTLDDHVTMAQDVEEMRNDETPTQAPQILPD-VN
VTPEVVAVP---------------------EAVVAAPEVVVAPEVVA------APEVVAA
PEVVATPEVV--AAPAVVATPEVVA---TPEVVAAP---------------------EVV
AASEVVATPEVVATPEVVA-----------------TPE--VVAAPEVA-------VITK
KRIGTT-SSAKKSVTAQMK-KTVSSELD-LS-APLKIEAATTRISIA-KSTQQAGSQFAS
AKASSVTVKAV-L------
>gi|27366289|ref|NP_761817.1|	   1033 residues, 50 /line  Ribonuclease E [Vibrio vulnificus CMCP6]
------------------------------------------------------------
------------------------------------------------------------
--------------------------MLINATQK--------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------------EELRV----------------------------
------------------------------ALVD----GQRLYDL---------------
------------------------------------------------------------
--------------------------DIESPGHESKKA----------------------
------------------------------------------------------------
-------------NIYKGRITRVEPSL---------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------EAAFVDYGAERHG--------FLPL
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-KEIAKEYFPDG-YSYQGRPSIKEVLTEGQEVIVQIEKEERGSKGAALTTFISLAGSYLV
LMPNNPRAGGISRRIEGDERTELKSALSTLELPQGMGLIVRTAGVGKSAEELEWDLNVLL
KHWAAIKDASESNPAPFLIHQESNVIVRAIRDYLRRDIGEILIDSNTIYERAKEHIQLVR
PDFVNRVKKYDGEVPLFSHYQIESQIESAFQREVRLPSGGSIVIDPTEALTSIDINSARA
TKGGDIEETALNTNLEAADEIARQLRLRDLGGLVVIDFIDMTPVRHQREVENRLREAVRL
DRARVQIGRISRFGLLEMSRQRLSPSLAEASHHICPRCSGTGVVRDNESLALSVLRLIEE
EALKDNTAQVLAVVPVPIASYLLNEKRRSVNHIERIQEVKITVVPNSDMETPHFEVIRVR
EGEE---VDLLSYLLPKKLEAMKEAEGK---ESPETEYKPKKIEEPVLKGF-----ASPA
QSVPAPAPKA---AVAKVANEKP-QAEE----KPGLFGRLIKAL-GSFLFGSAEEKVEAE
KT-----ERKDEREK-------GNRR-----------QKR------DRN-----------
-----------------------DRRRNNRDNNRENNRDRDGKRRQRNRDENVVETQDE-
--AIKPRSQQKRKQRPAQNKADNAV--ESKANAKVAEKGLQLAAE-------AQGASKQE
G-QK-TPSKAEKVKERRQRRKLNKPVR-----------VKD-------------------
QLEQAEETLMDAAP---VVEAETFNKQNTPASE--KAEKVVADTVDAMDNS---ENEEKP
RRNRRS--PRHLRASGQRRRRGR-D-----------RRPNP---FRLRKGGVASPEMAMG
KVMPRYIPKPVA----------KKEEMVKEEVVTAVTAVPAM---QGGVACPEMAMGKVI
IRRDITAAQ---------------------TPTETKPKRSKSRNNKPAKA---AVVEVVT
EEPTVENAVV--ATIQETDVQKIEP---QVESVSQPVEQV------------------SV
ETTEVVAEIVETTEVVAEVESATETVANETEATVAVV-----------------------
-ESSIK--VIKAQASAPMT-KAPGPQEL-IEIQVVAAPFKAER---Y-AQR-GAGSQVAT
SQASAAMTKPEMV------
>gi|75428521|ref|ZP_00731723.1|	   962 residues, 50 /line  ribonucleases G and E [Actinobacillus succinogenes 130Z]
------------------------------------------------------------
------------------------------------------------------------
-----------------------MKRMLINATQK--------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------------EELRV----------------------------
------------------------------ALVD----GQHLFDL---------------
------------------------------------------------------------
--------------------------DIESPGHEQKKA----------------------
------------------------------------------------------------
-------------NIYKGRITRVEPSL---------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------EAAFVDYGAERHG--------FLPL
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-KEIAREYFPAD-YVYNGRPNIKDVIKEGQEVIVQVNKEERGNKGAALTTFVSLAGSYLV
IMPNNPRAGGISRRIEGDERIELKEALSSLDVPEGVGLIVRTAGVGKSSEELQWDLKVLL
HHWEAIKQVSENRPAPFLIHQESDVIVRAIRDYLRRDIGEILVDSPKIYEKAKAHIKLVR
PDFINRIKLYQGEVPLFSHYQIESQIESAFQREVRLPSGGSIVIDATEALIAIDINSARS
TRGGDIEETALNTNLEAADEIARQLRLRDLGGLVVIDFIDMTPVRHQREVENRMREAVRQ
DRARIQISRISRFGLLEMSRQRLSPSLGESSSHICPRCQGTGKVRDNESLSLSILRLIEE
EALKENSKQVQCIVPVQIASYLLNEKRKAIRSIEKRHNVDIVVAPNEAMETPHFSVFRLR
DGEE---ANVLSYHLPKLHEVQEDV------FVAEESLISRNIETAAVTAENMAESAVLS
MTIPEAAPVI---E--------A-KKEA----ESSLFARIVAAI-KKLFTTAPEA----E
KV-----EEQPVVTR-------NNRN-----------NRR------ERN-----------
-----------------------NERNNERRNSRRSRAERNTARNNDTAA------EKP-
--ETPSRNERSNERNNRRNARRAAL--TDE----TSANAGTAEAV-------ETSE----
---E-KSPAPRQPRERRERRDLRKKVR-----------VSN-------------------
ETVEQQAVEEVS-----AVAEETVTE------------------QPSSESP---RRERSE
RNSRRM--PRHLRTNNSRRRRNE------------------VSSMPL-FAAVASPELASG
KVWIDSNTTSQK--------TKESNFLSVDELLEQQTQND-----EVEVSTP--ASS-IV
EKAENNAQP---------------------L-GLVSQPANEAVEKK-VQE---SLERLNE
EQRVLEQ-----QAK---------A---SSVAEAAVEKENVI------------------
--------------------------PEKKVNEPEISVK--NGQKFDRT-------YRFN
GRLGTI--SAVRHTKADMT-LAKADNEV-NV-PFDIVEWKDSRYYFH-GKG-SAGHHSAI
SHVFSEPTKAEAK------
>gi|52425677|ref|YP_088814.1|	   960 residues, 50 /line  CafA protein [Mannheimia succiniciproducens MBEL55E]
------------------------------------------------------------
------------------------------------------------------------
-----------------------MKRMLINATQQ--------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------------EELRV----------------------------
------------------------------ALVD----GQRLFDL---------------
------------------------------------------------------------
--------------------------DIESPGHEQKKA----------------------
------------------------------------------------------------
-------------NIYKGKITRVEPSL---------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------EAAFVDYGAERHG--------FLPL
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-KEIAREYFPDD-YVYQGRPNIKDIIKEGQEVIVQVNKEERGNKGAALTTFVSLAGSYLV
IMPNNPRAGGISRRIEGDERLELKDALSSLDVPEGVGLIVRTAGVGKSSEELQWDLKVLL
HHWEAIKQASQSRPAPFLIHQESDVIVRAIRDYLRRDIGEILIDSPKVYEKAKAHIKLVR
PDFISRIKLYQGEVPLFSHYQIESQIESAFQREVRLPSGGSIVIDVTEALTAIDINSARS
TRGGDIEETALNTNLEAADEIARQLRLRDLGGLIVIDFIDMTPVRHQREVENRMREAVRQ
DRARIQISRISRFGLLEMSRQRISPSLGESSHHICPRCQGTGKVRDNESLSLSILRLLEE
EALKENTKQVHTVVPVNIASYLLNEKRKAIHDIEKRHNVEILVVPNKEMETPHFSVFRVR
DGEE---INTLSYNLVKVYEEQETT------FIADEPFTTRVTETAAVTTENVLESAALS
MTISEPAPTI---E--------V-KKEE----QPSLFVRIVAAI-KGLFASEPKV----E
--------EKVEEAP-------QPNT---------------------RN-----------
-----------------------RRNNQEHRNSRRNRNERNNRGNNEEPADKVQSEKSA-
--EKAERPARSERTRRNNRNRNAAA--DDS----LNNESVIEAVT-------NETT----
------DDEAKAPQQRRQRRDLRKRVR-----------VTE-------------------
EQVTVAAE---------PVDKPSLAES-VP------VEPVVEEN--------VYQERDRQ
DNRRRL--PRHLRVNNQRRRRNA-E-----------Q----VSAMPL-FAAVASPELASG
KVWIESPTAPA--KP------KESAFLSVDELLEQQSEVK-----QPGVTTPAPATQVIF
DKADNDIAP---------------------LASFVTQPANESVQKK-VQE---SLDRLEQ
TNG-QQT-----EVK---------E---DDNASNMTLSDVTA-------------TESAV
E---------------------------------KTEVL--N----LSN-------YRFS
GRLGTI--SAVKHTKAEMT-LAKAADEV-LP-PFEIVQWQDSRYYFH-GKG-SAGHNSAV
SHVFTAATQAKAE------
>gi|68249015|ref|YP_248127.1|	   951 residues, 50 /line  ribonuclease E [Haemophilus influenzae 86-028NP]
------------------------------------------------------------
------------------------------------------------------------
-------MRFILRFFKYLIRELTMKRMLINATQK--------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------------EELRV----------------------------
------------------------------ALVD----GQRLFDL---------------
------------------------------------------------------------
--------------------------DIESPGHEQKKA----------------------
------------------------------------------------------------
-------------NIYKGKITRVEPSL---------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------EAAFVDYGAERHG--------FLPL
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-KEIAREYFPDD-YVFQGRPNIRDILTEGQEVIVQVNKEERGNKGAALTTFVSLAGSYLV
LMPNNPRAGGISRRIEGDERTELKEALSSLDVPEGVGLIVRTAGVGKSPEELQWDLKVLL
HHWEAIKQASQSRPAPFLIHQESDVIVRAIRDYLRRDIGEILIDSPKIFEKAKEHIKLVR
PDFINRVKLYQGEVPLFSHYQIESQIESAFQREVRLPSGGSIVIDVTEALTAIDINSARS
TRGGDIEETALNTNLEAADEIARQLRLRDLGGLVVIDFIDMTPIRHQREVENRIRDAVRP
DRARIQISRISRFGLLEMSRQRLSPSLGESSHHICPRCQGTGKVRDNESLSLSILRLLEE
EALKENTKQVHTIVPVQIASYLLNEKRKAISNIEKRHNVDIIVAPNEAMETPHFSVFRLR
DGEE---VNELSYNLAKIHCAQDEN--------TEESLLSRNVETTAVIEQPAVESAVVA
LSISEAAPTP---V--------E-RKSN----EPSLLAKIIAKI-KGLFATKSE-----E
--------NKPKNNR-------TSRN-------------P------NRN-----------
-----------------------QRRSQDRRSSRRPRSENNE--------TERTEEQVR-
--NVRE---RNQRR-----PRRNLV--EES----IAESAVNSTPV-------FEAK----
------EERTEPVTQRRQRRDLRKRVR-----------VED-------------------
NETVVENNFSTTE---KMPEVDVI-------------TVQNNDEKPVHQNQR----SERQ
ERQRRT--PRHLRAANNQRRRRN-Q-----------EP---KSPMPL-FAAVVSPELASG
KAWIDYSTVNLP---------KENHFLSVDELLEQEKTKK-----GF--ITP--AMGIVV
EEKSPDVKP---------------------ALDFITQPANESVQKK-VQE---SLDRLS-
------------SYKPQEVVESI-----------------DP-------------AINVD
EP---------------------------------ETLE--KVSKFVRT-------YEFN
GRLGTI--SSVPHTKAEMT-LAKANDEM-PE-AFPIRAWQDSRYYFY-GKG-AAGHHCAI
SHVYSEPTRAKSE------
>gi|113460860|ref|YP_718927.1|	   942 residues, 50 /line  ribonuclease E [Haemophilus somnus 129PT]
------------------------------------------------------------
------------------------------------------------------------
-----------------------MKRMLINATQK--------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------------EELRV----------------------------
------------------------------ALVD----GQRLFDL---------------
------------------------------------------------------------
--------------------------DIENPGHEQKKA----------------------
------------------------------------------------------------
-------------NIYKGRITRVEPSL---------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------EAAFVDYGVERHG--------FLPL
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-KEIAREYFPDD-YVYQGRPNIRDILSEGQEVIVQVNKEERGNKGAALTTFVSLAGSYLV
IMPNNPRAGGISRRIEGDERLELKEALSSLDVPEGVGLIVRTAGVGKSPEELQWDLKVLL
HHWEAIKQASQSRPAPFLIHQESDVIVRAIRDYLRRDIGEILIDSPKVYEKAKAHIKLVR
PDFINRVKLYQGEVPLFSHYQIESQIESAFQREVRLPSGGSIVIDATEALTAIDINSARS
TRGGDIEETALNTNLEAADEIARQLRLRDLGGLIVIDFIDMTPVRHQREVENRMREAVRQ
DRARIQISRISRFGLLEMSRQRLSPSLGESSHHVCPRCQGTGKIRDNESLSLSILRLLEE
EALKENTKQVHTIVPVQIASYLLNEKRKAIHSIEKRHNVDIVVAPNEAMETPHFSVFRVR
EGEE---INELSYNLAKLHEMNDET------YVVEDAFISRHLENSAATVESAVENAAVS
LAIETPAPMP---Q--------E-RKQE----RESLLRRIIEGI-KNLFADNSSK----N
--------KKNKNTR-------QNKN--------------------ARH-----------
-----------------------NRRNQDRRSSRRIRQE---HEIKSDENNKL----DT-
--QHSH---YTERYS--KHAKKGVD--DPQ----IQTKKAGELEI-------HTKD----
------DETIETIQPRRQRRDLRKKVR-----------VEE-------------------
NLVDTPNLGSTEEHV----ENEKTTEPVTS------LEQAVLQT----ENEKTHERQDNN
YRHRRL--PRHLRVNNQRRRRNV-E-----------L----KSAMPL-FAAVASPELASG
KVWVDVNVVNS----------KNNNFLSVDELLKQQYQQE-----EIEVVIP--ASEILM
DTQSDDIKP---------------------LSNFVSQPANEAVEKK-VQE---TLQRLTQ
E-----------------------------------VVDESS-------------TIERT
EV---------------------------------DTNI--SVPEFVRE-------YQFN
GRLGTI--SAVMHTKAEMT-LAKSSDEP-MQ-PFSIVEWQDSRYYFY-GRG-AAGHHCAI
SHVYSEPANTKIE------
>gi|15602856|ref|NP_245928.1|	   1004 residues, 50 /line  Rne [Pasteurella multocida subsp. multocida str. Pm70]
------------------------------------------------------------
------------------------------------------------------------
-----------------------MKRMLINATQK--------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------------EELRV----------------------------
------------------------------ALVD----GQRLFDL---------------
------------------------------------------------------------
--------------------------DIESPGHEQKKA----------------------
------------------------------------------------------------
-------------NIYKGRITRVEPSL---------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------EAAFVDYGAERHG--------FLPL
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-KEIAREYFPDD-YVYQGRPNIRDILSEGQEVIVQVNKEERGNKGAALTTFVSLAGSYLV
IMPNNPRAGGISRRIEGDERLELKDALSSLEVPDGVGLIVRTAGVGKSPEELQWDLKVLL
HHWEAIKQASQSRPAPFLIHQESDVIVRAIRDYLRRDIGEILIDSPKVYEKAKAHIKLVR
PDFIHRVKLYQGEVPLFSHYQIESQIESAFQREVRLPSGGSIVIDVTEALTAIDINSSRS
TRGGDIEETALNTNLEAADEIARQLRLRDLGGLIVIDFIDMTPVRHQREVENRIRDAVRQ
DRARIQISRISRFGLLEMSRQRLSPSLGESSHHVCPRCQGTGKIRDNESLSLSILRLIEE
EALKENTKQVHTLVPVEIASYLLNEKRRAIHSIEKRHDVDVIVVPNEGMETPHFGVFRVR
EGEE---VHELSYNLVKLHQEKDEH------FVPEESLVSRNIETAALTSENVLESAAVS
MAIPAPAPVP---E--------K-KVEN----KPSLLTRILAKL-KAIFADKPVV----E
--------EKSKGNR-------PKSN----------------------R-----------
-----------------------NRRQQERRNQRRSRAENVERDSNTKRQDEVVEEVIR-
--PRSE---RNTKRN--RKANHAVD--TVS----VTENTLDTATV-------ESVE----
------VEKVESVAPRRQRRDLRKKVR-----------ISD-------------------
DVHESALPLVETEISMP--EAETVVEETVV------ATELVPETVPVVEEGETEKR--RD
NNRRRL--PRHLRVNNQRRRRQN-Q-----------EF---KAPMPL-FAAVASPELASG
KVWPDFQPVVV----------KENQFLSVDELLEQQHQPK-----ESAATIP--ALDLVA
EGSEKGVSP---------------------FNGFVVQPANESVEKK-VKQ---SLQRLEE
EQALAIM-----QPLSVADTKIDEA---EGETEHKPLNDVST-------------ELSVK
EKDENSLPQSPVEEVVEQVEMPAQG----------DEVK--SISRLQRN-------YQFS
GRLGTI--SAVPHTTSEMT-LAKASDEP-LE-MCQIGVWTESRYYFH-GKG-SAGHHSAI
SHVYAGPTKAENKGE----
>gi|46143575|ref|ZP_00134935.2|	   992 residues, 50 /line  COG1530: Ribonucleases G and E [Actinobacillus pleuropneumoniae serovar 1 str. 4074]
------------------------------------------------------------
------------------------------------------------------------
--------------------------MLINATQK--------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------------EELRV----------------------------
------------------------------ALVD----GQRLFDL---------------
------------------------------------------------------------
--------------------------DIESPGHEQKKS----------------------
------------------------------------------------------------
-------------NIYKGKITRVEPSL---------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------EAAFVDYGAERHG--------FLPL
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-KEISREYFPAD-YVFNGRPNIKDIIKEGQEVIVQVSKEERGNKGAALTTFISLAGSYLV
LMPNNPRAGGISRRIEGDERLELKEALDCLDVPEDVGLIVRTAGVGKSPEELQWDLKVLL
HHWEAIKKAAESRPAPFLIHQESDVIVRAIRDYLRRDIGEILIDNKKIFEKAKNHIRLVR
PDFINRVRLYEGEVPLFSHYQIESQIESAFQREVRLPSGGSIVIDVTEALTAIDINSSRS
TRGGDIEETALNTNLEAADEIARQLRLRDLGGLIVIDFIDMTPVRHQREVENRIREATRQ
DRARIQFSRISRFGLLEMSRQRLSPSLSEASSHVCPRCQGTGKVRDNESIALSILRLLEE
EAIKENTAQVHTIVPVQIASYLLNEKRKAISSIEKRHDVQVVVVPTESMETPHFSVYRLR
ENEV---LPTLSYDLAKHYHDREEDTQLNTHTVSEEVLVTRN--EPVITVESVLQSSELN
L---QPAPTP---V-----------EPA----KPSLLSRLIAKV-KSFFAPEEKA----E
--------EKPKPKA-------RNQR--------------------DRR-----------
-----------------------NRRERPNRADRQERKQTQT-----------QDEQKA-
--QRQE---RNQERNEAKKARRQVV--EEV----A---GVQETQT-------EQR-----
------SNKDNATTERRQRRDLRKKVR-----------VEN-------------------
VETSIVTTEPITQPIEEKVQNIAQIQPLVA-----------QETQPETVNEERQDV-REN
GRQRRL--PRHLRVGNQRRRDNN-N-----------RKENVVAAMPL-AAAVASPEMASG
KIWVKFSEPVSTNKPNSKA-EEKARFLSVDEMLEQQTTE-------VNEPIV--ESNI-E
NNSASSVAP---------------------VVGFIKQQSDRDLVKE-NKA---RLHHQVE
ESEQADE-----QLVEKAMAKHVA-----------------P-------------LGGFV
SQHSDRDLVKEKNERVQKFQAQATQVPAIGNATAEAISV--PVSNYQSD-------YSFN
GRLGTF--SRVMHTKAEMT-VASAPEKA-LE-TVTVNEWTQSKYYFY-GKG-FGGHSSAV
SHVHSAPRVANTDHE----
>gi|1066807|gb|AAB05638.1|	   721 residues, 50 /line  heat shock protein 82 [Anopheles albimanus]
--------------------------------------------------MP--------
------------------------------------------------------------
-------EAPETETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNSSDALDKIRYESL-
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------TDPTKLDSGKELFIKIIP--NKEAGTLTLI---------DTG
IGMTKADL-VNNLGTIAKSGTKAFM----EALQA----GADIS-MIGQFGVGFYSAYLVA
DKVVVTSKN-NDDEQYVWESSAGGSFTVRAD-SG--EPLGRGTKIVLHIKED-QLEYLEE
SKIKQIVNKHSQFIGYPIKLLVEKEREKEV--SDDEAE--DDKKEEKK------------
-----------------------------------------------EEDKKDDEPKLED
A---EDDD-----DKKDKKKKTVKVKYTEDEELNKT------------------------
------------------------------------------------------------
--------------KP--------IWTRNADDISQEEYGEFYKSLTNDWEDHLAVKHFSV
EGQLDFRALLFVPR------------------RMPFDLFE--NKKKKN--------NIKL
YVRRVFIMDNCE-ELIPDYLNFMK-GVVDSEDLPLNISREMLQQNKILKVIR-KNLVKKC
MELFEELA--EDKET--YKKFYDQFSKNLKLGVHEDSQNRQKLADLLRFNTSASGDEYCS
LN----DYVGRMKENQTQIYFITGESIEQVKNSAFVERVKKR------------------
-----GFEVIYMTEAIDEYVIQQLKEYKGKQLVCVTKEGLELPEDEAEKKKRE-------
---EDKAKFENLCKVMKS-VLESKVEKVVVSNRLVDSPCCIVTSQYGWSANMERIMKAQA
L---RDSSAMGYMAGKKHLEINPDHAIIETLRQRAEADKNDKAVKD--------------
------------LVILLFETALLSSGFSLDEPGT--------------------HAARIY
RMVKLGLGIDDDEPMTTDEVSGA-------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------------------------------------G----------------------
-------------------------------------------APTTAA-----G-----
------------------------------------------------------------
----------------------------DAPPLV-DDSEDLSHMEE--------------
-------------VD----
>gi|66512625|ref|XP_623939.1|	   724 residues, 50 /line  PREDICTED: similar to heat shock protein 90-alpha isoform 2 [Apis mellifera]
--------------------------------------------------MPE-------
------------------------------------------------------------
--DVTMANAGEVETFAFQAEIAQLMSLIINTFYSNKEIFIRELISNASDALDKIRYESL-
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------TDPSKLDTCKELFIKIVP--NKNDRTLTIL---------DSG
IGMTKADL-VNNLGTIAKSGTKAFM----EALQA----GADIS-MIGQFGVGFYSAYLVA
DKVVVISKH-NDDEQYVWESSAGGSFTVRPD-NG--EPIGRGTKIILHIKED-QTEYLEE
SKIKEIVKKHSQFIGYPIKLVVEKERDKEL--SEDEEE--EEEPA--K------------
-----------------------------------------------EEGEDTGKPKIEE
VGEDEDEDKPK--DEKKKKKKTIKEKYTEDEELNKT------------------------
------------------------------------------------------------
--------------KP--------IWTRNPDDISQEEYGEFYKSLTNDWEDHLAVKHFSV
EGQLEFRALLFIPR------------------RAPFDLFE--NKKRKN--------NIKL
YVRRVFIMDNCE-DLIPEYLNFIK-GVVDSEDLPLNISREMLQQNKILKVIR-KNLVKKC
LELFEELS--EDKES--YKKCYEQFSKNIKLGIHEDSQNRKKLSELLRYHTSASGDEMCS
LK----DYVGRMKENQKHIYYITGESREQVANSSFVERVKKR------------------
-----GFEVVYMTEPIDEYVVQQLKEFDGKQLVSVTKEGLELPEDEEEKKKRE-------
---EDKAKFENLCKVMKD-ILDKKVEKVVVSNRLVDSPCCIVTSQYGWTANMERIMKAQA
L---RDASTMGYMAAKKHLEINPDHPIMENLRQKAEADKHDKSVKD--------------
------------LVMLLFETALLSSGFALEDPQV--------------------HASRIY
RMIKLGLGFDDDDTPNVEDEK---------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------------------MD-----T-----
------------------------------------------------------------
----------------------------EVPPLE-DDTEEASRMEE--------------
-------------VD----
>gi|91083665|ref|XP_967904.1|	   721 residues, 50 /line  PREDICTED: similar to Heat shock protein 83 (HSP 82) [Tribolium castaneum]
--------------------------------------------------MPE-------
------------------------------------------------------------
--EN---QNGDVETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNSSDALDKIRYESL-
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------TNPSRLDSGKELYIKIIP--NKNDGTLTII---------DTG
IGMTKADL-VNNLGTIAKSGTKAFM----EALQA----GADIS-MIGQFGVGFYSAYLVA
DKVTVVSKN-NDDEQYVWESSAGGSFTVTQD-RG--EPLGRGTKIVLHMKED-QTEFLEE
HKIKEIVKKHSQFIGYPIKLVVEKEREKEL--SDDEAE--EEKKEEEG------------
------------------------------------------------EDKDKDKPKIED
VGEDEDEDTKK---EDKKKKKTIKEKYTEDEELNKT------------------------
------------------------------------------------------------
--------------KP--------IWTRNADDISQEEYGEFYKSLTNDWEDHLAVKHFSV
EGQLEFRALLFVPR------------------RVPFDLFE--NKKRKN--------NIKL
YVRRVFIMDNCE-ELIPEYLNFIK-GVVDSEDLPLNISREMLQQNKILKVIR-KNLVKKC
LELFEELA--EDKDG--YKKFYEQFSKNIKLGIHEDSQNRAKLSELLRYHTSASGDEACS
LK----DYVSRIKPNQKHIYYITGESKEQVANSSFVERVKKR------------------
-----GFEVVYMTEPIDEYVVQQMKEFDGKTLVSVTKEGLELPEDEEEKKKRE-------
---EDKAKFEGLCKVMKS-ILDNKVEKVVVSNRLVESPCCIVTSQYGWTANMERIMKAQA
L---RDTSTMGYMAAKKHLEINPDHSIIENLRQKAEADKNDKAVKD--------------
------------LVILLFETALLSSGFTLDEPQV--------------------HASRIY
RMIKLGLGIDEEEAMITEDAQG--------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------G-----D-----
------------------------------------------------------------
----------------------------APSADA-AESEDASRMEE--------------
-------------VD----
>gi|70997669|gb|AAZ17403.1|	   720 residues, 50 /line  90 kDa heat shock protein [Bemisia tabaci]
--------------------------------------------------MPE-------
------------------------------------------------------------
--DVN---MEQAETFVFQAEIAQLMSLIVNTFYSNKEIFLRELISNSSDALDKIRYESL-
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------TDPSRLESGKELYIKIIP--NKNDRTLTII---------DTG
IGMTKADL-VNNLGTIAKSGTKAFM----EALAA----GADIS-MIGQFGVGFYSAFLVA
DTVTVVSKH-NDDEQYVWESSAGGSFTIKSD-HG--EPLGRGTKIIMHMKED-MTEFLEE
RKIKDIVKKHSQFIGYPIKLLVEKERDKEL--SEDEEE--EEVKKEDK------------
----------------------------------------------EEKEEDKDTPKIED
V---EDEEEGK---EKKKKKKTIKEKYTEDEELNKT------------------------
------------------------------------------------------------
--------------KP--------IWTRNPDDITTEEYGEFYKSLTNDWEDHLAVKHFSV
EGQLEFKALLFVPR------------------RAPFDLFE--NKKKKN--------NIKL
YVRRVFIMDNCE-DLIPEYLNFIK-GVVDSEDLPLNISREMLQQNKILKVIR-KNLVKKC
LELFEELA--EDKEN--FKKFYEQFSKNLKLGIHEDTQNRKKLADLLRYQTSATGDDVCS
FK----DYVARMKENQKHIYYITGESKDQVANSSFVERVKKR------------------
-----GFEVIYMTEPIDEYVVQQMKDYDGKNLVSVTKEGLELPEDEEEKKKYE-------
---EDKVKFETLCKVMKD-ILDKKVEKVIVSSRLVESPCCIVTSQYGWTANMERIMKAQA
L---RDSSTMGYMAAKKHLEINPDHPVMDALRVKAEAEKNDKSVRD--------------
------------LVMLLFETALLSSGFALEDPQV--------------------HAGRIH
RMIKLGLGIDEDEPVMVEEEK---------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------------------PD-----T-----
------------------------------------------------------------
----------------------------AMPAAD-GDAEDASRMEE--------------
-------------VD----
>gi|109689148|emb|CAK95235.1|	   728 residues, 50 /line  84kDa heat shock protein [Haliotis tuberculata]
--------------------------------------------------MPEPQ-----
------------------------------------------------------------
--EAQM-DEGEVETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNSSDALDKIRYESL-
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------TDPSKLDGNKDMQIRIVP--DKENKTLVIE---------DSG
IGMTKADL-VNNLGTIAKSGTKAFM----EALQA----GADIS-MIGQFGVGFYSAYLVA
ERVVVESKH-NDDEQYIWESSAGGSFTIKTS-ND--PTLGRGTRITLYMKED-QVEYLEE
RRVKEIVKKHSQFIGYPIKLMVEKERDKEV--SDDEEE--EKKEDEEK------------
---------------------------------------------KDDEEESEDKPKVED
LDE--DEDEDK--SKDKKKKKKIKEKYTEDEELNKT------------------------
------------------------------------------------------------
--------------KP--------LWTRNADDITQEEYAEFYKSLTNDWEDHLAVKHFSV
EGQLEFRALLFLPK------------------RAPFDMFE--NKKKKN--------NIKL
YVRRVFIMDNCE-DLIPEYLNFVR-GVVDSEDLPLNISREMLQQSKILKVIR-KNLVKKC
MELFDDIM--EDKDN--FKKFYEQFSKNLKLGIHEDSTNRRKLSDLLRYYTSQSGDEVTS
LK----EYVSRMKENQKSIYYITGESKDSVQNSAFVERVKKR------------------
-----GFEVIYMTDPIDEYCVQQLKEYDGKTLVCVTKEGLELPEDEEEKKKLE-------
---EAKAQFEGLCKVMKE-ILDKKVEKVVVSNRLVTSPCCIVTSQYGWSANMERIMKAQA
L---RDTSTMGYMAAKKHLEINPDHPIVKTLKEKADADKNDKAVKD--------------
------------LCMLLFETSLLASGFSLEDPTS--------------------HANRIH
RMIKLGLGIDEDDIPTEATAES--------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------------------AT-----D-----
------------------------------------------------------------
----------------------------EMPPLE-GDEDDASRMEE--------------
-------------VD----
>gi|38146757|gb|AAR11781.1|	   726 residues, 50 /line  heat shock protein 90 [Chlamys farreri]
--------------------------------------------------MPEPE-----
------------------------------------------------------------
--GQAM-EDGEVETFAFQAGIAQLMSLIINTFYSNKEIFLRELISNCSDALDKIRYESL-
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------TDPSKLDSGKELEIKIVP--NKDDNTLSIM---------DTG
IGMTKADL-VNNLGTIARSGTKAFM----EALQA----GADIS-MIGQFGVGFYSAYLVA
DRVVVETKN-NDDEHYIWESSAGGSFTVRSG-DG--SFI-LGTRITLHMKED-QAEYLEE
KKVKEIVKKHSQFIGYPIKLQVEKERDVEV--SDDEEE--EEKKEEDK------------
----------------------------------------------DAEKSEDDKPKVED
LDD-EDDDEDK--SKDKKKKK-IKGKYIEDEELNKT------------------------
------------------------------------------------------------
--------------KP--------IWTRNPDDITQEEYGEFYKSLTNDWEDHLAVKHFSV
EGQLEFRALLFVPR------------------RAPFDLFE--NKKKKN--------NIKL
YVRRVFIMDNCN-EVIPEYLNFVR-GVVDSEDLPLNISREMLQQSKILKVIR-KNLVKKC
MELFDDIA--EDKEN--YKKFYEQFAKNLKLGIHEDTTNRKKIADFLRYHTSQSGDEMTS
FK----EYVSRMKENQKSIYYITGESREVVQSSAFVENVKKR------------------
-----GIEVIYMVDPIDEYAVQQLKEYEGKTLVSVTKEGLELPEDEEEKKRFE-------
---EATAEYEGLCKVVKE-ILDKKVEKVTVSNRLVTSPCCIVTSQYGWSANMERIMKAQA
L---RDSSTMGCMAAKKHLEINPDHAIIKSLKEKAGLDKNDKSVKD--------------
------------LVLLLFETSMLASGFSLEEPGT--------------------HANRIH
RMIKLGLGIDDDDSGAPETSDE--------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------------------NV-----E-----
------------------------------------------------------------
----------------------------EPPPLE-GDEDDASRMEE--------------
-------------VD----
>gi|14041148|emb|CAC38753.1|	   733 residues, 50 /line  heat shock protein 90 [Dendronephthya klunzingeri]
--------------------------------------------------MSESE-----
------------------------------------------------------------
--IKTMDEDNEVETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNSSDALDKIRYQSL-
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------TDPTKLDNCKDMKMEIIP--NKDDNTLTII---------DTG
IGMTKADL-VNNLGTIAKSGTKAFM----EALQS----GADIS-MIGQFGVGFYSAYLVA
ERVVVHTKH-NDDEQYVWESSAGGSFTVARD-DS--EMYGRGTKIILHMKDD-QLEYLEE
KRVKDIVKKHSQFIGYPIILKVQKEREKEV--SDDEDD--EDDEDKKE------------
----------------------DAEEKAENG--------------EAEENGEKEKAKIED
LDE----DAEK--EGEEKKKKKIMEKYIDEEELNKT------------------------
------------------------------------------------------------
--------------KP--------LWMRNPSDITSEQYAEFYKSLTNDWEEHLAVKHFSV
EGQLEFRAILFVPK------------------RAPFDLFE--NRKKRN--------NIKL
YVRRVFIMDTCD-DLIPEYLNFVK-GVVDSEDLPLNISRETLQQSKILKVIR-KNLVKKC
MELFNEVA--EDKDN--YKTFYEQFSKNLKLGIHEDSTNRAKLAELLRYHTSSS-DDMTS
LK----EYVSRMKEGQKDIYYITGESKDQVSNSAFVERVKKR------------------
-----GFEVLYMTEPIDEYSIQQLKEYDGKKLVSVTKEGLELPEDEEEKKKRE-------
---EQNAAFEELCKLIKE-ILDKKVEKVVLSNRLVSSPCCIVTSQYGWSANMERIMKAQA
L---RDSSTMGYMAAKKHLEINPDHSIIIALNKKVAEDKNDKSVKD--------------
------------LVHLLFETSLLSSGFTLDEPQV--------------------HSARIY
RMINLGLGIDEDA---TEDAAG--------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------------------DE-----E-----
------------------------------------------------------------
----------------------------DMPPLEEGGDEDSSKMEE--------------
-------------VD----
>gi|148802325|gb|EDL43724.1|	   748 residues, 50 /line  heat shock protein 86, putative [Plasmodium vivax]
------------------------------------------------------------
------------------------------------------------------------
---------MSKETFAFNADIRQLMSLIINTFYSNKEIFLRELISNASDALDKIRYEAI-
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------TDTQKLSAEPEFFIRIIP--DKTNNTLTIE---------DSG
IGMTKNDL-INNLGTIARSGTKAFM----EAIQA----SGDIS-MIGQFGVGFYSAYLVA
DHVVVVSKN-NDDEQYVWESAAGGSFTVTKDETN--EKMGRGTKIILHLKDD-QLEYLEE
KRIKDLVKKHSEFISFPIKLYCERQNEKEITASEDEAE--EEDAEGEK------------
------------KKKEGKDQLDDGDKQAQEGEGADNKEKKEHNEEDEDKEKGEDHPKVED
VTEELENAEKK--KKKEKKKKKIHTVEHEWEELNKQ------------------------
------------------------------------------------------------
--------------KP--------LWMRKPEEVTNEEYASFYKSLTNDWEDHLAVKHFSV
EGQLEFKALLFIPK------------------RAPFDMFE--NRKKRN--------NIKL
YVRRVFIMDDCE-EIIPEWLNFVK-GVVDSEDLPLNISRESLQQNKILKVIK-KNLIKKC
LDMFSELA--ENKDN--YKKFYEQFSKNLKLGIHEDNANRAKITELLRFQTSKSGDEMIG
LK----EYVDRMKENQKDIYYITGESINAVSNSPFLEALTKK------------------
-----GFEVIYMVDPIDEYAVQQLKDFEGKKLKCCTKEGLDIDDSEEAKKTFE-------
---TMKAEYEGLCKVIKD-VLHEKVEKVVVGQRITDSPCVLVTSEFGWSANMERIMKAQA
L---RDNSMTSYMLSKKIMEINARHPIITALKQKADADKSDKTVKD--------------
------------LIWLLFDTSLLTSGFALEEPTT--------------------FSKRIH
RMIKLGLSIDEEENNDI-------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------ELPPLEETIDATDSKMEE--------------
-------------VD----
>gi|18858873|ref|NP_571403.1|	   726 residues, 50 /line  heat shock protein 90-alpha [Danio rerio]
--------------------------------------------------MPEAH-----
------------------------------------------------------------
--EQQMMEDEEVETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNSSDALDKIRYESL-
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------TDPSKLDSCKDLKIELIP--DQKERTLTII---------DTG
IGMTKADL-INNLGTIAKSGTKAFM----EALQA----GADIS-MIGQFGVGFYSAYLVA
EKVTVITKH-NDDEQYIWESAAGGSFTVKPD-FG--ESIGRGTKVILHLKED-QSEYVEE
KRIKEVVKKHSQFIGYPITLYIEKQREKEV--DLEEGE--KQ-EEEEV------------
--------------------------------------------AAGED---KDKPKIED
LGADEDED-SK--DGKNKRKKKVKEKYIDAQELNKT------------------------
------------------------------------------------------------
--------------KP--------IWTRNPDDITNEEYGEFYKSLSNDWEDHLAVKHFSV
EGQLEFRALLFVPR------------------RAAFDLFE--NKKKRN--------NIKL
YVRRVFIMDNCE-ELIPEYLNFIK-GVVDSEDLPLNISREMLQQSKILKVIR-KNLVKKC
LDLFTELA--EDKDN--YKKYYEQFSKNIKLGIHEDSQNRKKLSDLLRYYTSASGDEMVS
LK----DYVSRMKDTQKHIYYITGETKDQVANSAFVERLRKA------------------
-----GLEVIYMIEPIDEYCVQQLKEYDGKNLVSVTKEGLELPEDEEEKKKQD-------
---ELKAKYENLCKIMKD-ILDKKIEKVTVSNRLVSSPCCIVTSTYGWTANMERIMKSQA
L---RDNSTMGYMTAKKHLEINPAHPIVETLREKAEAEKNDKAVKD--------------
------------LVILLFETALLSSGFTLDDPQT--------------------HANRIY
RMIKLGLGIDDDDSVVEEISQP--------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------------------AE-----E-----
------------------------------------------------------------
----------------------------DMPVLE-GD-DDTSRMEE--------------
-------------VD----
>gi|74147335|dbj|BAE27553.1|	   733 residues, 50 /line  unnamed protein product [Mus musculus]
--------------------------------------------------MPEETQT---
------------------------------------------------------------
--QDQPMEEEEVETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNSSDALDKIRYESL-
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------TDPSKLDSGKELHINLIP--SKQDRTLTIV---------DTG
IGMTKADL-INNLGTIAKSGTKAFM----EALQA----GADIS-MIGQFGVGFYSAYLVA
EKVTVITKH-NDDEQYAWESSAGGSFTVRTD-TG--EPMGRGTKVILHLKED-QTEYLEE
RRIKEIVKKHSQFIGYPITLFVEKERDKEV--SDDEAE--EKEEKEEE------------
--------------------------------------------KEKEEKESDDKPEIED
VGSDEEEEEKK--DGDKKKKKKIKEKYIDQEELNKT------------------------
------------------------------------------------------------
--------------KP--------IWTRNPDDITNEEYGEFYKSLTNDWEEHLAVKHFSV
EGQLEFRALLFVPR------------------RAPFDLFE--NRKKKN--------NIKL
YVRRVFIMDNCE-ELIPEYLNFIR-GVVDSEDLPLNISREMLQQSKILKVIR-KNLVKKC
LELFTELA--EDKEN--YKKFYEQFSKNIKLGIHEDSQNRKKLSELLRYYTSASGDEMVS
LK----DYCTRMKENQKHIYFITGETKDQVANSAFVERLRKH------------------
-----GLEVIYMIEPIDEYCVQQLKEFEGKTLVSVTKEGLELPEDEEEKRKQE-------
---EKKTKFENLCKIMKD-ILEKKVEKVVVSNRLVTSPCCIVTSTYGWTANMERIMKAQA
L---RDNSTMGYMAAKKHLEINPDHSIIETLRQKAEADKNDKSVKD--------------
------------LVILLYETALLSSGFSLEDPQT--------------------HANRIY
RMIKLGLGIDEDDPTVDDTSAA--------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------------------VT-----E-----
------------------------------------------------------------
----------------------------EMPPLE-GD-DDTSRMEE--------------
-------------VD----
>gi|90075818|dbj|BAE87589.1|	   724 residues, 50 /line  unnamed protein product [Macaca fascicularis]
--------------------------------------------------MPEEVH----
------------------------------------------------------------
------HGEEEVETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNASDALDKIRYESL-
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------TDPSKLDSGKELKIDIIP--NPQERTLTLV---------DTG
IGMTKADL-INNLGTIAKSGTKAFM----EALQA----GADIS-MIGQFGVGFYSAYLVA
EKVVVITKH-NDDEQYAWESSAGGSFTVRAD-HG--EPIGRGTKVILHLKED-QTEYLEE
RRVKEVVKKHSQFIGYPITLYLEKEREKEI--SDDEAE--EEK---GE------------
--------------------------------------------KEEEDKDDEEKPKIED
VGSDEEDDS-G--KDKKKKTKKIKEKYIDQEELNKT------------------------
------------------------------------------------------------
--------------KP--------IWTRNPDDITQEEYGEFYKSLTNDWEDHLAVKHFSV
EGQLEFRALLFIPR------------------RAPFDLFE--NKKKKN--------NIKL
YVRRVFIMDSCD-ELIPEYLNFIR-GVVDSEDLPLNISREMLQQSKILKVIR-KNIVKKC
LELFSELA--EDKEN--YKKFYEAFSKNLKLGIHEDSTNRRRLSELLRYHTSQSGDEMTS
LS----EYVSRMKETQKSIYYITGESKEQVANSAFVERVRKR------------------
-----GFEVVYMTEPIDEYCVQQLKEFDGKSLVSVTKEGLELPEDEGEKKKME-------
---ESKAKFENLCKLMKE-ILDKKVEKVTISNRLVSSPCCIVTSTYGWTANMERIMKAQA
L---RDNSTMGYMMAKKHLEINPDHPIVETLRQKAEADKNDKAVKD--------------
------------LVVLLFETALLSSGFSLEDPQT--------------------HSNRIY
RMIKLGLGIDEDEVAAEEPSAA--------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------------------VP-----D-----
------------------------------------------------------------
----------------------------EIPPLE-GD-EDASRMEE--------------
-------------VD----
>gi|40956306|gb|AAO14563.2|AF461150_1	   721 residues, 50 /line  Hsp90 [Heterodera glycines]
------------------------------------------------------------
------------------------------------------------------------
------MSEQSGETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNSSDALDKIRYQAL-
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------TDPSQMESGKELFIKIVP--NKADKTLTII---------DTG
IGMTKADL-VNNLGTIAKSGTKAFM----EALQA----GADIS-MIGQFGVGFYSAFLVA
DRVTVTSKH-NDDDCYQWESSAGGSFIIRNC-AD--PEVTRGTKIVLHLKED-QTDYLEE
RRVREVVKKHPQFIGYPIKLLVEKERDKEI--SDDEAE--EEKKEDEA------------
----------------------------------------------KEEEKKPE----DD
VSDDEAEKKKEEGDKKKKKTKKIKEKYTEDEELNKT------------------------
------------------------------------------------------------
--------------KP--------IWTRNPDDISNEEYAEFYKSLSNDWEDHLAVKHFSV
EGQLEFRALLFVPQ------------------RAPFDLFE--NKKSKN--------AIKL
YVRRVFIMENCE-ELMPEYLNFIK-GVVDSEDLPLNISRETLQQSKILKVIR-KNLVKKC
MDLFEEIS--EDKDN--FKKFYEQFAKNIKLGIHEDSVNRKKLSDFLRYYTSASGEEPCS
FK----DYVSRMKENQTCIYYITGESKDVVQNSSFVERVKKR------------------
-----GFEVIYMVDPIDEYCVQQLKEYDGKKLVSVTKEGLELPESEEEKKKFE-------
---EDKVKFEKLCKVIKD-ILDKKVQKVSVSNRLVSSPCCIVTGEYGWSANMERIMRAQA
L---RDSSTMGYMASKKNLEINPDHSIIKSLRDRVEKEQDDKTAKD--------------
------------LVVLLYETSLLTSGFSLEDPQQ--------------------HASRIY
RMVKLGLDIPDEEEPAEQQPSTS-------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------------------------------------G----------------------
-------------------------------------------EPTI-------------
------------------------------------------------------------
-----------------------------AEKIA-GAEEEASRMEE--------------
-------------VD----
>gi|71030336|ref|XP_764810.1|	   721 residues, 50 /line  heat shock protein 90 [Theileria parva strain Muguga]
--------------------------------------------------MTS-------
------------------------------------------------------------
-----KDETPDQEVYAFNADISQLLSLIINAFYSNKEIFLRELISNASDALEKIRYEAI-
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------KDPKQIEDQPDYYIRLYA--DKNNNTLTIE---------DSG
IGMTKADL-VNNLGTIAKSGTRAFM----EALQA----GSDMS-MIGQFGVGFYSAYLVA
DKVTVVSKN-NADDQYVWESTASGHFTVKKD-DS-HEPLKRGTRLILHLKED-QTEYLEE
RRLKELVKKHSEFISFPISLSVEKTQETEV--TDDEAELDEDKKPEEE------------
----------------------------------------------KPKDDKVEDVTDEK
VTDVTDEEEKK--EEKKKKKRKVTNVTREWEMLNKQ------------------------
------------------------------------------------------------
--------------KP--------IWMRLPSEVTNEEYAAFYKNLTNDWEDHLAVKHFSV
EGQLEFKALLFVPR------------------RAPFDMFE--SRKKKN--------NIKL
YVRRVFIMDDCE-ELIPEWLSFVK-GVVDSEDLPLNISRETLQQNKILKVIR-KNLVKKC
LELFNELT--EKKED--FKKFYEQFSKNLKLGIHEDNANRSKIAELLRFETTKSGDELVS
LK----EYVDRMKSDQKYVYYITGESKQSVASSPFLETLRAR------------------
-----DYEVLYMTDPIDEYAVQQIKEFEGKKLKCCTKEGLDLDEGEDEKKSFE-------
---ALKEEMEPLCKHIKE-VLHDKVEKVVCGTRFTDSPCALVTSEFGWSANMERIMKAQA
L---RDSSITSYMLSKKIMEINPRHSIMKELKTRAANDKTDKTVKD--------------
------------LVWLLYDTALLTSGFNLDEPTQ--------------------FGNRIY
RMIKLGLSLDDEEHVEEDSS----------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------MPPL-DEPVVDSKMEE--------------
-------------VD----
>gi|114326947|ref|YP_744104.1|	   949 residues, 50 /line  ribonuclease E [Granulibacter bethesdensis CGDNIH1]
------------------------------------------------------------
------------------------------------------------------------
---------MSCHAPQALARIRLRLCVPFATIHRHNVMPGGARRSRISRVCTGAHY-SM-
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------TKKMLIDASHAEETRVVVMDGNRLEDFDVE---------AAS
RKQIKGNIYLAKVVRVEPSLQAAFV----EYGGN----RHGFL-AFSEI-----------
------------------------------------------------------------
---------HPDYYQIPVA---DRQRLLAM--QEEEAREEEEAEEAEFSAAEARRSASRP
LNNAREVIQADSEQPEASDPQEDGADHGVQDESAADFSGEAGDEGSVPASAGEGDDQEES
RQASRPARQKEDR---ERRSPRFLRNYKIQEVIKRRQILLIQVVKEERGNKGAALSTYIS
LAGRYCVLMPNSPRGGGVSRKITSATDRRRLKDIIGALEIPRGMGIIVRTAGGNRPKAEI
MRDCEYLLRLWDDIRD--------ITLRSSAPALIHEEASLIKRAIRDVYTS-TIEEVLV
DGEEGWRAARDIMRMLMPSHARKVICWNADKERAGQPLFA--HYQVESQLDAILAPNVSL
KSGGYLVINQAE-ALVAIDVNSGR-STKERGIEETALRTNLEAADEVARQLRLRDLAGLI
VIDFIDME--SRKHNGMVERRLKEALKNDRARIQVGQISSFGLLEMSRQRLRPSLTETSM
ITCPHCNGLGLVRTTEGASVHVLRAIEEEGARRRYAEIMVHAAADVAFYILNNRRDFLAT
LESRFGMKVLFSADTQFSGSQLRIEKIRARAMEDVVRTPLIGVADPQPSVAGDLYDFADA
SDGFATFEAAPVAALPVA-VQAEPVGTAEEGNNGGRLPSAEGDSEPGPDDGERRRRRRRR
R---RGN--------------RRNDGAENGMDARSEQDENGNPVEEGEGVRHGDANTSAL
PVETTELT---VAGVASKETSAETQGDAIDGTQAVSGEFGDEFAEDSRPRRRGRRGGRGR
RQPAQANGHDAGEVAYTGPTPAD-------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------------------------------------PFGQQPLDVFDVMDGIEQPMIRD
GKVDQGSRSERHPDLV--------------------PEPVVVSEEQAEP-----Y-----
------------------------------------------------------------
----------------------------IAPPIQPVVIEDTAPRAR--------------
-------------RGWWKR
>gi|84498597|ref|ZP_00997360.1|	   1003 residues, 50 /line  hypothetical protein JNB_20433 [Janibacter sp. HTCC2649]
--------------------------------------------------MATQD-----
------------------------------------------------------------
--EPTTQNDASTTDGAESAPAKAPRRRRATKKAAAPVIAETATDAGSEPAAEPAADEATE
AAPKKKAAKKTAKKAAPRKRATKKAVAQQEALLEEPTTVDEPLVEEDEALVEEPVVEPEP
EKVEAPKVVPSFGILFQAPDVTAAPRRRRATAPAQAPSEGTIDSAPEAEAPAPTRDKSAK
AEIDAPAEKPTRSRRGRAAKTVEAAEPTEDDQAVEDQSGDDDSREDSGDEPQEGARRRRR
GGRGRRGRGGNERSDDNASDDATSSDSAESSDDSDESDDQDARADDGADNENGDGGTSRR
RRRRRRSGSSADGDDPPGTVTKVREPRKERERERSDEPTAVKGSTRLEAKKQRRREGREA
GRRRTIITEAEFLARRESVERIMTVRGKGDKTQIGVLEDGVLVEHYVS---------RET
NASMAGNVYLGRVQNVLPSMEAAFV----DIGKG----RNAVL-YAGEVNWD--------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------AAGLEQNRAKRIENAMGSGDTVLVQVTKDPIGHKGARLTSQIS
LPGRYLVYVPEGSMTG-ISRKLP-DTERARLKAILKEV-VPEHAGVIVRTAAEGASEEEL
RADVERLTKAWEKIQQKVAAASSKKAGSGGAPVLLHGEADLTVRVIRDVFTE-DFSELIV
SGDQAWAEVSGYVEDVAPDLAKRLTHWTSEE-----DLFS--HHRVDEQISKAMDRKVWL
PSGGSLVIDRTE-AMTVVDVNTGKFVGSGGNLEETVTKNNIEAAEEIVRQLRLRDIGGII
VIDFIDMV--LESNRDLVVRRLLECLGRDRTKHQVAEVTSLGLVQMTRKRVGSGLIEVFS
EQCEHCAGRGIIVQSE--------------------------------------------
------------------------------------------------------------
-----------------------PVDRTGTSNEHGHSNGAV--GGQGGDKSGSASSRGRN
R---RGKADSGQASAPKDATVEDAPPVRS-----------------GPTAAQIAAAAHAA
AIKSLSGESTDDDVADLAGPADDESTQ-------PTHTPVVESSEVSEPSEPSHTEPAEP
A---------------------E-------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------------------------------------PAEPTQVAPATVIAEVG------
-RPDSADDTEAVRPIV--------------------AEPAPIDQPVVRPRRKRGR-----
------------------------------------------------------------
----------------------------VVAPAGPPKTADLEQGEN--------------
-------------DR----
>gi|125564091|gb|EAZ09471.1|	   803 residues, 50 /line  hypothetical protein OsI_030703 [Oryza sativa (indica cultivar-group)]
--------------------------------------------------MAPALSRSLG
ASSVAALRPTPSRGRGPTLRSAVAVQGRGAAAVAARGVRWEAGRRKGKGRMVGVRCEAAV
TEKPAGEEEAAGEQFEYQAEVSRLLDLIVHSLYSHKEVFLRELVSNASDALDKLRFLSV-
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------TDSSVLSDGGELEIRIKP--DPEAGTITITRSHCFAYYSDTG
IGMTKDEL-KDCLGTIAQSGTSKFL----KALKENQDLGADNG-LIGQFGVGFYSAFLVA
EKVVVSTKSPKADKQYVWEAMADSSSYVIKEETDPEKMLTRGTQITLFLRDDDKYEFADP
GRIQGLVKNYSQFVSFPIYTWQEKSRTVEV--EEEEEE--EPKEGEEA------------
------------------------------------------------------------
---------TE--GEKKKKKKTITEKYWDWELANET------------------------
------------------------------------------------------------
--------------KP--------IWMRNPKEVEKTEYNEFYKKAFNEFLDPLAYTHFTT
EGEVEFRSVLYIPG------------------MAPLSNEE-IMNPKTK--------NIRL
YVKRVFISDDFDGELFPRYLSFVK-GVVDSNDLPLNVSREILQESRIVRIMR-KRLVRKT
FDMIQEIAEKEDKED--YKKFWESFGKFVKLGCIEDTGNHKRLSPLLRFYSSKNETDLIS
LD----QYVENMPENQKAIYYIATDSLQSAKTAPFLEKLVQK------------------
-----DIEVLYLIEPIDEVAIQNLQTYKEKKFVDISKEDLELGDEDEDKEN---------
---ESKQEYTLLCDWIKQ-QLGDKVAKVQISKRLSSSPCVLVSGKFGWSANMERLMKAQT
L---GDTSSLEFMRGRRIFEINPDHPIVKDLSAACKNEPESTEAKR--------------
------------AVELLYETALISSGYTPDSPAE--------------------LGGKIY
EMMTIALGGRWGRPEESEAATSE-------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------------------------------------S----------------------
------------------------------------------NVEVESSEGSATE-----
------------------------------------------------------------
----------------------------VVEPSE--VRPESDPWKD--------------
-------------------

Ad blocker interference detected!


Wikia is a free-to-use site that makes money from advertising. We have a modified experience for viewers using ad blockers

Wikia is not accessible if you’ve made further modifications. Remove the custom ad blocker rule(s) and the page will load as expected.