Fandom

Proteins Wiki

At2g03540.1/MSA

< At2g03540.1

47,922pages on
this wiki
Add New Page
Talk0 Share
>gi|15227661|ref|NP_178452.1|	   166 residues, 50 /line  unknown protein [Arabidopsis thaliana]
------------------------------------------------------------
-------------------------MIDMGISRTSTVLEAWTNRRRRRHRVDCLRSMEEM
LALKRNSRT-NEQDRVLWKGKNGHLESHT---------HNGEQGFLAQKGLICASYTETC
VLH---------------------------------------------------------
---VWR------------------------------------------------------
-----------------------DKVDGLLARYVLQATIYTIWRERNERKHGTGL-NSAN
RLIKWIDRHIRNQLSVLKISGDHRYN--KGLQVW--------------------------
------------------------------------------------F------TSRGI
------N
>gi|10177359|dbj|BAB10650.1|	   76 residues, 50 /line  unnamed protein product [Arabidopsis thaliana]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------------------MQH-NRIERFLARYILQASVYTLWRERNGRRHGEDP-NPAA
RLIRWIDKQMRNALSSIKEMGDRRYD--TGLQLW--------------------------
------------------------------------------------F------ATAN-
-------
>gi|116830389|gb|ABK28152.1|	   196 residues, 50 /line  unknown [Arabidopsis thaliana]
------------------------------------------------------------
------------------------------------------------------------
--------------------------MALLTKVTWNNIGMHQPQTNWYKGVWFPYSTPKY
SFLLWLTIQNRLSTGDHIKAWNSGQQVTCTLCGNAEETRNLLF-----------FSC-HY
TSEVWRT--LTQRLLSND---------------------------YS----RDWNRLLPL
LCN----------------TNM-PTDLLFLFRYVFQASVYHIWRERNARRHGEIS-SPPN
RLIKFIDKNVRNRINSIRDTGDHNYN--ACLQLW--------------------------
------------------------------------------------F------STRPL
SSTHSLG
>gi|116830665|gb|ABK28290.1|	   84 residues, 50 /line  unknown [Arabidopsis thaliana]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------------------------MHHF-----------------
------------------------------------------------------------
IIS----------------KSS-NLVLPSCTDYFFQATVYSIWLERNKRRHSEPP-STAD
QVIKFLDRIIRNKISSIHRTNPRKHE--DGFRVW--------------------------
------------------------------------------------V------DSRNG
-------
>gi|15223191|ref|NP_174517.1|	   192 residues, 50 /line  unknown protein [Arabidopsis thaliana]
---MK-------------------------------------------------------
----------------------------LQRSCYVRILNEFE----------------EI
LLQKYQQRNIEREEAILWRGKADVFKATFSTKDTWNHIRTSSNQRAWHTGVWFAHATPKF
SFCAWLAVRNRLSMVDRMMTWNNGTPTTCVFCSSPMETRDHLF-----------FQC-HY
SSEIWTS--IAKNVYKDG---------------------------FS----TDWSAVVNY
ISD----------------SQP-DCIQNFLSRYTFQVSIHSITVR----RHVQLQ-TSCD
R-----------------------------------------------------------
------------------------------------------------------------
-------
>gi|8920614|gb|AAF81336.1|AC007767_16	   206 residues, 50 /line  Strong similarity to a putative non-LTR retroelement reverse transcriptase At2g23880 gi|3738337 from Arabidopsis thaliana BAC F27L4 gb|AC005170
---MK-------------------------------------------------------
----------------------------LQRSCYVRILNEFE----------------EI
LLQKYQQRNIEREEAILWRGKADVFKATFSTKDTWNHIRTSSNQRAWHTGVWFAHATPKF
SFCAWLAVRNRLSMVDRMMTWNNGTPTTCVFCSSPMETRDHLF-----------FQC-HY
SSEIWTS--IAKNVYKDG---------------------------FS----TDWSAVVHI
PS-----------------------LHSF--------------------NHGEAS-RSAS
NLMRQIDKTIRNQLSTIQKKGELRLE--KGLQVW--------------------------
------------------------------------------------F------AMR-P
-------
>gi|9665166|gb|AAF97350.1|AC021045_7	   176 residues, 50 /line  Hypothetical Protein [Arabidopsis thaliana]
------------------------------------------------------------
----------------------------MGIPLVATLATVLQTHRSRRHRAELYNKI-EA
EIQRLQQQVQEAEKLVQGR------------------------------LVPLLHAQVLL
H----FVARNT---------------------QQTFNRRSHQN-----------MEL-RY
SSEVWEN--LAQRLLSTD---------------------------YS----SHWNHLIAK
ES--------------------------------------ALPVPRNARRHGELS-LPSN
RLIKLIDKTVRNRISSIRDTGNHSYN--TCLQLW--------------------------
------------------------------------------------F------STRPR
SSLQL-L
>gi|5454197|gb|AAD43612.1|AC005698_11	   103 residues, 50 /line  T3P18.11 [Arabidopsis thaliana]
------------------------------------------------------------
----------------------------MGIQFVMF------------------------
------------EIHSKWVGTV--------------------------------------
-----LAGRVKLPSQDNMIE----------------------------------------
DITIWAA--LAKGLWKSR---------------------------YT----TSCPQILAH
VSA----------------PDQ-DRLEGFLLRYVFQATVYTVWRER--------------
-----MDDDISNHRTHRL------------------------------------------
------------------------------------------------------------
------N
>gi|15221947|ref|NP_175893.1|	   137 residues, 50 /line  unknown protein [Arabidopsis thaliana]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------MMKWIGGATGTCVLCDNNIETRDHLF-----------FSC-PF
VSEIWAV--IAKGIFKDK---------------------------YS----TDWSQLLDH
VSN----------------ANQ-TQLESFLSRSAFQATVYTIWGERNGRRHGEEP-HSTT
LLTTWIDKHIRNKISTIRRMGDRRYD--EAYQAW--------------------------
------------------------------------------------L------ISR-T
-------
>gi|89274225|gb|ABD65629.1|	   147 residues, 50 /line  hypothetical protein 23.t00046 [Brassica oleracea]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------MQGRLSTGDRMRGWNMNVDTSCVLCQEPLETADHLF-----------FKC-PY
STQIWEA--LMKGVMESR---------------------------FT----MEWERIITF
LRE----------------SSNWSKVKLFVSRYILQSTVHAIWMERNRRKHNELP-SPSV
VLIKRLDKNMRNRLTILQRRGDKELA--EGMTFW--------------------------
------------------------------------------------F------GSR--
-------
>gi|15218634|ref|NP_174704.1|	   157 residues, 50 /line  unknown protein [Arabidopsis thaliana]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------MADGKNVVKG--------------------
------------------------------------------------------------
--L----------------AAR-NRNITLILKLIFPASLYFIWRERNQRLHSATS-RPTT
SIIKEIKMIVRTRLDPLSRAQRSTPPALTLLATWL------GFIGFTLCLDLPLAAGAAS
SCFGPRPCLFLFQRRRKDKVSSRIIYSDQLIFYNVIEAGLAPVTIVDWF------CPL-R
-------
>gi|8778252|gb|AAF79261.1|AC023279_10	   142 residues, 50 /line  F12K21.23 [Arabidopsis thaliana]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------MADGKNVVKG--------------------
------------------------------------------------------------
--L----------------AAR-NRNITLILKLIFPASLYFIWRERNQRLHSATS-RPTT
SIIKEIKMIVRTRLDPLSRAQRSTPPALTLLATCCCFFCRLGFIGFTLCLDLPLAAGAAS
SCFGPRPCLFLFQ-----------VCVPLLGIYHICYVFLVK-----------------I
-------
>gi|22328361|ref|NP_680600.1|	   138 residues, 50 /line  unknown protein [Arabidopsis thaliana]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------MRRWGLSIPSDCVLCSGNAEFREHLF-----------FGC-GV
SFAVWGN--FMFRASLTP---------------------------PL----L-FMDCLTW
VLS----------------PSR-DPNISLIIKLVFQASIYFLWKERNRRLHDHAS-RSST
AIIKEIKVILTAKLDPLSRRSEFDAPDNSLLSTW--------------------------
------------------------------------------------F------RYF-N
-------
>gi|9755378|gb|AAF98185.1|AC000107_8	   86 residues, 50 /line  F17F8.11 [Arabidopsis thaliana]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------MI-KSIESFIARYVFQATLYTIWCERNGRRHGEREAEPAA
LLIKLIDKQ---AIFPQS------------------------------------------
---------------------------EQLMIYAMTRASKSGLHRVVEIKPSIVHVFN-L
-------
>gi|15239791|ref|NP_199720.1|	   116 residues, 50 /line  unknown protein [Arabidopsis thaliana]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------------MQKMCDASWNDETTSS-----------SFC-AY
TSEIWEA--LAKNILKRS---------------------------YT----TDWHNLIIS
VSD----------------QRH-NTIEGFLARSVLQALVYTIWRERNVRRHGESP-KPAA
RFIQWINKHIRNTFSVIKRMRDKKYD----------------------------------
------------------------------------------------------------
-------
>gi|15226989|ref|NP_178356.1|	   211 residues, 50 /line  unknown protein [Arabidopsis thaliana]
------------------------------------------------------------
--------------MEMQ--------MEIGIGYNADP-----------------------
-ILERNKEI-DLE-----------------ATATWLHLNPIGERVDWFKAIWFKGKIPKH
AFIAWVNMRHRLHTKDRMISWGFIFPPLCLFCNTHDETRQHLF-----------FDC-EF
AREVWIY--FTSRVHVFP---------------------------PL----L-FEDGIRW
LKN----------------PCQ-DKNVTTILRLSHHASVYTIWKERNARLHDSAS-RPAA
ALILEIKSVIRCHLDPLSRAQRLGPNRISFLATW--------------------------
------------------------------------------------F------GLF-D
-------
>gi|22331328|ref|NP_683592.1|	   153 residues, 50 /line  unknown protein [Arabidopsis thaliana]
----------M-------------------------------------------------
------------RNVMFP--------YEIG---NRNP-----------------------
-IIQML------------------------------------------------------
----------------------NNCLPVSNVVNLQDDAEDDLF-----------L-W-KF
AREVWNY--FTSRAHVSP---------------------------PH----L-FGDGVRW
LKN----------------PCH-DKNVTMILRIAHQASVYTLWKERNSRLNNATS-RPAA
GIILEIKALIRCHLDPLSRAQRLGHQGTSFLATW--------------------------
------------------------------------------------F------GMFNA
-------
>gi|9802599|gb|AAF99801.1|AC012463_18	   165 residues, 50 /line  T2E6.13 [Arabidopsis thaliana]
------------------------------------------------------------
------------------------------------------------------------
-----MKPC-CEA-----------------CCFSLCHMEKM-------KPCW--------
-----------LSTGDRMQFWNNGSDVKCTFCSTSIETRDHLF-----------FSC-SY
ASSIWTA--IAKNVLQHR---------------------------FS----TDWQAIVNY
ISE----------------TQT-DRIRSFLSRYIFQLTVHTVWKERNDRRHGEEP-RTSA
NLISWMDKQIRNQLSIIISTGDRRYE--NGLQVW--------------------------
------------------------------------------------F------STR-L
-------
>gi|79348531|ref|NP_173555.2|	   152 residues, 50 /line  unknown protein [Arabidopsis thaliana]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--MTWLAVRNRLSTGDRMLQWNMGVNSCCVFCHAPVETRNHLF-----------FAC-QY
SADVWTG--LSRKLLSQR---------------------------FS----TDWDMIIKL
ITD----------------TSL-GKGCLFLVRYTFQLTVHSIWKERNGHRHGEAP-IPSS
QLTRRLDKQTRNRISSIRELGDRRYED-YGDLVW--------------------------
------------------------------------------------L------KI--T
-------
>gi|15219641|ref|NP_174790.1|	   236 residues, 50 /line  unknown protein [Arabidopsis thaliana]
---MEEPLRQE-------------------------------------------------
------------SPTTFHAKTSDRGQIDLGISKHKTVAEAWEGYRQRRHRSTHLQAIETA
LLQQRNDRT-EDEDIVLWKGKNDVYKPQFLTKETLNHMRTISMDVDWYKGVWFGHSTPKY
SFCVWLAVLNRLSTGDRMTHWNGGQSAACVLCHNAPETRDHLF-----------FSC-DF
ASIVWSN--LARGIYGDR---------------------------FS----THWQDLIQA
ISG----------------SWM-TPLDSFFARYLFQATVHTIWRERNGRNHGEKP-NSAA
LLIK--------------------------------------------------------
------------------------------------------------------------
-------
>gi|116830551|gb|ABK28233.1|	   103 residues, 50 /line  unknown [Arabidopsis thaliana]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------MLKWNKNVGTSCLLCNYPLETREHLF-----------FQC-PY
SRTVWSE--LAGRLLASK---------------------------YT----DNWLDIMKE
LVS----------------KDL-DATTRIVLRYVFQNTIHSIWRERNERRH---------
--------------GETRHRGRRRG-----------------------------------
------------------------------------------------------------
-------
>gi|15229111|ref|NP_190497.1|	   176 residues, 50 /line  unknown protein [Arabidopsis thaliana]
---------------------------------MDVE-----------------------
------------EDAEVSGTSKDVPQGGSEEWGHN-------------------------
-----------------------------FLLETWLQIRSTRPEMQDYKAIWFSDATPK-
---------------ERMLKWNKNVGTSCLLCNYPLETREHLF-----------FQC-PY
SRTVWSE--LAGRLLASK---------------------------YT----DNWLDIMKE
LVS----------------KDL-DATTRIVLRTEKIIR----LIDKNIRNR---------
-------------LSTLRVRGEEKYP--RGIQVW--------------------------
------------------------------------------------F------ASRQD
QNQG---
>gi|15217619|ref|NP_174632.1|	   210 residues, 50 /line  unknown protein [Arabidopsis thaliana]
------------------------------------------------------------
----------------MGSFSIDLPTLSGELDVYD-------------------------
------------------WVVEDKLCNGFSSAKTWAALRPRSDVVSWAKTVWFKGATPKH
AFHMWVTNLDRLPTKTRLASWGMQLQTTCGLCSLDIEDRDHLF-----------LTC-EF
ACFLWHT--VSVRLELPA---------------------------FS---FVVWNDLMDW
TLQ----------------RN--RRSPPTLRKLIVQSVLYAIWKQRNNFLHNHET-ILPS
VVFKTIDREIKNSITARRLK--KRFR--RLMTLW--------------------------
------------------------------------------------L------H----
-------
>gi|15222880|ref|NP_175429.1|	   91 residues, 50 /line  unknown protein [Arabidopsis thaliana]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------MQKTERVIAISQTEESDFNCV-----------LLC-MF
A-----------------------------------------------------------
---------------------------SFIRKLAAQSTIYNLWKQRNNVVHNQVS-IPAP
TIFKLIDREIRNIITARRKR--KRYR--NLMQIW--------------------------
------------------------------------------------L------T----
-------
>gi|79325061|ref|NP_001031615.1|	   146 residues, 50 /line  unknown protein [Arabidopsis thaliana]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---MWISNLDRLPTRARLVSWGLQISPLCCLCSQSVETRDHLI-----------LTC-GF
SSSIWNM--VQARLRLQP---------------------------VQ---FRVWESLLSW
IKL----------------ST--ASSPSIIRKLVAQATVCAIWKQRNNLLHNLQD-ILPS
IIFKNIDREIINSINARCHR--RKFR--SLMRLW--------------------------
------------------------------------------------I------R----
-------
>gi|15236296|ref|NP_193083.1|	   256 residues, 50 /line  unknown protein [Arabidopsis thaliana]
--MMMEVLVARGGCDHGDGNDVVVVMVVMVAVVVVVTARWWLWLWLRLASYDGCDDGDGG
CGGTSFWYDNWCSLGSLYEVLGARGCIDMGISSSWSVADVLRSHVRRRHRTATLNSIEDE
IDALR-QRHDPTCDIPLWKCCNGSFKHKF-------------------------------
-----------------------------------------------------------F
SRDTWYEIPLTRDMLGSR---------------------------YT----TRWDSLVDL
STS----------------SAL-TQIHMFVFRYVFQLTTHSLWKERNGRRHGESP-IPAP
SLAKMIDKNMRNRLSTLATSGSPIYK--SGLRYW--------------------------
------------------------------------------------F------STHCR
-------
>gi|22328367|ref|NP_680602.1|	   219 residues, 50 /line  unknown protein [Arabidopsis thaliana]
---MDL------------------------------------------------------
-----------------------------------------KEKNRRIQ-----------
------IHGTETEDKVLWRGKSDVFRTTFSTRDTWHHTRSTSARVPWHKVIWFSHATPKY
SFCSWLAAHGRLPTGDRMINWANGTATDCIFCQGTLETRDHLF-----------FTC-SF
TSAIWVD--LARGIFKTQ---------------------------YT----SHWQSIIEA
ITN----------------SQH-HRVEWFLRRYVFQATIYIVWRERNGRRHGEPP-NTAS
QLVGWIDKQIRNQLSSICFKGDKRYD--GSLQVW--------------------------
------------------------------------------------F------QSR-S
-------
>gi|9759131|dbj|BAB09616.1|	   184 residues, 50 /line  unnamed protein product [Arabidopsis thaliana]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------MVNINSGSWIWKSICKLRPMAREFVVCKVGSG-----ITC-NF
WSENWTN--LGPLIHLTGDLGPRVSGLPRNASVADALRDGVWWINGS----RSRNPIIQL
LKNCLPLSSVVNLQV----DA-EDDLFMWKVGGTHQATVYTLWRERNTRLHTSSS-RPAA
GLIMEIKNLIRTHLDPLSRAQRIGPNGLSYLATW--------------------------
------------------------------------------------F------GLF-I
-------
>gi|15226569|ref|NP_179162.1|	   90 residues, 50 /line  unknown protein [Arabidopsis thaliana]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------------------------------------------MKE
LAG----------------KNL-GVTTRFVLRYVFQNTIHSIWRERNERRHGEKP-SRTE
KIVKLIDKNIRNRLSTIRVRGEEKYA--QGTQMR--------------------------
------------------------------------------------F------ASRQY
QIDRTFL
>gi|22327496|ref|NP_680373.1|	   245 residues, 50 /line  unknown protein [Arabidopsis thaliana]
------------------------------------------------------------
----------------------------MAIPLERKLCKVMNRTRSSHHRRDFLNQVEEE
LRKKRQHRLETEPDAALWKGKNDCYRKQFSSRETWSQIRLPKAERNGHKVIWFSGATPRY
TFISWLVMKNRVATGERMVNWKLNVDTSCVFCKHPLETREHLF-----------FQC-PF
SKEVWEK--LVRGILLHK---------------------------FS----DKWLEVMKE
ITS----------------KSH-DNTKRFILKFVFENAIHFIWTERNDRRHGERP-STTE
KMVKLIDKNVRNRLSTLKQGKVEKHV--EGLQVW--------------------------
------------------------------------------------F------ASR--
-------
>gi|15226571|ref|NP_179163.1|	   185 residues, 50 /line  unknown protein [Arabidopsis thaliana]
-----------MSNQNKPQPP-KPLMKQQSLPPDINREE---------------------
------------------------------------------------------------
------------------------------------------------------------
---AWLRMKKKHPSA------RLHRSKSCVTNDDIEELRGCFDLGFGFEPDSLDFNP-SL
SKTI--------------------PALD---------LYSAIHRQYSNHLSRTWSSTSER
DVNSSTTT-IVNKVMS---EEWHFCN--IIVKRLFQLMFLYLTVSQVRRRHGEAP-YSAV
RLIDGIDKQIRNRFATIRVTGDQC------------------------------------
------------------------------------------------------------
-------
>gi|4538991|emb|CAB39612.1|	   186 residues, 50 /line  hypothetical protein [Arabidopsis thaliana]
QSQTRDNRLVQFSQFNKPIEPLRIESEYRTLIEMTKKEE---------------------
------------------------------------------------------------
------------------------------------------------------------
---EHVVES--------------------------------LNLPDVAGKPSTKVGPMGS
REDV--------------------SGMG---------DRGVTVVSEPDP----DKCGVKK
ALTVGVTVMVRNEDVGIYNDKITFREMIVGIIYAFQRGVYNIRRERNCRKNRETP-KPQL
QLLQNLDKHVGNRIFSIREQGYRRFD--RCMETW--------------------------
------------------------------------------------F------ASK--
-------
>gi|7487943|pir||T01450	   80 residues, 50 /line  limonene cyclase homolog F24O1.12 - Arabidopsis thaliana
-----------MLNKNPK------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------RKQFDLGPKICDECFIHSIWNERNQRRHGKSP-SLPE
RLIKMIDKNVRNRLSTMSGCGVLKYK--DEMRVW--------------------------
------------------------------------------------F------ASRA-
-------

Ad blocker interference detected!


Wikia is a free-to-use site that makes money from advertising. We have a modified experience for viewers using ad blockers

Wikia is not accessible if you’ve made further modifications. Remove the custom ad blocker rule(s) and the page will load as expected.