Fandom

Proteins Wiki

At2g03420.1/MSA

< At2g03420.1

47,923pages on
this wiki
Add New Page
Talk0 Share
>gi|18395549|ref|NP_565301.1|	   170 residues, 50 /line  unknown protein [Arabidopsis thaliana]
-MMQTKISSFSRP-------SFSLYEPRVIHHPRISMALSSSAPSPFHH---LLCKSTFP
LAASLTLLLSPCTAEAGLMSGSPGIESVPGPELPKIEFLDRF--NAKNQKFYAENDARFK
DSPLLKKLLENSKLNKEKNEREIQDKYCLRGAEWGVGDCSTTGMTDEEKEKFITMLKKKT
GVE--
>gi|147815436|emb|CAN63830.1|	   177 residues, 50 /line  hypothetical protein [Vitis vinifera]
-MVSSLLSPLSDTVLHSSPPKITVSEKPTIPQKKTQLGFTKK-PSWTSP---LLQK-SIP
LAASVAILLWSNPANAGFLSGFSGIESVPGPELPQVDFLNKF--NEENQKKYAEFDERFK
SSPLLKELLERSKLNQEKNRKEIQDKYCIRGAEWGVGDCSVEGMSPADKDNFIATLKQKL
GDGAK
>gi|108706799|gb|ABF94594.1|	   170 residues, 50 /line  expressed protein [Oryza sativa (japonica cultivar-group)]
-MLGLRGLVAASP----------VTAPRCRGRCSAATAATSAPEKTAGHVGRLPLAIVPA
AAASLSLVLWSSPVHAGIMSGFKGMESVPGPDLPRVEFLEKW--NAENQKKYAEFDSRFK
SSQVLKDLLEKSKQNKLKNEREIQDKYCLRGAEWGVGDCSTEGMSDQEKEDFIAELKKRT
GQE--
>gi|115451485|ref|NP_001049343.1|	   124 residues, 50 /line  Os03g0210700 [Oryza sativa (japonica cultivar-group)]
MLASCQGSKGWNR----------FQAQICHEWSSWKNGMVS---KLATTLLYICMYVCMP
YLSRISIAESSCNVPANCHF------CCDMNSLIKKNFLLIWCSQAENQKKYAEFDSRFK
SSQVLKDLLEKSKQNKLK---------------------------------------YPN
FR---

Ad blocker interference detected!


Wikia is a free-to-use site that makes money from advertising. We have a modified experience for viewers using ad blockers

Wikia is not accessible if you’ve made further modifications. Remove the custom ad blocker rule(s) and the page will load as expected.