Fandom

Proteins Wiki

At2g03390.1/PDB

< At2g03390.1

47,922pages on
this wiki
Add New Page
Talk0 Share
&&&&&&&&&&&&&&&&&&&& BEGIN  /usr/local/www/html/proteins/Compiled_Programs/WYRM/PyMOL_highlight_conserved_residues &&&&&&&&&&&&&&&&&&&&

Successfully read 2 file paths from WYRM_file_paths.txt

generic_input                                         /usr/local/www/html/proteins/workspace/
generic_output                                        /usr/local/www/html/proteins/htdocs/results/

======================================================

Sequence file type = 3

Sequence type = 3

Got here 1
Got here 2
Got here 3
Sequence 1
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Sequence 2
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Got here 3
Got here 4
Read 2 amino_acid sequences from PIR Sequence file /usr/local/www/html/proteins/workspace/At2g03390-1vbvA0.pir.txt

======================================================

Assigned types to 330 residues in Sequence 2-03390, 0 remain unknown
Assigned types to 77 residues in Sequence 1vbvA0, 253 remain unknown

======================================================

Successfully read 576 entries for residue match scoring matrix /usr/local/www/html/proteins/workspace/BLOSUM62.dat

Read the residue match scoring matrix /usr/local/www/html/proteins/workspace/BLOSUM62.dat

======================================================

Translated sequence file At2g03390-1vbvA0.pir.txt into sequence alignment.

======================================================

>1VBV.pdb  Made from 603 ATOM records in 1VBV.pdb
ASKFGIGQQVRHSLLGYLGVVVDIDPVAAPWYHVVMEDDNGLPVHTYLAE
AQLSSELQDEHPEQPSMDELAQTIRKQ

======================================================

Best alignment:
1VBV.pdb     4  FGIGQQVRHSLLGYLGVVVDIDPVAA    29
                F +GQ++RH   GY  VV  +DP+ +
2-03390    206  FRLGQKLRHKTFGYRAVVCGMDPICS   231

======================================================

Highlighted IDENTICAL residue PHE    6  index1    4  path  206  %Seq 100.00
Highlighted IDENTICAL residue GLY    9  index1    7  path  209  %Seq 100.00
Highlighted IDENTICAL residue GLN   10  index1    8  path  210  %Seq 100.00
Highlighted IDENTICAL residue ARG   13  index1   11  path  213  %Seq 100.00
Highlighted IDENTICAL residue HIS   14  index1   12  path  214  %Seq 100.00
Highlighted IDENTICAL residue GLY   18  index1   16  path  218  %Seq 100.00
Highlighted IDENTICAL residue TYR   19  index1   17  path  219  %Seq 100.00
Highlighted IDENTICAL residue VAL   22  index1   20  path  222  %Seq 100.00
Highlighted IDENTICAL residue VAL   23  index1   21  path  223  %Seq 100.00
Highlighted IDENTICAL residue ASP   27  index1   25  path  227  %Seq 100.00
Highlighted IDENTICAL residue PRO   28  index1   26  path  228  %Seq 100.00
Highlighted IDENTICAL residue ALA   49  index1   29  path  231  %Seq  50.00
Highlighted 12 residues for visualization

Wrote PyMOL macro into file /usr/local/www/html/proteins/htdocs/results/At2g03390-1vbvA0.pir.txt.1VBV.pdb.conservation.pml

===============================================================================

The program

/usr/local/www/html/proteins/Compiled_Programs/WYRM/PyMOL_highlight_conserved_residues At2g03390-1vbvA0.pir.txt PIR amino_acid 1VBV.pdb _ 100.0 BLOSUM62.dat 

completed successfully.

@@@@@@@@@@@@@@@@@@@@ END  /usr/local/www/html/proteins/Compiled_Programs/WYRM/PyMOL_highlight_conserved_residues @@@@@@@@@@@@@@@@@@@@

Ad blocker interference detected!


Wikia is a free-to-use site that makes money from advertising. We have a modified experience for viewers using ad blockers

Wikia is not accessible if you’ve made further modifications. Remove the custom ad blocker rule(s) and the page will load as expected.