Fandom

Proteins Wiki

At2g03390.1/MSA

< At2g03390.1

47,923pages on
this wiki
Add New Page
Talk0 Share
>gi|42568906|ref|NP_178438.2|	   330 residues, 50 /line  uvrB/uvrC motif-containing protein [Arabidopsis thaliana]
-------------------------------MVQSQSLSTLTICGSVKVSS---------
--------------------------------------------LLRNRLNSVK------
-ASSLIGDRCVSCQFL-------------------RKSPSFRSHWKS----LKQRNLLR-
---------------------------------------------VEARWPFQGGGEQGL
DP--------------------------------SSERSESANEDILIFFFQLDLATRVQ
YAMN---------------------------------------------------LEQYD
IAQQLREKLTEV---------------------EEESIRLQEGKRGSSAKSEAQ------
-----DKGISIIRLRADLQNAIDSEDYG--------------------------------
--------LAAKLRDEIS-----------KLEA--ESLAVSAKA-LAFEKAEYAFRLGQK
LRHKTFGYRAVVCGMDPICSESSSWMEAAEV-EKLPRGSNQPFYQVLVDVRTHPDL--LV
AYVAEDNLLAPEKPDKERFD------HPYI----SFLYYG-------ADTAGD--FIPVK
QLREK-------------------------------------------------------
-----------------------------------------------------------Y
NRP---------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------------------------------------------RHEV
PFDSQDE--------------------D------
>gi|109098902|ref|XP_001082474.1|	   477 residues, 50 /line  PREDICTED: similar to F-box only protein 21 isoform 2 isoform 1 [Macaca mulatta]
------------------------------------------------------------
------------MKHYSPTDYVN--------WLEEYKVRQKAGLEARKIVASFSKRFFSE
---HVPCNGFSDIENLEGPEIFFEDELVCILNMEGRKALTWKYYAKKILYYLRQQKILNN
LKAFLQQPDDYESYLEGAVYIDQYCNPLSDISLKDIQAQIDSIVELVCKTLRGINSRHPS
LAFKAGESSMIMEIELQSQVLDAMNYVLYDQLKFKGNRMDYYNALNLYMHQVLIRRTGIP
ISMSLLYLTIARQLGVPLEPVNFPSHFLL-RWCQ------GAEG----------------
---------------------------------------------------EGI------
-----DQSYQLLRDSLDLYLAMYPDQVQLLLLQARLYFHLGIWPEKVLDILQHI---QTL
DPGQHGA-VGYLVQHTLE-----------HIERKKEEVGVEVKLRSDEKHRDVCYSIGLI
MKHKRYGYNCVIYGWDPTCMMGHEWIRNMNV-HSLPHGHHQPFYNVLVE-----DG--SC
RYAAQENLEYNVEP--QEIS------HPDV----GR-YFS-------EFTGTH--YIPNA
ELEIR-------------------------------------------------------
-----------------------------------------------------------Y
PED---------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------------------------------------------LEFV
YETVQNIYSAKKEN----------------ID-E
>gi|109497446|ref|XP_001080075.1|	   368 residues, 50 /line  PREDICTED: similar to F-box only protein 21 [Rattus norvegicus]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------MEIELQSQVLDAINYVLYDQLKFKGNRMDYYNALNLYMHQVLTRRTGIP
ISMSLLYLTIARQLGVPLEPVNFPSHFLL-RWCQ------GAEGATL-DIFDYIYIDAFG
KGKQLTVKECEYLIGQHVTAA-----LYGVVNVKKVLQRMVGNLLSLGKR-EGI------
-----DQSYQLLRDSLDLYLAMYPDQVQLLLLQARLYFHLGIWPEKVLDILQHI---QTL
DPGQHGA-VGYLVQHTLE-----------HIERKKEEVGVEVKLRSEEKHRDVCYSIGLV
MKHKRYGYNCVIYGWDPTCMMGHEWIRNMNV-HSLPHGHHQPFYNVLVE-----DG--SC
RYAAQENLEYNVEP--QEIS------HPDV----GR-YFS-------EFTGTH--YIPNA
ELEIR-------------------------------------------------------
-----------------------------------------------------------Y
PED---------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------------------------------------------LEFV
YETVQNIYSAKEDT----------------A--E
>gi|125849130|ref|XP_696130.2|	   480 residues, 50 /line  PREDICTED: similar to mKIAA0875 protein, partial [Danio rerio]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------KSLTLKYYAKKILYFFRQQNILRN
LKVFLERPPEQQSALEGAVLVDQYCNPLTDVTFESISAQVEEITDKVKKCLRAQNAAHPS
LRAGQGECFVLEDFEFQRQVICAVNTVLYEQLQYKGNERDYYNPLNSYIHQVLLRRTGIP
ISLSVLYMTLARKLGVPLEPVNFPNHFLL-RWCQ------NQRRCG--DIYDYIYIDAFG
NGKQLAAKECEILIKHQATAD-----YYSAISTSELLLRMVGNLLNIGMRGEGN------
-----EKSYQLLRDSLDLYLSINPDNVQYLLLQARLYFHLGIWPEKVLDILQHI---QAL
DPSQHGA-VGYLVQHTLE-----------HIQHKRHPVEPEVKRRSAPEHRDVQFSTGLI
MKHKRSGYNCVIYGWDPKCTMSQEWINTMRV-HQLSKGADQPFYNVLVQ-----DG--TC
RYAAQENLEPHSAP--LEIA------HPEI----GR-YFN-------EFSETH--YISNE
ELQAR-------------------------------------------------------
-----------------------------------------------------------Y
PED---------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------------------------------------------MCKT
NRTVEELYHSLTPNSGQSPEPTANFQDHDLLD-P
>gi|47221488|emb|CAG08150.1|	   427 residues, 50 /line  unnamed protein product [Tetraodon nigroviridis]
--------LTDLPTELLEHILCF-------PVLQHIDICNVSCC--CKRLHDVCHGRGKV
WGNQYKLRWPRLQRFYRPNESWD--------WLSEYRARHKVGTQIRRTVESISKRFFTE
VVSQVLGDSFAEIESLGMPEHFCEDELLFILNSDKRKNLTLKYYAKKILYFLRQQNILRS
LKSFLERPAEQQSALEGVTSE---------------------------------------
------------------------------------------------------------
------------------------------------------------DIFDFVYIDAFG
KGKQLTAKECEYLIGHQVTAD-----YYSAISTNELLLRMVGNLLNIGKRGEGN------
-----EKSYQLLRDSLDLYLTINPDNVQYLLLQARLYFHLGIMARKV-------------
-------------QHTLE-----------HIQHKKHPAAPEVKLRSSPEHAEVQYSVGLI
MKHKRSGYNCVIYGWDPKCTMNQEWITTMRV-NLLPNGPQQPFYNVLVQ-----DG--TC
RYAAQENLEPHSAP--MEIG------HPEV----GR-YFS-------EFANSH--YAANE
ELQAR-------------------------------------------------------
-----------------------------------------------------------Y
PED---------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------------------------------------------TGVT
LGTVRRLYH-------------------------
>gi|115475007|ref|NP_001061100.1|	   334 residues, 50 /line  Os08g0172200 [Oryza sativa (japonica cultivar-group)]
-------------------------------------MQGIFACGSISSAHGSCFRPACL
AVDDL---------------------------------------RLFYKINSVT------
-CGAYSWRWCVKKLHM-------------------RTN--------R----RQMGTTVR-
---------------------------------------------TNARWLFGGDGRSSS
NA--------------------------------RMERSESANEDILIFYFQLDLQTRIQ
YALN---------------------------------------------------IEQFD
VAKQLREKLTEI---------------------ETVIIRQREAKRGSS-KTEAQ------
-----DKAINLLRVRADLQKAVDSENYA--------------------------------
--------LAAALRDEIA-----------KLET--ESLAVSAKA-LAYQNVKYAFRLGQK
VRHKVHGYRAVICGMDHVCCESKSWMETANV-ENLSKGPNQPFYQVLVDVYADPEL--LV
AYVAEENLAEAEIPEKGRFD------HPYI----EFLFFG-------EDTAGD--FIPIK
QLREK-------------------------------------------------------
-----------------------------------------------------------Y
DQP---------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------------------------------------------RYEA
SGDEDDD--------------------DGSTD-S
>gi|125527819|gb|EAY75933.1|	   275 residues, 50 /line  hypothetical protein OsI_003780 [Oryza sativa (indica cultivar-group)]
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------------------------MGTTVR-
---------------------------------------------TNAKWLFGGDDRSSS
NA--------------------------------RLERSESANEDILIFYFQLDLQTRIQ
YALN---------------------------------------------------IEQFD
VAKQLREKLTEI---------------------ETEIIRQREAKRGSS-KTEAQ------
-----DKAINLLRVRADLQKAVDSENYA--------------------------------
--------LAAALRDEIA-----------KLET--ESLAVSAKA-LAYQNVEYAFRLGQK
VRHKVHGYRAVICGMDPVCCESKSWMETANV-ENLSKGPNQPFYQVLVDVYADPEL--LV
AYVAEENLAEAEISEKGRFD------HPYI----EFLFFG-------EDTAGD--FIPIK
QLREK-------------------------------------------------------
-----------------------------------------------------------Y
DQP---------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------------------------------------------RYEA
SGDEDDD--------------------DGSTD-S
>gi|22136040|gb|AAM91602.1|	   138 residues, 50 /line  unknown protein [Arabidopsis thaliana]
------------------------------------------------------------
------------------------------------------------------------
---MYYLSACLTLVYI-------------------H------------------------
------------------------------------------------------------
------------------------------------------NEELMLVSF---------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----RLGYRAVVCGMDPICSESSSWMEAAEV-EKLPRGSNQPFYQVLVDVRTHPDL--LV
AYVAEDNLLAPEKPDKERFD------HPYI----SFLYYG-------ADTAGD--FIPVK
QLREK-------------------------------------------------------
-----------------------------------------------------------Y
NRP---------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------------------------------------------RHEV
PFDSQDE--------------------D------
>gi|4335759|gb|AAD17436.1|	   131 residues, 50 /line  unknown protein [Arabidopsis thaliana]
-------------------------------MVQSQSLSTLTICGSVKVSS---------
--------------------------------------------LLRNRLNSVK------
-ASSLIGDRCVSCQFL-------------------RKSPSFRSHWKS----LKQRNLLR-
---------------------------------------------VEARWPFQGGGEQGL
DP--------------------------------SSERSESANEDILIFFFQLDLATRVQ
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------------------------VKTKC-RVF------------
-----ISFKMVANGFD--------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-VL---------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------------------------------------------QY--
----------------------------------
>gi|116509905|gb|EAU92800.1|	   345 residues, 50 /line  predicted protein [Coprinopsis cinerea okayama7#130]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
MSLIHVFVSLCRQIGIQAYPINFPGTIIA-YVP-----------TG--SDSPPLIVNLWT
GNAENAVMNNRPEWQSDAAFP-----FPVFPGPNDAILRPCTNPVPMLKRSSYNILN---
-----SIQVDPTIDSHDRQAAIMAVLYVGLVLTDDTFVYRNLSNLPLVDCLILY---RNL
LPKLNDEHQAAFNEHCVK-----------AIQQEESKIAALDAPKRRASSSRPKYFVGMA
MNHLKYNYRGVIFGWTPKCEAPEEWIENMDV-DSLAGGRSQPFYHVFSVNELNPRSLLNT
YYVAEENIKPRSLD--AELGEILLNHIPDL----PR-YFGKVEFPRGKEGFGR--FVPSP
EMSLE-------------------------------------------------------
-----------------------------------------------------------Y
PDE---------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------------------------------------------IAYG
QEWARK-WKEENRLSG----------QLGSSDAV
>gi|115403031|ref|XP_001217592.1|	   491 residues, 50 /line  conserved hypothetical protein [Aspergillus terreus NIH2624]
MTCPISLLALSIRIEKFRTIIAYGYDIKDALLQNTQADSSVD-----DYLARSYYAKELL
NCLHRSIAVSEWAKIRNGET-VPLDRALGAFDLFVPESGYGSLDEISNTLEGIARK----
----------------------------FLMHHPDIHRLTCRAKAKAIAAYLKANDL-TG
IKNGREYDTLQHNFL-GIALKDP-------------------------------------
------------------------------------------------------EHNSLP
LISAAIYCYVAQKFGLDAHPCGFPFHVHV-IVKPPIGFDIDGNALGPGIESVPIYMDPFR
SDAETHVASLQHQLNFLGLSVAEQSPYLNESWTPEIVIRCSTNIMSQLRRLSEGASAHMS
VENILSAKYAALWSAILLLGPSRPAEFSHYMPLF-MELYAKEFPSDTYLIERHI---A--
-PLFHGTLE---HAHILE---------CLHVMRAVDEMPKQVK-RRNPGHMSVKYRVGQV
FRHRRYNYVGIIIGWDTECDAGEQWMRRMGV-DRLAGGRHQSFYHVLVEDRS-------V
RYVAEENIWP-TAP--RLADM-----PRDLLETAGK-HFK-------RWDEEN--HVFIS
NVKDE-------------------------------------------------------
-----------------------------------------------------------Y
PDD---------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------
>gi|67904144|ref|XP_682328.1|	   477 residues, 50 /line  hypothetical protein AN9059.2 [Aspergillus nidulans FGSC A4]
-------MSQTGRIEKFRSIVSFGYDAKDTLLRNISIDSSAE-----DYLARRYYARALL
TSLHRTIAIPAWASLRDGNE-ISLANALGAFDLFIPESGFGNFDEISARLNQIL------
-SG-------------------------CLLEFPDIQNLSPRRKASAIAAYLRSHNM---
------------------------------------------------------------
-----------------TGIGPGREYHCLE-----------HNFLGIALNDP--AHNSLP
LISAAIYCHVAQMLGLDARPCGFPFHVHV-IVIPPSGFDIDGNPITT--QGEPIYMDPFR
SDQETPASDLRTQLNFLGASPIEQVAFMGESETSEIVLRCSKNILNSIQRRNQSSSI---
--DAVCARYAALWSSLLLSNHLRPAELQHHLLWL-MELVATDFPCDIHLVERYI---A--
-SLFRGTPE---VEHILE---------SLHVIRAVDMIPKQVKR-RSFEHKSVKYHIGQV
FRHRRYNYTAIITGWDAECGAGEQWMRRMGI-DHLQSGRHQSFYHVIVEDKS-------V
RYVAEENIQLISPT--VSEL------SPTLVAVAGK-YFK-------RWDSSS--REFVS
NIKDE-------------------------------------------------------
-----------------------------------------------------------Y
PDD---------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------
>gi|114798382|ref|YP_760504.1|	   150 residues, 50 /line  hemimethylated DNA binding domain protein [Hyphomonas neptunium ATCC 15444]
------------------------------------------------------------
-------MTSRRGRTA--------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------WLKDIFRKRVRPAEADPLLL------TDAVDTRYFY------------
---------------------------------------------NAISRHEARFQIGQV
VRHKLFPFRGVIFDVDPQFANTDEWYDSIPE--EVRPRKDQPFYHLFAENDR--TH--YI
AYVSEQNLIPDDSD--VPLS------HPDI----SD-WFT-------MNGSGT--YELKK
EATN--------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------
>gi|114704736|ref|ZP_01437644.1|	   143 residues, 50 /line  hypothetical protein FP2506_07366 [Fulvimarina pelagi HTCC2506]
------------------------------------------------------------
-------MSGRKAGTASAPKCVRFLRAGPELG----------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------YCGRRNGV--------EFSMQTARFFIGQI
VKHRVYPFRGVIFDVDPVFDNTEEWYEAIPA--EVRPRKDQPFYHLFAENAE--TE--YV
AYCSEQNLVPDESG--QPVR------HPQI----RE-MFD-------GPFEGA--YKLKA
PIHN--------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------
>gi|13470730|ref|NP_102299.1|	   174 residues, 50 /line  hypothetical protein mlr0512 [Mesorhizobium loti MAFF303099]
------------------------------MVLQHSQAAYEN-------------PCGGS
SDL-ADFIATSRHQSKPLRRILRSLKALKRFGIE--------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------------------------------------------------LTRSL---R--
------------------------------QIKSRNSV--------VSTMKTAKFAIGQV
VRHRLFPFRGIIFDVDPQFANTDEWYEAIPA--DVRPRKDQPFYHLLAENSE--TE--YI
AYVSEQNLLEDRSG--EPVR------HPQI----KE-MFD-------KRPDGR--YEPKR
QSRH--------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------
>gi|148556791|ref|YP_001264373.1|	   130 residues, 50 /line  hemimethylated DNA binding protein [Sphingomonas wittichii RW1]
------------------------------------------------------------
-------------------MIEKSVSIPAAAGAL--------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------------------------------------------------HQG--------
------------------------------------II--------SPSISHARFSIGDV
VRHRMFEFRGVVFDVDPVFANSEEWYQAIPE--DMRPAKEQPFYHLFAENSD--SS--YI
AYVSQQNLVHDESD--ELVD------HPAI----AG-LFD-------SYADGR--YQLRR
EHRQ--------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------
>gi|50744786|ref|XP_419873.1|	   239 residues, 50 /line  PREDICTED: hypothetical protein [Gallus gallus]
-------------------------------MPRISIAAALQ-------------ICALL
AALPAQYYISQWYGTDPAQR-LQMTKRLFACGSSLKKS-YLSLDLWADRLK---------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------LWLSEARQDEWSKSERAKLVN------IIEEERRNWYYGEKKI---K--
-SANNEAEN---HS----------------YFAASPHV-------HSPKPESIQFSVGQV
IVHKRFGYSGVIVGWDVKAKAPEEWLQHKYP-PEKQDVKDTPHYRILINNASGFGK--ST
AYVPEEEIKT-TVG--LQVH------HPDV----KV-YFC-------GYDGSK--YILQP
WLRDI-------------------------------------------------------
-----------------------------------------------------------Y
PHD---------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------
>gi|118596562|dbj|BAF37938.1|	   226 residues, 50 /line  Similar to Tetraodon protein product CAG00085 [Oncorhynchus mykiss]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----MPQLTVATILQLTLLLSALPAQYLISRWT---------------------------
-----------------------GASVAQRYHATKRLLGMWG------------------
-------------------------------EWRKSYLNTTVWTEWIADLMDRI---TML
VGGEEE-GEVPGESPALEVMLQDNDLGFF---GASRSV-------RRPRPPFVFLRVGDV
VMERNGHMIGVIVSWDPELRAPPEWMSRLH-PNEEVNAENTPHYKVLFSGPGPSSL--LV
GYLPQTRLERVTGT---RPE------IPTL----EQ-YFT-------HFDGER--FIMQP
WLQEI-------------------------------------------------------
-----------------------------------------------------------F
PED---------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------
>gi|47222651|emb|CAG00085.1|	   145 residues, 50 /line  unnamed protein product [Tetraodon nigroviridis]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------------------MIFDNDQGFF---GASKAV-------RSPRPPFVFLRVGEV
VMETKGHMVGVVVSWDPELRAPQEWIDRVYSISEGPKAENTPHYKVLFSGPGQSSV--II
GYLPQTQLERISGM---RPD------IPTL----EN-YFT-------HYDGER--FVMQP
WLREL-------------------------------------------------------
-----------------------------------------------------------F
PED---------------------------------------------------------
------------------------------------------------------------
--------AVEDDEPFPW------------------------------------------
------------------------------------------------------------
----------------------------------
>gi|39581485|emb|CAE68015.1|	   487 residues, 50 /line  Hypothetical protein CBG13628 [Caenorhabditis briggsae]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------------------------------LT
MKKDSD-AEA-AESKAMEDETNPDGNGAY---GMGRYL-------RQ-RAPEVEFRVGDV
VYHKKLGFRGLIIGWDELAIAPEKFLKVAHGDNKASHFATQPNYAILIDTRDRFTP--QM
SYVVQENIQLDKGT----IW------HPLV----EK-FFD-------GFDEKRLKFFSAK
MIPRCLATRFYSNSAQKPRKKVDCAVYGCGLSASGALAIPKLIQNSTDDVTASEAKYPKR
ITYFNTKSIKNVTSGFGFSLFASENRLYGAGINNRFQIGGQLTDPSKFQDYYISAKKINI
PAEEILEISSGRAHSLIRTEKGVFAIGDNNFGQCGRDPTVLEHIVGSDDSPLQPLTPPTS
NPIVSIHCSLDTSFIVDSEGKVFSFGLGEDGQCGNESYGIQWNPSSVKGDLEGVRIQKIA
GSTDTVMALSDEGEAFVWGQTEYGQAVGATDQIQLNVSRHLNLSSTIGPISSIATTQSSV
IAQNKNGEVFVWGVGVLGMGPEAEVLKRPTRMDQPLFDGKKV------------------
----------------------------------
>gi|71992585|ref|NP_001021670.1|	   200 residues, 50 /line  Temporarily Assigned Gene name family member (tag-229) [Caenorhabditis elegans]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------MEIKPELIFIGILILVPAQWLLSPSE---------------------------
-----------------------TGHLKYR------------------------------
-------------------------------------------MNSLIFTLKQYIPSFMT
SSSDSE-AEA-AESSAIMAEMNPEGNGAY---GMGQYT-------RH-RAPHVEFRVGDV
ITHTKLNFRGVIIGWDEHAIAPEKFLKVAHGENK--NYATQPNYAVLIDTRDRLTP--QL
SYIVQENLEIDKGT----VM------HPLV----DK-FFD-------GFDEKRQKYIMRP
LYKQW-------------------------------------------------------
-----------------------------------------------------------Y
PDD---------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------
>gi|7509185|pir||T26319	   522 residues, 50 /line  hypothetical protein W09G3.3 - Caenorhabditis elegans
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------------------------------MT
SSSDSE-AEA-AESSAIMAEMNPEGNGAY---GMGQYT-------RH-RAPHVEFRVGDV
ITHTKLNFRGVIIGWDEHAIAPEKFLKVAHGENK--NYATQPNYAVLIDTRDRLTP--QL
SYIVQENLEIDKGT----VM------HPLV----DK-FFD-------GFDEKRQKLVTSK
MISRWQTTRFLSNSAGKTRKNVDCAVYGCGLSASGALAIPKLVANS-DDVTAGEARFPKR
IAYFNTKSIKFISSGFGFSLFASKNRLYGAGINNRFQIGGQLTNINKYQDYYISAKKINI
PGDEILEISSGRAHSLIRTNLGVFAIGDNNFGQCGRNPENMDYVVGSEESPLLPLSFPTS
EPIISIHCSMDTSFVVDSSGAVFSFGLNEDGQCGNEAYGIQWEPAKVRGDVEGSKIQKVS
GSTDTLLACSENGEIFIWGQTEYGQAAGATDEIQLNTSRH--VANSLGPIICVDSTQSSV
VARNSRGNVFVWGVGVLGMGPEAESLKTPTQMDQPLFDGKMVIYENFHVEIRTQRPLLSL
FMWKLDRF-------RENLNFCAFWRRFG-----
>gi|89360906|ref|ZP_01198723.1|	   179 residues, 50 /line  Hemimethylated DNA-binding region [Xanthobacter autotrophicus Py2]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------------MGSHDKARAKPATGAPAPDG---------------------------
-----------------------TS-----------------------------------
-----------------------------------------------IASAPEADAMTQD
AKAGAP-AGA-AEGKSIAA--APEGAAALPLSGAAADF-------HS-TMREGKFRIGEV
VRHKHFPFRGVVFDVDPVFDNTEEWWLSIPEE--IRPHKDQPFYHLLAENAD--SE--YV
AYVSEQNLERDFSE--EPVR------HPKV----NE-ALT-------DDGAGG--WRVRR
DLIN--------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------

Ad blocker interference detected!


Wikia is a free-to-use site that makes money from advertising. We have a modified experience for viewers using ad blockers

Wikia is not accessible if you’ve made further modifications. Remove the custom ad blocker rule(s) and the page will load as expected.