Fandom

Proteins Wiki

At2g03140.1/MSA

< At2g03140.1

47,922pages on
this wiki
Add New Page
Talk0 Share
>gi|15227541|ref|NP_178413.1|	   1805 residues, 50 /line  CAAX amino terminal protease family protein [Arabidopsis thaliana]
--MYSSSSSSSIF---------LQFP-------PARITTASPFILRRS------------
----------RKRGARFKRQSRNLVLVNSSIFPPP--------FDGSVPL----------
----------------DSSLAPSLAGIASGLAVYLSSRFFGKSLEKISDKIVD-------
------------------------------DVVVGEWILFTTPTP-----FNRFVLLRCS
LLSFDDDS--EKSLSDRLVTEERHFVTL-DSGKIVRDGAV---TDEKTPLEYQRVCITME
D---GGVVSLDWPANLDI------------------------------------------
------REER--G-LDTTVVFIPGTPEGSMEEGVRSFVCEALRR----------GVFPVV
MNPRGC-AGSP---LTTPRLFTAGDSDDISTALRF--------LSK------TRP---W-
-TTLTAVGRGYGANMLTKYLAEA------------------G-ER----TPLTAAVCIDN
PFDLEEITRT----SPYSTSLDQQLTRGLVEILLAN----KELFQGRAK-----------
---A---F-------------------DVGKALCSKS-VREFDKALS--------MVT--
-------YGCE-SIEDFYSSCA-TREVIGEVKVPLLFIQ--NDDVVPP---Y--------
----TIP--RS---SIAENPFTSLLLCSS-SPNLIDGRT-------VAVSW-CQDLAKID
FPMLAMQWLTAVELGLLKGRHPLLEDVDVTVNPSKGLVFSEARAPEK-SIGAKKLVQAAH
EKTVNGYHLDPFRETLEDSDMTPNSNLSPETDLEKNVKIDYGSDETENNIVSTRVESIED
NESNVEESDRGQVLQTAEVVVSMLDVTMPGTLKAEEKKKVMDAVGRGETVLTALQDAVPE
DVREKLTTAVTGILQSGGTKLNLENLK---LPSIAPGLKKAEEEKKETSSAIGQSDSYSP
DPKDKSDGLVSGSDETISGSDNSPGGVELEHSPSKVSQRNSDSGKSQPVDNDQDDSPGNH
ESHTNEKTSAADDSEMASEAKSDSANQGPIGAEAVTNNDDKVEQGSGVATHQGQVETSKN
-DEKGAPIANEKS-----SVADGFEKASDAKNDSTNPQPVGADDITSDGDKVDQGVVLAQ
QQRKDETSKSDENAKQSA---TDQNKVTSTDNEGDAGKSSASQPVEKDESNDQSKETKVM
QPVSDQTKPA--IQEPNQPNFNVSQAFEALTGMDDSTQVAVNSVFGVLENMISQLDEEKK
EGNEVSDEKNLKDEKNLKDAKNVTNEVVSPS----------EEEIPYKRETKSLMPSAKS
RDPACSVSETEKCSDNDKVTGV----VIEKQLGRDEFVIGKHSPKILPERKTDSIENSSH
DGYLGEELSKEKIAKQLDLDTTTALMLDYYPEEGKWKLLDQQPKRLDDDYYPEEGKWKLL
DQQPEYLGNVADNAAASRNTHDNVQVHSLSVDNEETIEPSYVIVDHEQELELSGMHDAAD
NQNDGPHKLDEGC--EELEHLINVIVSDSLNVEIQRRMGSAGMRQIESQLSRDIKKVAKT
FSYAVVYSEPTWTFKRNSKTSNVPAGKVGKLRGDAIIRAIASAVQEAHFLRQVLPIGVVV
GSVLAALRKYFDVST--TTNNAKRDVVPG-----------RRQKYENNGAMASVLPD---
--KVSKETKQNNSS---------IGEMVESGLQSI---NNKSAMVGAVTAALGASAMLVQ
HEDPQRGGIMSKS-----SDKDSQQK-ESGQL-DQSSMVGSFAEKAMSIAGPAVPTKETG
EVDQDRIVAMLADLGQRGGILSLVGKLALLWGGLRGAMSLTDRLIQFLHMDEWPLLKRAV
GFIGMVLVLWSPVVIPLLPTLLQNWSTSNPSRVAELASVVGLYVAVFILVMLWGKRVRKY
ENPFKQYGLDLKASNKEKIQEFLKAFAGGITVVLLIQFINAISGAAFLSRPPYFPHSFDA
MKWLKGCGQFLLLIIRGFTAATFVVLVEELLFRSWMPAEIAIDLGYHQSIIITGLIFALF
QRSLRSIPGFWLLSLALTWARERSQGNLIVPIGLRAGIIASSFILQSGGFLTYNP----S
SPVWIAGSRPSQPFSGVVG--LMVSLALALILYPKRSPETKMQKYN
>gi|68380126|ref|XP_689131.1|	   456 residues, 50 /line  PREDICTED: hypothetical protein [Danio rerio]
------------------MAILWPVAKCFGAASH---------------------YTLLL
PRRDSKRPAERCDSKLE--------------EKGESA-----------------------
------------------------------------------------------------
-----------------------------------AVALICKPSAL-----ANYLLKHCM
TFCKS--------------LSIPSWNW-RVSSSLQTVFGALWP--VECPVHFIRDHLQLS
D---DGLVALDWAVVGAAHH------------KR--------------------------
-------RRTSSNSTSPVLLIIPNSFGRITRNVLK-LCEAALS------H----GYLPVI
FNRRSQ-NGTP---LSTIRLQQFGDPTDLREAVRY--------IRY------RQP---A-
-GQIYAVSESTGSGLLLSYLGECG-------------------SSS----YVTAAACLSP
IFR---CQSWFESG-PSW-PFHWALLLYQKICLSRY----KTVLGELVHID---------
------------------------------SVFSSCS-LKEMEEALFCHF-SSKGVPV--
-------EGTG-SWEAYWERND-PLRDIDEVAIPVLCVCSQDDPIRGDP-RT--------
----TLP--FE---LFENNPHFFLLLTA-CGGHCGFSTSDEG-----PVVWS-HQAL---
-----LEFFRAT------------------------------------------------
-------------TDFFAAEERAKLAARRRGLSGAGKTFRHRSVSTCKRLPVCSHN----
------------------------------------------------------------
------------------------------------------------------------
--------------------I---------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------HAIYNWQRSYTR
>gi|68468959|ref|XP_721538.1|	   425 residues, 50 /line  alcohol acyl transferase [Candida albicans SC5314]
--------------------------------------------------------MGIL
GWGFRSNIKIHQSGDEG--------------SATLSLKDKGTIKF---------------
------------------------------------------------------------
---------------------------------------------------SQFIKQDLP
ILDES--------------QKLWLNPL-LFNGTLQTLYYTSMDSSNKFLIYYGRELFTYS
D---GGICSLDWVIPKPEDE------------QKFETIRKETLPEGFPRLQPRCRYFTNE
EL--AELHQEDSTSEKPIVVIIHGLGGGSHESLIRDFAETIEKKT----S----GWGVVV
INSRGC-GRTK---LTSGKLFNAGSTNDIREVLQD--------FKK------RWP---N-
-RPIYLVGFSFGGALTANFLGEEG-------------------EKENSESLVKAACTVGC
PWDFVDGAYHLQKSWTGKYLLSPALAKFLAKIVTNN----YKELETYAP---DIVNK---
--------------------------ETLKVIKNCKT-LWEFDNNVT--------CKT--
-------TPYK-DAFEYYQELS-PVKKLSQIKTPLLALNSTDDPAVGV------------
----KLP--IS---QMKANPYFCLVETD-LGGHLGYVQSN-------GEFWC-VELV---
-----EQFFQKF------------------------------------------------
-------------EELV-------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------------------------------K
>gi|71016919|ref|XP_758940.1|	   696 residues, 50 /line  hypothetical protein UM02793.1 [Ustilago maydis 521]
---MSSFLS--------S-------TATLLTRTI---------------------LSPVA
PPS-----LFAVNVEYY--------------KSTSSSPNTASSRSSPS------------
------------------------------------------------------------
-----------------------------IESLLS------------------ATQTLDP
AKK----------------PTFKPTPW-LSSGHLQTIYSAVANFSQIDAVEYQRRVFLTP
D---GGTIGLDISPPSLAPS------------EQ------------------------DL
KT--QAH---PAADGLPTVVCLHGLTGGSHESYVRNCFSHLTKPTSQGGL----GYRAIV
INFRGC-ANVP---VTSPQLYSALKIADVRSALLL--------ITK------LYP---S-
-SPLVGIGFSLGANVLGCYLGEEG-------------------DNT----PLLGGVIVGT
PFDLKAGADQLDYGGFLSQKYSVAMGNNLRRMACKH----KDTLALHPPFRALLDDLYDA
PPQPKAELELYKQQVKNGGPL-----QNQRVIIKRGS-LKAADQTLT--------RFVGG
LPKPYGEFPFE-SADDYYINGG-CADRVSNVQRPMLCLSAEDDPIVPSQ-IWQKIRAAIA
RNPDGTP--LEADAHAEFNENVVLAWTK-AGGHLGWFEGIR------PKRWL-YRPT---
-----SEFIKAL------------------------------------------------
-------------FDQTSEEQQARLRAKSRWAEAQVEA-REVLVELMPKEALPVYT----
------------------------------------------------------------
------------------------------------------------------------
--------------------LPGQGGRSSRWTDTELAPSKSDSQRSNPSGSDTPSRLAEL
DRDLQSDKLGAEDSL---------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------LNPSDTGFSANAPPTSSDTQVNDGQ
HSTLRLAWLLTHVLKEAPLVHPRHAIYAPYNEPQSSDA----------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------------------------DQRKRLGWQKVTLTMYT------------------
----------------------------------------------------DRQHPEVG
FAELGPETRVAGAGETFRGGIDVPGASMEPKQAGVHASANNVIAGL
>gi|71655623|ref|XP_816372.1|	   414 residues, 50 /line  hypothetical protein [Trypanosoma cruzi strain CL Brener]
------------------MFLIFARVSFWVLH-V---------------------VVHVI
YIDIPRLQ--------R--------------AFKLMTEEKRTEKIEEK------------
------------------------------------------------------------
-----------------------------I-------DFLSAGTNTR----CFFSFESF-
-------------------ADFCYTSP-PYNGHISTLLCAFR--PPK-PIKYTRQVVDSV
D---GNPICLDWFLAEEK------------------------------------------
-----------NSPANGVMIIFPGLASWSQTNYVQHYVWHAHD------R----GFHCCV
FNARGM-GDTP---LTRPRLMSASWTGDLRWVTRT--------ELSRTALSLRFG---AT
AQNVWGVGFSLGGVVLAKYLHEEG-------------------QNMTKEFPFDAALIINS
PLDTLAVSANMMQP-ENA-LYQKNLVGGLIRYAIRH----KDMLKQLPGVNDDGIRK---
--------------------------DPLRFLKRLRT-VNEFDAHIT--------APH--
-------NGFS-NPEEYYAAVN-TLTSLRHCTIPTLCVIARDDPVTGEP-PR--------
----KEM--RE---LVTANSLVAFLELP-YGGHLGYIGSP-------VEEWR-GDPS---
-----FMELLTC------------------------------------------------
-----------------NICQA--------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------------SQGRG
>gi|72389304|ref|XP_844947.1|	   426 residues, 50 /line  hypothetical protein, conserved [Trypanosoma brucei TREU927]
------------------MTSLKEKVLFLLLH-T---------------------LIHIL
VIHFWNVV--------R--------------TLVDGIFGKRRRRSRGV------------
------------------------------------------------------------
-----------------------------I-------EVVAHGNTSK----VFFSLDKV-
-------------------EKLFYLSP-PYDGRINTVLCALR--PNW-PISYTREVVNGV
D---DNPICLDWLIADTS------------------------------------------
-----------ERDARGILIIVPGLASWSQTNYIQRCVLLAHR------Y----GIHCCV
FNCKGL-GDTP---LTTPRMISASWTGDLHKTFST--------ALSREALSRKFG---TA
ANNIWGAGFSLGGVIMSKFLKECALQ---------------GVKSQ----PLDAALIINS
PLDMEETSRTLNEP-QNA-MYQRKMISNVIQFVTKH----IDVLKNVKEINLKEHDN---
--------------------------DILKFMKSLRS-LQEFDVHIN--------TPH--
-------NGFA-TVKDFYDAVN-VFTSLRHCNIPVLCLVAEDDPVIGSL-PS--------
----NAF--DD---VASCNKLVAFVKFP-YGGHLGFCRSP-------MEEWN-GEPS---
-----VMEMFIC------------------------------------------------
-----------------DLISSHKHM----------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------E---------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------EMKEPTEGICLY
>gi|74193400|dbj|BAE20655.1|	   459 residues, 50 /line  unnamed protein product [Mus musculus]
-------------------MPPWAAALALLLA-A---------------------LALLL
LRPWKRAVGARTSVRDH--------------EEQEVASGGPADQFSDR------------
------------------------------------------------------------
-----------------------------REALPGGCSLICKPSALA----QCLLRALRR
SAA----------------LEPSPRSW-LSGPHLQTFCHFIL--PVGPGPELAREYLQLA
D---DGLVALDWVIGPCARG------------RR--------------------------
-----VT---NPGSHPPVLLVIPNAWGRLTRN-VLGLCLLALE------R----GYYPVI
FHRRGH-HGCP---LVSPRLQPFGDPSDLKEAVTY--------IRF------RHP---A-
-APLFAVSEGSGSALLLSYLGECG-------------------SSS----YVTGAACISP
---VLRCREWFEAG-LPWP-YERGFLLHQKISLSRY----ASALEDTVDTG---------
------------------------------KLFRSGS-LREFEETLF--------CHT--
-------KSCPISWDTYWDLND-PLRDVDEAAVPVLCICSADDPVCGPP-EH--------
----TLP--AE---LFHSNPYFFLLLSH-HGGHCGFLRPE-P-----LPAWS-HEVI---
-----LESFRAL------------------------------------------------
-------------TEFFRMEERMKGLSRRR--TSFLGG-RRRWGGLQKREVSPSSN----
------------------------------------------------------------
------------------------------------------------------------
--------------------L---------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------EEIFNWKRSYTR
>gi|74732703|sp|Q96SE0|ABHD1_HUMAN	   405 residues, 50 /line  Abhydrolase domain-containing protein 1 (Lung alpha/beta hydrolase 1)
--MLSSFLS--------PQNGTWADTFSLLLALA---------------------VALYL
GYYWACVLQRP-------------------------------------------------
------------------------------------------------------------
-------------------------------------RLVAGPQFLA------FLEPHCS
ITT----------------ETFYPTLW-CFEGRLQSIFQVLL--QSQPLVLYQSDILQTP
D---GGQLLLDWAKQPDSSQ------------D---------------------------
----------PDPTTQPIVLLLPGITGSSQETYVLHLVNQALR------D----GYQAVV
FNNRGC-RGEE---LRTHRAFCASNTEDLETVVNH--------IKH------RYP---Q-
-APLLAVGISFGGILVLNHLAQAR-------------------QAA----GLVAALTLSA
CWDSFETTRSLETP-LNSLLFNQPLTAGLCQLVERN----RKVIEKVVDID---------
------------------------------FVLQART-IRQFDERYT--------SVA--
-------FGYQ-DCVTYYKAAS-PRTKIDAIRIPVLYLSAADDPFS--P-VC--------
----ALP--IQ---AAQHSPYVALLITA-RGGHIGFLEGLLP-----WQHWYMSRLL---
-----HQYAKAI------------------------------------------------
-------------FQDP---EGLPDLRAL----------------------LPSED----
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------------------------------------------RNS
>gi|111070230|gb|EAT91350.1|	   406 residues, 50 /line  hypothetical protein SNOG_01701 [Phaeosphaeria nodorum SN15]
--------------------------------------------------------MFDL
SWILGHGKT-FYTHHP--------------------------------------------
--------------------SPVPLTTKSA-Q----------------------------
-------------------------------------THPAMRS-T----PPLNAPP---
-------------------------------NHVHSAPTPDPS--DHSTSASISI---QT
TPCNPGTYAVDFVVTKEEGE-------------------AATKD---ASLPERTANFTSA
EW--DDMNSK--D-TTPMIIALHGLSGGSHEVYLRETLAPLTAS----G------WAACV
VNGRGC-ALSK---VTTPQLFNARATWDVRQTIAH--------LRE------LYP---N-
-RPLYAVGFSLGANILTNYVGEE------------------G-DK----CMLRAAVACSN
PWNLDVCNVELQRTWVGLEIYARTMGANLKKLFVLH----REQILKNEG-----------
---V---D--------------------EDKVMGSRY-LFEFDRHVQ--------CPT--
-------WGYP-TEGAYYRDSE-SVDALLGIS--------------SK---A--------
----AIP--FE---EFKQNPYAVLCTTN-WGGHLGSFQL-------GGGRW-FATAA---
-----SSFLAKV------------------------------------------------
-------------HEEIDHEASQ------T------------------------------
-------------------------------------KIQETKIDTPGK-----------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------K-------------------------------------------
------------------------------------------------------------
--------YP--------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------------------------------------IYDP-------------------
------------------------------------------------------NNRRLI
LPD---------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------------------------------A
>gi|115386260|ref|XP_001209671.1|	   436 residues, 50 /line  conserved hypothetical protein [Aspergillus terreus NIH2624]
---MAAGDSSGLL---------DLFPVSILLS--------------GL-F-----VMGFL
SWMRPTGRVSFYNAKD--------------------------------------------
--------------------NSLRLTKKIG-K----------------------------
-------------------------------------SGSKEQT-T----LADLCRSATP
T-------------------KCQLNPFL-FNGHLQTAWTTMKF--DNVPVYYKRRVLQAN
TPMLTGHFAVDFVTEPYEVPQ---------DGPRTDPERKYTQP---SGLPERTAFFTEE
EF--AALPSD--D-TKPMLVVLHGLSGGSHELYLRHVLHPLIAD----G-----TWEACV
VNSRGC-AQTN---ISSGVLYNARATWDVRQAVQW--------LRQ------MFP---N-
-RPLFGIGFSLGANILANYLGEE------------------G-DK----CLLKSAVLVAS
PWNLEVSSANLQSTSIG-LAYSRVMGSSMKRLFEAH----VDAVSKNPR-----------
---I---N--------------------VEEVRSITY-LHEFDRAVQ--------CAS--
-------WGYP-TEGAYYRDAA-SIDTMLNIRIPFFVVQAEDDPIASA---N--------
----ALP--WQ---EIKQNPYGVMMTTS-WGGHLGWFEL-------GGDRW-FVKPV---
-----SSPLFIG------------------------------------------------
-------------HEAV-------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------------------
>gi|116206658|ref|XP_001229138.1|	   401 residues, 50 /line  hypothetical protein CHGG_02622 [Chaetomium globosum CBS 148.51]
-----------------------------------------------------------M
DW-FGRAKIA-FTHSP--------------------------------------------
--------------------SPLALQRKDG-T----------------------------
-------------------------------------A-----T-D----LLKVCEASTP
T--------------------CQLNPLL-FNGHLQTMWTAVKE--HGPPIYYRRKIFDAD
HKTYTGTFTVDFAVDPHA-----------------------DVD---EALPPRTAFFSED
DF--AKIGSD--D-SRPMLIVLHGLSGGSHEIYLRHAIAPLVMN----GG----NWDVCV
VNARGC-ANSK---VTSGLLFNARATWDVRQFVKW--------AKQ------TFP---N-
-RPLFGLGFSLGANILTNYVGEE------------------G-AN----CLLKGAISVAN
PFDLEIANKALQRTLLGKQVYSRVMG----------------------------------
-------N--------------------YDRIQNVTWSLTIWP---R--------TVT--
-------WGYP-TENAYYRDAS-STDAILAIRIPFLAISALDDPIAVY---D--------
----AIP--FQ---EFAHNPYTVLATTS-LGGHISWFKI-------GGGRW-HARPI---
-----CEFLNRM------------------------------------------------
-------------VTEIDLDAIN------P------------------------------
-------------------------------------NANGAHSKTQFV-----------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------T--------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------------------------------------EFDP-------------------
------------------------------------------------------VRRKLQ
ILS---------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------------------------------N
>gi|116505665|gb|EAU88560.1|	   450 residues, 50 /line  hypothetical protein CC1G_04266 [Coprinopsis cinerea okayama7#130]
---MGAVLSTNLK---------ASS-----------------------------------
-SGSESNSVI--HFPD--------------------------------------------
--------------------QPTLLPVKNG-D----------------------------
-------------------------------------EEEVQHV-P----LRTLIETHCP
SLFR----------------PFKPLWYL-FKCTLYCVFGDFS---KHDRMGYLRRYIKTA
D---GGTIGLDFAP----------------------------------------------
-V--DQGSVP--D-DAPVIVVQHGLTGGSYEPYVRAVLSRACKPVSEGGL----GYRAVV
INFRGC-AGVP---ITSPLLYSAGHTDDTRHALAY--------IAH------KYP---K-
-AHRHGLGFSLGSNVLTRYLGEE------------------R-EA----TRLHSTCALAC
PWNLKANNHGLLNSFLGKHVYSKGMGGNLLNLLKKH----AKSLTADPS-----------
---H---YVAIA---------------ALNALQLKNPTLEMFDECFTRIAGG--PAPH--
-------FPFK-NSEEYYIWGS-SDHIVEHITVPFLAINADDDPVVRH------------
-----VP--MD----GKGNGKVVMQLTK-GGGHLGWFEAGDG----RVERW-TTQPV---
-----LEWLKVM------------------------------------------------
-------------GKVVHEHHHS------S------------------------------
---------------------------------------PKLYIDGEGW-----------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------LCEEGRDHIR----------------------------------
------------------------------------------------------------
CKEL--EECH--------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------------------------------------VVNG-------------------
------------------------------------------------------NGGETG
ILQG--------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------------------------------L
>gi|118362510|ref|XP_001014482.1|	   493 residues, 50 /line  hypothetical protein TTHERM_00523040 [Tetrahymena thermophila SB210]
---MSKKDLKDIN---------WQSQISELEQQQQQQNSFDSMIPSIQ-K-----LLIWL
IYITGFGMV-IFPYFALTLDPKFSIHFWILTGIDFGLFVALLNFKRFVVSGNTLQQNDEI
DDKKQDVVSNESLLAFGLGAAIVYPQINSN-F----------------------------
-------------------------------------ELYYSDT-K----LNQFIKNKCN
EIKKG---------------YFLPTPYL-GYGILQAIFGSKSQF-RHEKINYEKKYIDFG
D---YGELRYDVAK------------------------------------------LQDE
TIVPIEKREK--N-KNNCLVILLGITASSQEPYVENMTAEALKE----------GYTVVL
YNDRLY-NNYEDKGRIFPREGYYSIEVDFEKTLSQ--------IQK------DFS---G-
-YNFYAVGHSFGANTLVKYLGSH------------------K-NN----NPFKGAVSVGN
PFDIKQAFATLRPTF------DKYLVESRQTVLKMR----QSLLQNPPP-----------
---H---INI-----------------NLEKALKAVN-TTEFDEHFS--------KHL--
-------YGHK-SIFDYYEDLS-CINQLKNVKIPLLCLNSKDDPCIHH---S--------
----TIP--FN---ISEINQNVMLLVTK-CGGHVGWFEGIF-----TPKRW-YMKPT---
-----LEFLNAL------------------------------------------------
-------------TDYSCSQL---------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------------------
>gi|118378164|ref|XP_001022258.1|	   827 residues, 50 /line  hypothetical protein TTHERM_00500990 [Tetrahymena thermophila SB210]
-----------------------------------------------------------M
DTKFEKQR-LHHFRKQ--------------------------------------------
--------------------ESLKIKPKNYKI----------------------------
-------------------------------------ELKYVEN-E----INQQRVSKLT
LLTEN---------------KYSPSPMM-AHSFMQSLYNIRYS--RTLKVNYSRELIKLE
D---GGQFSLDWALPINSI-----------------------------------------
--TDEEYEPS--P-ETKILFVIHGLTGGSNMNYIKAMIQHAQQN----------GYRCVA
FNSRGI--NTE---LSTPVPFNGECLKDLNLALNT--------VKQ------RYP---N-
-APIFAVGASYGSNMLLRWAGNM------------------K-EN----NFLTAMAGLAT
PYSIVQCVDKMGYVYEG--FFVDRYKAN---CIDPH----KDILKQLKE-----------
---S---HNI-----------------CLKRLAKTKK-LREFHEEIT--------IKL--
-------FGYK-SVEEYFNSSNVQPEQIKNISRPCLLMHSKDDPIVTY---D--------
----CVP--SD---VLIQNPQIIQAETT-HGAHVCWYTGKTP-----QRVE-LSKFQ---
-----FNQLQIF-----------------------------------QISKNNNHKQKNF
IK---------EVNKMRQQESES------F------------------------------
-------------------------------------KQAKVSINSDQNL----------
------------------------------------------QNQYENL-----------
-----------------------------EQEQGIKQKLLLQEEQPPQQI--VIQKD---
------------------------------------------------------------
------------------------------------------------------------
---------------IQQPAAAPKQRLECLDIYRG---LTMVGMILV--DNMGNSSVIWP
LD------------------------------ETEWNGLSTADCVFPSFLFISGM-----
-----------------------------------------AITLAIKHNGNKKQQFFRI
LERFVKLFVIGVALNAACANYKQQFRIMGV------------------------------
------------------------------------------------------------
LQRI--AICYFVTSTSYLF------------------------LQN---FAVQ-------
------------------------------------------------------------
-----------------------------------------------------FVLNGVF
LLIYIYFMYFFDVPDGCGANNVTPTCNFGRYLDMQIFT----------------------
-----------LNYMMKPSDPEGLFTTL-----------------GALVTTFIGLCYGLA
LQEFKS-------QKKRLSCIWFVMSLVLVFIGGICCFLTP-------------------
------------------------------------------------------INKKVW
SPSFV-------------------FIVGSMSGAFLNLCFIVVDI----------------
--------YNN--LKLNKALEFLKWLG--------LNPLFVFVAMIWL-EL---------
---------IMLLNIHFY--------VDGTRYSLWNFISEYVFLGAYINSYVASLAVSIF
H--------------------------LLLWIGISYYLYNRKVFIK--------------
---------------------------------------------L
>gi|118400039|ref|XP_001032343.1|	   730 residues, 50 /line  conserved hypothetical protein [Tetrahymena thermophila SB210]
---MFSRIAQSYK---------TPS-----------------------------------
---------SYAQFRSGKFKKKMLYGFLIYCGLEF------------------YSRADIN
TDLKFKGIMNED------------------------------------------------
---------------------------------------------------NIAAIKNCK
SLRQG---------------KYFPTSYL-PNNFLMAVYGAKFD--PAPYVPYEREYIKTK
D---GGQLGLDWVPVQ--------------------------------------------
----SKFSND--E-ERRILIIFHGLTGGSDCNYIKQGALIAQNY----------GFRTVC
VNMRGY--NSK---LSSPQMTDFTKNDDILEIIQS--------IQA------KYP---K-
-ANLYGLGISMGANYMLKMAGEL------------------K-EK----CLLKSMVSVSN
PWDLVKCNEEMNKWY--KKIYNYNIAANFKRNLKQN----LELFENKEK-----------
---E---LGVDLSRINFLCQLFILINQLKEKALETND-TFEFHDAFT--------TKL--
-------CGYN-DVLKMYEQSS-CKDVVQNITVPTLCIQSNNDPICVQ---D--------
----CVP--TD---KFSKNPNLLLVQTQ-KGSHIDYFTTYKC-----HRVA-FIILT---
-----SLYKEEE-----------------------------------RPKGFQ-DMVK--
GP---------SY-----YLYDQ------H------------------------------
-------------------------------------QNGFESIKQN-DI----------
------------------------------------------KRRNEAI-----------
-----------------------------QRDERTFFVDMLMDRKGIDDL--LIKRY---
------------------------------------------------------------
------------------------------------------------------------
---------------MNDP---KKNKIFSTKDNEP---IGQMKIIKVNQNSLNNSQVKEG
IS------------------------------LIDTRKINQSSIKRVNTSQVQSY-----
-----------------------------------------LKQLEYKNRGISIKQSLKL
VPNCTSL-IAGVIYSSPQKYQQFPTNMISS------------------------------
------------------------------------------------------------
SQSLDQQINYFQNNVNQRS------------------------TQT---IKTE-------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------TN----------------------
-----------LSPKLLFDGPNPHENIV-----------------FDVSTPFVGKQSRLA
NNNTKN-------NVFND------------------------------------------
----------------------------------------------------------EF
DEFKD-------------------FVIEDEVSKRNSQLYESFDQ----------------
--------QNS--QEKSFKNESIKKVQ--------QTQSYLFYCSKQL-E----------
------------------------------------------------------------
----------------------------------NWYEYQIQKLC---------------
---------------------------------------------I
>gi|118778868|ref|XP_308926.3|	   432 residues, 50 /line  ENSANGP00000013379 [Anopheles gambiae str. PEST]
---MLSFLYTYLT---------NLP-----------------------------------
---------------RWHLVAIVLVGYLIYYLMEV------------------VK-----
------------------------------RP----------------------------
-------------------------------------ILAVSNG-P----FKKYLRKHIP
TLE-N---------------KFWPTFWC-VESRAQTVFASIIRSNIMPLVEYRREVFTLK
D---GGEVALDWL-----------------------------------------------
-----ETGCD--P-ESPVIIILPGLTGESQAEYIKCLVTAANRI----------GIRTVV
FTNRGL-GGVA---LKTPRLYCASNCEDLSEVVKH--------VKQ------SNP---H-
-VRIGATGISMGGLILGNYLARH------------------S-DEAK--SILTAAKIISV
PWDVHKGCASIEQPIL-NNLLGRHLASSLCRTVSKY----DILRGEEFE-----------
---W-----------------------DMNQVLQSKT-IKQFDSAFT--------SKH--
-------FGYK-DVDSYYTDAT-LHNKLHQIKVPLLCLSAADDPFQPL---D--------
----AIP--IK---AAAGSSHVAILITA-RGGHIGFLEGWWPA---NKDQY-MGRLF---
-----SQYFSAA-----------------------------------LFDPDNEFYRTAQ
LM---------MEH----------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------------------------------------NLTA-------------------
------------------------------------------------------STSVPG
SPTNK-------------------SALGAASAI---------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------------RKKSIP--------------
---------------------------------------------F
>gi|119196673|ref|XP_001248940.1|	   454 residues, 50 /line  hypothetical protein CIMG_02711 [Coccidioides immitis RS]
--------------------------------------------------------MGLL
SWMLPSGRVA-FHHAP--------------------------------------------
--------------------KSVLLPRKNP-G----------------------------
-------------------------------------PDDSKYI-S----LSELCQAATP
S-------------------ICQLNPLL-FNGHLQTAWTVVKNDD--VPVYYKRWRFEAN
NPNYSGTFEVDFVVDQYDAA----------------ALSQVEEN---RDLPSRTTFFTEK
EF--AALPSE--D-TKPMLVLLHGLSGGSHELYLRHVVAPLLET----------GWEACV
LNFRGC-AQSK---VTSSILYNARATWDVRQLVRW--------LRE------KFP---N-
-RPLFGIGFSLGANILTNYLGEE------------------A-EK----CQLKAAVICSN
PWNLEIGSLALQRTWLGLEVYSKVMGANMKRLFERH----VDAVEKHPR-----------
---V---N--------------------VERVRNIKY-LHEFDRELQ--------APV--
-------WGYP-TETAYYRDAS-SIDSLFAIKIPFFAIQAEDDPISVK---E--------
----ALP--YL---EIQQTPYGVMCTTT-WGGHLSWFEA-------GGSRW-FTKPV---
-----TGFLNKL------------------------------------------------
-------------ATEIDLESPLKVEDTTP------------------------------
-------------------------------------AAQRIPANPAGE-----------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------LYGPTPN------------------------------------
--------------------------------------FQP-------------------
------------------------------------------------------MRRKCK
MP----------------------------------------------------------
------------------------------------------------------------
---------------------------------LVNEDD---------------------
------------------------------------------------------------
---------------------------------------------E
>gi|125552452|gb|EAY98161.1|	   581 residues, 50 /line  hypothetical protein OsI_019394 [Oryza sativa (indica cultivar-group)]
---MGNAAAGDSA---------AELLLRAAALVPPAH-----------------------
----------------YALAALLLACAFLYRFLEL------------HLIGD--------
----------------------LLRGLRGGRV----------------------------
-------------------------------------ALTFHPASH----VYHRVASKCR
SLH-G---------------RYLATPWL-ASPHLQTLFLSISG--RPPSFTYRRQLYTVR
D---GGTIALDWLLASDCEE--------------------------------EDVGF---
--CDGVISRD--D-STPLVVVIPGLTSDSTAAYVKHLVFSMASK----------GWNVVV
GNHRGL-GGIS---ITSDCFYNAGWTEDFREIVNY--------LHQ------KYP---Q-
-APLFAVGTSIGANILVKYLGEE------------------G-EG----TPVAGAVSICS
PWDLLVTNRFIQRKLV-QRCYDKALAIGLKGYAKLH----QPVLARLA------------
---------------------------NWEDIRKSRS-IREFDRHAT--------CVV--
-------AKYE-TVDTFYRRCS-SANYISNVSVPLLCISALDDPLCTR---E--------
----AIP--WD---ECRANKNIVLATAP-NGGHLAFFQGLT-----AGKLW-WVGAV---
-----SEFLLAL------------------------------------------------
-------------HDSPCMHRQKAQEHSLHTSLES-------------------------
----------------------------------SIDKSPYVNFMEDGMV----------
------------------------------------------TAVTNDD-----------
-----------------------------ANNSDSDNPISNEMELRNGMV--GVQQD---
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------------------------GI-----
-----------------------------------------ATEIQNECDGNRSQE----
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------------------------------------------------------NVTPA
QGPVGS-------QEQPKQNIDKIQDAIAPVKISINQLIRS-------------------
------------------------------------------------------QGRSVW
LLTYI-------------------------------------------------------
------------------------------------------------------------
-----------------------------------AFVTSWPFLGA--------------
---------------------------------LGFILFRKKFRNSL-------------
-----------------------------------PAKR------L
>gi|125605820|gb|EAZ44856.1|	   1757 residues, 50 /line  hypothetical protein OsJ_028339 [Oryza sativa (japonica cultivar-group)]
--MLPGPACAPPP---------RL--------LPAAAAATFPLILR--------------
-------------------------------RRQRRRHHRHRPR----PCPTLRASLSDL
LASIP-----SSLALVGPAAAAAVAAVASSFSSSSSSSYVRNGLPPPSSSPPEPDSGYAA
ACGDAA-GDW---------------------------ILFTSPT-P----FNRCVLLRCP
SVSFEDGGVLLDGVNERLLTEERHYVNL-SRGSIPAARGGDG---GAGDIFYQRVCIPAE
D---GGVIALDWPDNLD-------------------------------------------
-----LGKEH--G-LDSTVFIVPGTPEGSMERGIKVFVLDALKN----------GYFPIV
MNPRGC-GGSP---LTTPRLFTAADSDDIGTAIRF--------INN------KRP---W-
-TTLMGVGWGYGANMLTKYLVEV------------------G-ES----TPLTAAVCVDN
PFDLQEATRSFPHHI----ALDRKLTTGLVDILRAN----KELFQGKDK-----------
--------DF-----------------NVQKALSSDC-LRDFDGAIS--------MVS--
-------HGFS-TVDDFYAESS-TRLSISYVKIPVLFIQS-DDGTVPL---L--------
----SVP--RS---SISENPFTSLLLCSCVHSTVFTFE----R---YAVLW-CQNLA---
-----LEWLSAVEFALLKGRHPLIKDVDITINPSKGLAFVEPQANDRKAPNNNNFRQQSQ
FILYNSMPHGINGLLLDSAKQHSVSNEKENGQIKDNGDMDRARKDVNE----------EE
SEETPEDDEKGHALQSASLVMNMLDATMPGTLDDDQKKKVLVAVEQGETLVKALEEAVPE
DVRGKLTTSVTEILQSKRGNFSLDALKRLGWTNGRPNTKTAVQEKIKDS-----------
-----------------------------DHESGLKDAKMHDQNKSASAIGDVDQKDGNL
TSNDNSSGEGIESSQ-----GKPSQTSGPVGA----------------VTEMGTEQIQPN
RSEKSTPGINESSEDHQHKTDQGTETAPKQV----------SDDLSPSEKKNSDDQSPGE
KKVSDDQS----TANLNG---APRERVQSADATAE---SPQVHVVEKDGDAVRASEDKAT
HNVTDQSMQVSKTEEPKPPPVNVTQALDALTGFDDSTQMAVNSVFGVIENMIDQFEKQHE
SENGDKSDGSTDEASVNKTESQVTGDMNNESSGKSINPSSYQPENSISGKGDSIMSEDRM
IGEINSN--LSIISSAKEKIGNYERNIIENYVDADVAKQGSGLPDYLLNIAVNSYLKAQY
AMYLHEFLSTQLQLKPPDSNSATDLFLD--PHEGKWKIADQMDSEHD------------Y
NSKSDKDGNYTKNIGISGSSRDQFR-------TENVIDTPYLVLSH---YPVSRDKKSNE
LKQTVATKLPDIALRETLTSFIRDELENALKIEVGRKVGITNTEQLERNLAHDVERLAAQ
VSRAVVLDCELYS--AACVERNPTTVKFGTTHGENVIEAVSNAIQQSHDLRNILPVGVIV
GVILASLRNYFHVDISKHDKHTKTIVKSGVLSEDPDFKNSYLKKEESTDDASSKTEETTN
NASLQKEEKANDSSKNAENADNPIEKTVAPKGQEIRRSEGQGMMVGAVTAALGASAFVAH
HQQLHSVFIFQQKKVEKHDNMDSTRPDETAQEKSQNNLVTSLAEKAMSVASPVVPTKGDG
EVDQERLVAILAELGQKGGALRFVGKIALLWGGIRGAMSLTDRLISFLRISERPLFQRIM
GFSFMVFVLWSPVVIPLLPTLVQSWTISSSTGIVGYACIVGLYVSIMILVILWGKRIRGY
ENPVEQYGMNL--ASVSRVQEFLQGLAGGITVVGLVHSVSILLGFAAL-RAGSYSFVTRP
LDLLKSSSNVLLLALRGFVTATSIAVVEEVVFRSWLPEEVAVDLGYYSAILISGVAFSLI
HRSLPSVPGFLLLSLVLFGLKQRTQGKLAAPIGLRSGIMTASYLIQTSGIIQSKPVVTFQ
SGIVSSIDYKVERTNQVVGYALVENIEAGTFSILPSSLQ------T
>gi|134063961|emb|CAM40151.1|	   426 residues, 50 /line  hypothetical protein, conserved [Leishmania braziliensis]
--MSGG---------------------------PSASGAVAPLLCR--------------
------------VPFSSKVKFLCLHLFCSLVV----------------------------
-------------------DPVLRLTRFFSRV----------------------------
-------------------------------------WLGRDTTTAVYGSPQAKAFFSLG
RVDKV---------------SYSDPP---YSGHVSTILCALRPHR---NIAYERMTHPGA
D---GNPIYLDWLH----------------------------------------------
------TDAR--S-AKGVFLIIPGLASSSNTNYIEHFVWFASVN----------HFHCGV
FNSRGM-GNSP---IETPRLMSAAWTDDLRTALLDGPFSRAAIEKR------CGA---G-
-ISIIAVGFSLGGVILSKYVGEECLA---------------G-RE----VVVDAAMVVNA
PLNCLHSHRVMSRSI-SKTLYQPRMAGGLVAYARRH----SKVLKDLPG-----------
---L---S----PDVRAAF----TLGRLEEVMAHVKT-VHDFDRLIT--------APT--
-------LGFA-TPEDYYHHVS-PVEWLPHFSVPVLCIGAADDPVTGE---L--------
----PMTNLAS---IMSCNPNVALLVMP-YGGHLGYIRS-------VWDEW-AGKET---
-----AMEKIIY------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------------------------EVAAAIV
PR----------------------------------------------------------
---------------------------------------------R
>gi|134106585|ref|XP_778303.1|	   573 residues, 50 /line  hypothetical protein CNBA3030 [Cryptococcus neoformans var. neoformans B-3501A]
--MHRRSLRPYLR---------YPFPVTQHLS--------------FR-S-----VHHFY
SYRE----INEKNEKPIKYSHTPTIHFSLYCNIHSPLPVHSHPHS---------------
--------------------------------STDTNEHTVHRSMDPAFHPPFPLSNLYQ
TLPFGT-CCAILILWAVHHILCQRYAPITITGPTRREEVGAHGET-----TEELVHKWCK
SLK-E---------------GFTASWWL-PNGHAQTIYSGLADFSMDDHVTYQRQLLRLP
D---GGTIGVDVYPPL--------------------------------------------
-----TTELA--D-DAPVIVVNHGLTGGSHESYVRNLVVWLTKPIAEGGL----GGRAAV
VNFRGC-ASTP---LTSPHLYCSGNTIDNHTATTY--------LAS------LFP---D-
-APLLGVGFSLGAAVMTRYLGEQ------------------G-DK----SRLRAAVVLYC
PLELKAMSAKLDSAHLFPRLYSLTMARKILKSISPH----LLPPSPLSS-----------
PSSP---LHVNIPEILSLSSS--VKYKWTLRASKVTE-LVVTKVGGS--------APC--
-------FPFE-GMDQFLEWAC-PSGWIGRIKRPTLAISALDDPIVSG---D--------
----CLP--YS---AVRASSHMILAGVA-QGGHLGSFDSPSPFGPDRHRRW-HVRPT---
-----IEFLRGV------------------------------------------------
-------------IKDLPKSASE-------------------------------------
------------------------------------QKLGRVQVEERED-----------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------------------------------GWSWVGEVGWKLVGEEEEC----------
------------------------------------------------------------
---------------GWVGNGICESEMDGAGAS------------V
>gi|145350697|ref|XP_001419736.1|	   402 residues, 50 /line  predicted protein [Ostreococcus lucimarinus CCE9901]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------MAVAATACAAWCALGSARETSEVRVTARRTK-----RNAYVLDKCG
AILER---------------GYDAVAWL-KNRHASTILSSLLR--RDLNVAYQREVLAMP
D---GGHATLDWPMSSALVR--------------------------------RRL-----
--AVHHARIA--A-DAPVLVLMSGIAGGSHDKYLKHFLKRARAR----------GFRCVA
FNCRGT-SESP---LTTPQFYSASYTGDIRHVVNT--------LRE------RYP---D-
-APLFAIGWSLGANILTNFLGEE------------------G-EN----AKVTGAAALCN
PFDLNACDTALESGFF-GKVYSQAMAKNMRKLFAPH----ENLFAGLPK-----------
---Y-----------------------NPELVKAAKT-VRDFDEAIT--------RVT--
-------FGFP-SVDAYYEYSG-SKNKIGDVRVPLMTVQARDDPIAIA---D--------
----SIP--RA---IIEENPNVILLETE-SGGHLGWEAGPEAP---FGAPW-PDAVV---
-----MQFFEAL------------------------------------------------
-------------LELKK------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------SPNAKVETDTKVD--P-----------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------VPA------R
>gi|146079860|ref|XP_001463885.1|	   472 residues, 50 /line  hypothetical protein, conserved [Leishmania infantum JPCM5]
-MRFTDRVSFAVK---------------------------------HV-A-----VHVFF
YWL-----------------PRLVFGALSRWPRWL-------------------------
------------------------------------------------------------
--------------------VSRLTRGKLVAEPPDEREVTLIANEKDPYRLRR--RFGLP
LTGQP---------------PLRYHAPL-YNGHIHTILAAMR---SGPRVPYERELVESY
E---GQHVNMDYLYPPPSSDP---------TS----------ST---PATAATSPFAGST
GS--AKGRAP--Q-AKGLIFIVPGLLNASTTNYVRHFAVKSVEA----------GFAVCV
LNSRGM-GTTP---LEVPRLFSATFTEDIRYCLHH-YLQQKQV-QE------RLGTPRP-
-VPLIAVGFSLGGVTLIKYLGEQGMAAAENELRSNLPPNSAA-PD----TPVSALVTVTC
PYDLIEADR-MSATLLYRCLYEKSFAVGLRKYAKHN----REMLAKLPN-----------
--------------VDSKM----LFEGPSPVIDRLTS-IRAFDKYIN--------ASH--
-------NGFN-SPQEYYAAAQ-PLLWLPRCRTPILCIGDRNDVVAGGFVPD--------
----ASW--RA---LVSENPYTVYVCYP-VGGHLGFLGT-------PAAEW-R-------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------------------GDASEAEH--------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------------------------------------LVLRAATKFC
E-----------------------------------------------------------
--------------------------------------T------T
>gi|148230372|ref|NP_001080501.1|	   411 residues, 50 /line  abhydrolase domain containing 3 [Xenopus laevis]
---MPLQQTSI----------------------QNWTLSLSPVLLG--------------
----------------------VASAYVWFYRSYI------------------CKKPRL-
------------------------------------------------------------
----------------------------------------VSDLP-----FQLFLERYCP
IVK-E---------------KFRPTMWC-FGGRIQTILRVILL--SKPPVSYRKEILKTT
D---GGQISLDWVDNNES------------------------------------------
----SQFPGA--S-LRPTVIFLPGLTGNSRQSYILHLVHQASRD----------GYRSVV
FNNRGF-GGEE---LLTPRTFCAANTDDLSAVVSH--------VHR------QFP---D-
-APVLAVGVSLGGMMLLNYLAAQ------------------G-SS----VPLWAALCFST
PWNVFESTRSLEEPL-NYLLFNYSLNKSLRRATEQH----RHVIGKAV------------
---------------------------NVDHILQSRS-IREFDERYT--------SVV--
-------WGFP-SCDDYYTQAS-PDFKLSHIRTPVLCLNAADDPFSPS---A--------
----AIP--VS---KASSNPHVALLIPA-HGGHIGFLEGLLP----THQRY-MDRVF---
-----QQFVGAI------------------------------------------------
-------------LDHRDELNLGENHQYP-------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------KTPNWQREPQWK----------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------------------------------I
>gi|15240586|ref|NP_199806.1|	   537 residues, 50 /line  embryogenesis-associated protein-related [Arabidopsis thaliana]
--MNCAITEDDLI-------SPYLIIFKSLLLIPISH-----------------------
----------------YLIFFFLTILLFLYFFLEI-------------------------
------------------------------------------------------------
-----------------------------HFPKADPISLTFNPNSD----FCKFIVSKCR
LLH-G---------------RYFPTFWL-SSPHLQTAFLTLFG--KSPPFSYKRILYQAT
D---GGTIALDWLMHSDVVEG-----------------------------------ISQV
--VNASNPGT--D-RTPIAIIVPGLTSDSSAAYIKHIAFRLAKE----------GWNVVV
QNHRGL-GGIS---LTSDCVYTAGWTEDLRKVIAH--------IHS------QFP---E-
-APLFAVGTSIGANVLVKYLGED------------------G-PN----TPLIGATAVCS
PWDLLICDRFINRKLV-QKVYDRMLTIGLQGYAQLH----HSIISRIA------------
---------------------------DWEGIKKSRS-VREFDNYAT--------RLV--
-------AKFE-TTDTYYRRSS-SSQYVENVAVPLLCISALDDPVCTR---E--------
----AIP--WD---ECRANKNIVLATTT-HGGHLAYYEGLT-----ASSMW-WTRVV---
-----HEYFEVL------------------------------------------------
-------------LSSPFADRRHKIIPEPL------------------------------
--------------------------------GSSIDQGPFVDAGEHGMV----------
------------------------------------------------------------
-----------------------------------------------AAASEVDTTRADA
EPEDNAQ-----------------------------------------------------
--------IYVKTSNHLHK-----------------------------------------
------------------------------------------------------------
----------------------------------DNNPQVYNNILGPL------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------------------------------KKRVDQLSRY-------------------
------------------------------------------------------SRKSIW
LLAYIA------------------------------------------------------
------------------------------------------------------------
------------------------------------IVTTWPLVGP--------------
---------------------------------ALLFSIKRRFRKLV-------------
--------------------------------------------EK
>gi|21593159|gb|AAM65108.1|	   408 residues, 50 /line  putative LEA protein [Arabidopsis thaliana]
-----MARVAFA-------------------------TSSPPLISSVRTL----------
-----RRHFS--------------------------------------------------
-----------------------VFAAANPEMSRPSH--------------------HSS
LEVIG-------------------------------------------GGSDRFLPALKD
SLAK----------------PYNAFPLIGFNRHVETIYAAFFR--SVPFVRLRRECLRTK
D---NGSVALDWVAGED-------------------------------------------
------RHFP--P-DSPILILLPGLTGGSQDSYVRHMLLRAQSK----------KWRCVV
FNSRGC-GDSP---VTTPQFYSASFLGDIGEVIDH--------VVD------KFP---K-
-ANLYAAGWSLGGNILVNYLGQE------------------S-HN----CPLTAAVSLCN
PFDLVIADEDFHKGF--NNVYDKALSKSLRRIFSKH----SLLFEDIGG-----------
--------EF-----------------NIPLAANAET-VRDFDDGLT--------RVS--
-------FGFK-SVDEYYSKSS-SSKAIKHVRIPLLCIQAANDPIAPE---R--------
----GIP--RD---DIKSNPNCVLIVTP-RGGHLGWVAGEEAP---NGAPW-TDQVV---
-----MEFLQHV------------------------------------------------
-------------ENRETINGERSF-----------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------------------------EDVH---
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------------DQIQV
>gi|49388448|dbj|BAD25578.1|	   469 residues, 50 /line  putative late embryonic abundant protein EMB8 [Oryza sativa (japonica cultivar-group)]
-------MAAPP-------------------------TPSSPLVASTRRF-----VAPRL
RSLLPAAAVS--------------------------------------------------
-----------------------MSSTSSSSISAPSNGRPVSGGAGEQRPPPSPLLPHES
LEVA---------------------------------------------GARCGLLAGFD
SLRR----------------PYRAFPIVASNRHVETIFAAFAR--SLPAVALRRECLRTP
D---DGAVALDWVSGDD-------------------------------------------
------RALP--R-DAPVLILLPGLTGGSDDTYVRHMLLRARNK----------GWRVVV
FNSRGC-AGSP---VTTAKFYSASFTGDLRQVVDH--------VLG------RFP---Q-
-SNVYAVGWSLGANILVRYLGEE------------------T-DK----CVLSGAVSLCN
PFDLVIADEDFHKGF--NNVYDRALAKALRNIFKKH----ALLFEGLEG-----------
--------EY-----------------NIPKAANARS-VRDFDEGLT--------RVS--
-------FGFK-SVDDYYSNSS-SSDSIKNVSIPLLCIQADNDPIAPS---R--------
----GIP--RE---DIKANPNCLLIVTP-QGGHLGWVAGEDAP---FGCPW-TDPII---
-----MEFLEYV------------------------------------------------
-------------HNEKNSSTKGSISYEQ-------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------QSVTQTSAPDVSVHACLVHIVVRSRCSTVLQDDRF---
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------------YVIEL
>gi|23397663|ref|NP_612213.2|	   409 residues, 50 /line  alpha/beta hydrolase domain containing protein 3 [Homo sapiens]
---MQRLAMDLRM-------LSRELSLYLEHQVRVGFFGS--------------------
------------------------------------------------------------
------------------------------------------------------------
-----------GVGLSLILGFSVAYAFYYLSSIAKKPQLVTGGES-----FSRFLQDHCP
VVT-E---------------TYYPTVWC-WEGRGQTLLRPFIT--SKPPVQYRNELIKTA
D---GGQISLDWFDNDNS------------------------------------------
----TCYMDA--S-TRPTILLLPGLTGTSKESYILHMIHLSEEL----------GYRCVV
FNNRGV-AGEN---LLTPRTYCCANTEDLETVIHH--------VHS------LYP---S-
-APFLAAGVSMGGMLLLNYLGKI------------------G-SK----TPLMAAATFSV
GWNTFACSESLEKPL-NWLLFNYYLTTCLQSSVNKH----RHMFVKQV------------
---------------------------DMDHVMKAKS-IREFDKRFT--------SVM--
-------FGYQ-TIDDYYTDAS-PSPRLKSVGIPVLCLNSVDDVFSPS---H--------
----AIP--IE---TAKQNPNVALVLTS-YGGHIGFLEGIWP----RQSTY-MDRVF---
-----KQFVQAM------------------------------------------------
-------------VEHGHELS---------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------------------
>gi|2501572|sp|Q40863|EMB8_PICGL	   457 residues, 50 /line  Embryogenesis-associated protein EMB8
--MAISSR----------------------------------------SV-----GMTEI
HCNFPQNPFR--------------------------------------------------
-----------------------RISRRISQFRAGFPDKKPAAGACEEQDELT-------
----------------------SGSAARIQRRDKQLPEII---------GSDRELMSKLT
TLGR----------------PYRHFPFM-GNRHVETIFASFFR--SWPVIKSRRECLRME
D---GGTVELDWPLEGEDAE----------------------------------------
---LWNGELP--V-NSPVLILLPGLTGGSDDSYVKHMLLRARKH----------GWHSVV
FNSRGC-ADSP---VTTPQFYSASFTKDLCQVVKH--------VAV------RFS---E-
-SNIYAVGWSLGANILVRYLGEV------------------A-GN----CPLSGAVSLCN
PFNLVIADEDFHKGLGFNNVYDKALARGLRQIFPKH----TRLFEGIEG-----------
--------EY-----------------NIPTVAKARS-VRDFDGGLT--------RVS--
-------FGFQ-SVGDYYSNSS-SSLSIKYVQTSLLCIQASNDPIAPS---R--------
----GIP--WE---DIKENPNCLLVVTP-NGGHLGWVAGDDAP---FGAPW-TDPLV---
-----MEYLEVL------------------------------------------------
-------------EKNQIEKPLRRT---------------------IDDVHTPRVD----
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------------------------SVHTRETNNYKSPIENV-----
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------------------------------N
>gi|41053893|ref|NP_957208.1|	   432 residues, 50 /line  abhydrolase domain containing 2 [Danio rerio]
---MNTHESEVYT-------V---------------APEMPAMFDGMKL-----------
------------------------------------------------------------
------------------------------------------------------------
--------------AAVATVLYVIVRCLNLKSPTAPPDLTFQDTT-----LNHFLLKSCP
ILTKE---------------YIPPLLWG-KSGHLQTALYGKLGRVSSPHPFGLRKYLPMQ
D---GATATFDLFEPLA-------------------------------------------
------DHQS--G-EDVTMVICPGIGNHSEKHYIRTFVDHSQKQ----------GYRCAV
LNHLGALPNIE---LTSPRMFTYGCTWEFAAMVGF--------IKK------TYP---Q-
-SKLIVVGFSLGGNIVCKFLGEN------------------R-TNQE---RVLCCVSVCQ
GYSALRAQETFLQWDQCRRFYNFLMADNMKKIILSH----RGVLFGVGS-----------
--KM---VDS-----------------ELSRLYTATS-LMQIDDNIM--------RKF--
-------HGHN-SLKEYYEKES-CVHYIHNINVPLLLVNSVDDPLVHNSL-L--------
----TIP--RT---LAEKKENVVFALTL-HGGHLGFFEGAVL--FPQPLTW-MDKVI---
-----VDYATAM------------------------------------------------
-------------CQWEKQKPPCQ------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------------------------SKDAQSNQ
TTCQENT--------------------------------------S
>gi|42562518|ref|NP_174694.2|	   530 residues, 50 /line  esterase/lipase/thioesterase family protein [Arabidopsis thaliana]
---MEEEDLILSP-------SPYDLLFQALTLIPIRH-----------------------
----------------YLIALFVLCTIFFYNFVEF------------HFLGDA-------
------------------------------------------------------------
----------------------------ILRYFRCRVNLIYNPDSP----LYHGVVSRCQ
ILH-G---------------RYVATPWL-ASPHIQTCFLNFHG--LPPVFTYTRQLFLTS
D---GGTIALDWLTNSDVLDG------------------------------------SLH
N--KSEITKE--D-TTPIAVVIPGLTSDSSSAYLKHLAYDTAKT----------GWNVVI
SNHRGL-GGVS---VTSDCFYNAGWTDDIRVVLDY--------LQH------KYP---R-
-APLFAIGTSIGANVLVKYLGEE------------------G-EK----TPLRGAVAICS
PWDLLIGDRFICRTL-KQKLYDKALTIGLQGYAQLH----EPQFLRLA------------
---------------------------NWEGIKKSRS-IRDFDNHAT--------CLV--
-------GKFE-TVDTYYRKSS-STQYVGNVAVPLLCISALDDPLCTK---E--------
----AIP--WD---ECRANKNIVLATTN-HGGHLAFFEGLT-----GSSLW-WVRAT---
-----NEFLGVL------------------------------------------------
-------------SCSPYMHIQKIVDKRSSGS----------------------------
-----------------------------GKQEPSINQGPYLNIAEDGLV----------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------------------------------------AAVKYEQDTN
KTTLKQRGR---------------------------------------------------
------------------------KPEEDVTKKSFKELCRQ-------------------
------------------------------------------------------TKQSVW
WLGYIG------------------------------------------------------
------------------------------------------------------------
------------------------------------MVTSFPLLGM--------------
---------------------------------LLNYIFRKKQRPTT-------------
------------------------------------------TSTS
>gi|45185426|ref|NP_983143.1|	   450 residues, 50 /line  ABR194Cp [Ashbya gossypii ATCC 10895]
-----MGLPT----------------------------------------------FAPR
SWGYRGT-ITHRPHEE--------------------------------------------
--------------------GLVKLPLKDK------------------------------
---------------------------------------EKEPVT-----LSDLLNEHVP
ELKDG--------------ARFYLHPYL-YNGILQTMYLYGADFSQQYKPFYGREIVSYS
D---GGVSTADWAMREWDDLYA---APEGYNKEKFDADAAKTHPENWPRLQPNTRFLDEE
EL--AKI-PK--D-TRPLIVVAHGLAGGSHENIIRALVTELLSV---GNG----QFNVVV
LNSRGC-ARSK---IANKKLFSAFHTMDIREFINR--------EHA------RQP---E-
-RKIYGLGFSFGSVIFGNYLGEE------------------G-DK----SPLSGAVCCAG
PWDMFASSKMLNDDFWISRLFGKNLVKHLSRLLHVN----RKELEYDGS-----------
--KG---DDVEDASPTNPAS-HIFTKENLARASTMAC-TRDFDNFFT--------APA--
-------LGFK-NANDYYKAAS-PVNIVGKIRVPTLLINALDDPMVGAE--G--------
----FLP--IE---KLRSNKHILLCTTD-IGGHLAYLDK-------NYTPW-MAGRV---
-----AEFLSKM------------------------------------------------
-------------DTLV-------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------------------------------A
>gi|45185835|ref|NP_983551.1|	   455 residues, 50 /line  ACR149Cp [Ashbya gossypii ATCC 10895]
--------------------------------------------------------MGVL
AWLPFCNEVR-HTVPE--------------------------------------------
--------------------QPLKFRDKEQ------------------------------
----------------------------------------QGSMT-----MLELIEKYVP
EFQDR--------------ATQLFHPVL-PTGHLQTIFASLRNFETVDVVYYERMMLSYH
D---GGVGALDFATSAASLE-------------HFQDLPNEVPPHQHRALTDRYRYLTAK
EI--DELASN--D-AKPMLIVMHGLTGGSDEGYVRAIVNRARDV-----Y----GFEACV
LNSRGC-AQSS---ITTPSLYNGAWTDDIRHCVKV--------LRG------MYP---Q-
-RKFYLVGVSLGASMATNYLGQE------------------Q-NS----SDIECAAVLGN
PWDLTSGAYNLSKGLLSRYVYSPALRKNCVQVLKSN----IRQLRLDPY-----------
-----------------------MKKQYDEKLNSLQT-IEDFDNEFT--------AKM--
-------FGFN-TSYEYYRHAS-SVNRLPQVRTPLLAINALDDPIVGS---E--------
----ALP--RR---EVAINPYVVLLETS-KGGHIGWFDY-------KGSRW-YVDPL---
-----CRFFYAF------------------------------------------------
-------------HREITKKNMIP------------------------------------
-------------------------------------DLDGVVLPHPHK-----------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------FEKDRLVNPLVREWDTGRQGS------------S
>gi|4586632|dbj|BAA76441.1|	   451 residues, 50 /line  alcohol acyl transferase [Saccharomyces cerevisiae]
---MSEVSKWPA--------------------------------------------INPF
HWGYNGT-VSHIVGEN--------------------------------------------
--------------------GSIKLHLKDN------------------------------
----------------------------------------KEQVD-----FDEFANKYVP
TLKNG--------------AQFKLSPYL-FTGILQTLYLGAADFSKKFPVFYGREIVKFS
D---GGVCTADWLIDSWKKDYEFDQSTTSFDKKKFDEDEKATHPEGWPRLQPRTRYLKDN
EL--EELR-E--V-DLPLVVILHGLAGGSHEPIIRSLAENLSRS-----G----RFQVVV
LNTRGC-ARSK---ITTRNLFTAYNTMDIREFLQR--------EKQ------RHP---D-
-RKLYAVGCSFGATMLANYLGEE------------------G-DK----SPLSAAATLCN
PWDLLLSAIRMSQDWWSRTLFSKNIAQFLTRTVQVN----MGELGVPNG-----------
---S---LPDHPPTVKNPSF-YMFTPENLIKAKSFKS-TREFDEVYT--------APA--
-------LGFP-NAMEYYKAAS-SINRVDTIRVPTLVINSRDDPVVGPD-----------
-----QP--YS---IVEKNPRILYCRTD-LGGHLAYLDK-------DNNSW-ATKAI---
-----AEFFTKF------------------------------------------------
-------------DELV-------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------------------------------V
>gi|50287413|ref|XP_446136.1|	   443 residues, 50 /line  unnamed protein product [Candida glabrata]
--------------------------------------------------------MVGY
YWLNSL-EVTQVTPDH--------------------------------------------
---------------------AAKIN----------------------------------
--------------------------------------VGGSSTT-----IPEFIDKNIP
ELANG--------------ATDTLSPLL-FNGHLQTAYTALASFESIDQVNYKRIMLKYP
D---GGVGALDFAMKEPDNK------TEYVPEGQTPLDAL------NSHMPGRFYTYMDP
ND--ARLRSN--D-SKPLLIALHGLTGGSHESYVRSMVRTLQNK-----Y----DFEACV
LNSRGC-CNSA---ITTAQLYNGGWTNDIRHCVKE--------LRE------MYP---N-
-RKFYMIGFSLGASILTNYLGEQ------------------G-DK----SDIELAIAFGT
PFDLSHSAKCISESRIGSRVYSPKLTQNLLRLVKSH----EEELTKNEK-----------
-----------------------FRIKYESYAANLKS-VTRFDDLFT--------GPM--
-------FGYR-DAEDYYQNSS-SYKRLLGIRTPYIAINSADDPIVGY---Q--------
----ALH--EN---MFRANPYTTLIRTS-IGGHIAWFKDM------KGDRW-YTEPA---
-----CKLIADY------------------------------------------------
-------------HSKIVSQDHAI------------------------------------
-------------------------------------NVNINDLPKES------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------------------------------IEPVKTTYRDD-----
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------------------------------L
>gi|50294414|ref|XP_449618.1|	   453 residues, 50 /line  hypothetical protein CAGL0M06237g [Candida glabrata CBS138]
----MSVNTWPL--------------------------------------------INPF
NWGYNGT-IKHVTHDE--------------------------------------------
--------------------GTVKLQLKNG------------------------------
----------------------------------------EEPLQ-----FEEFLNKYVP
ELKND--------------AKFKLNPAL-FTGILQTMYLGSADYSREFQVFYGREIVKFS
D---GGVCTVDYVMKDWENEYKLNETTKKFDVEKFKQDEADTHAEGWPRLQPRTRYLRDN
EL--QEVH-S--D-DRPLVLVLHGLAGGSHEPVIRSLTQQLSRI---GGG----KFQVAV
LNSRGC-ARSK---ITTRSLFTAFHTGDTREFLQR--------VRN------HHP---N-
-KKIYAVGFSFGATMLANYLGEE------------------G-EN----TPLSAACTLSN
PWDMVMSSVKTSNDWWSKNLFSANITQFLVRLVKVN----MGELEVPEG-----------
---T---EPDHPPTVKNPSY-YNFTKSNLQKAFKFKT-IADFDSTYT--------APC--
-------LGFK-SAMDYYKSAS-SINRLPNIKIPLLSINARDDPVVGP---E--------
----GVP--FD---LMKQNPHVVHCETD-IGGHLAYLDL-------EWKPW-VTKEI---
-----AQYFNVF------------------------------------------------
-------------DDHV-------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------------------------------E
>gi|50306715|ref|XP_453331.1|	   440 residues, 50 /line  unnamed protein product [Kluyveromyces lactis]
-------------------------------------------------M-----VLGEL
YSLLPWVQTVQQFLPD--------------------------------------------
--------------------ELLQFNSEPG------------------------------
--------------------------------------KTAKSVS-----IKSLIDKYAP
EFQHN--------------SKCVIPPFL-CSGHMQTIFASMFTFESKHLVYYKRYILNYP
D---GGEGALDVCVPQSLWKE-----TGYVPK------------NQRNQLLPRYTYFDAD
E----KFGSS--D-TKPMLIILHGLTGGSNESYVRSLVDTITNE-----Y----NFEACV
LNSRGC-CQSS---ITTPFLYCGLWTDDVRFCVKE--------LRN------KFP---N-
-RKFFLCGVSLGASMTANYLGQE------------------S-DQ----SDVELGVVLGN
PWDLTASSYHLERNLIGKYAYTPALAKNLVKLTTSH----LDVLKQNPE-----------
-----------------------MARMYADHLHEVKT-VEEFDNFFT--------ARM--
-------FGFN-TSFEYYRHGT-SSNRLNKLRTPLLILNALDDPIVGC---E--------
----ALP--YR---EVQSNPYTLMLTTT-RGGHIGWFDM-------NLDRW-YVKPL---
-----CRLLHKF------------------------------------------------
-------------YTDISMQGLAP------------------------------------
-------------------------------------DLKSVDLPKEN------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------KFKN---------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------------DRIIR
>gi|50415370|gb|AAH78041.1|	   500 residues, 50 /line  ABHD3 protein [Xenopus laevis]
---AAGSSAQNHF-------WTL--------------------------R-----FLGAQ
RSLGYRGCEHPEVQHP------EVQHPEIQHSEIQ---------------------HSEI
KHPEIQHPEIQHSEIKHPEVQHPEIQHSEIQHSEIKHPEIKHPEVKHPEDLCGAFSPVIM
ETPEGTTGCWSPSLPSFLLGVTAAILGYYWMCMCKKPTI-VSCKP-----LRLLLEQYCP
VVS-E---------------KFYPTIWC-FEGRMQTALWIH--FVRKPIMSYRNEVIAAE
D---GGQLSLDWKDNEES------------------------------------------
----SQFPDG--A-TRPIAIILPGLNGNSQKIYILNLAKAAMEV----------GYRAVV
INNRGF-GGEQ---VLTPKTLCVGYTLDMRTVVCH--------LKS------IYP---E-
-APLVAVGSSLGAVILLNYLADY------------------G-AS----SHLQAAVSLSP
LWNLFQSDISLSKPL-NHWLLHKTIIQGVKKTMRRY----YSVISQKV------------
---------------------------DVDHVLESQT-LREYDERYT--------APA--
-------YDYQ-SCDEYYRKAS-PDHRLGKIQTPVLCLCSLDDPFSPS---D--------
----AIP--LA---EVSSNPNVALLITT-HGGHIGFLEDLVP----NHQRY-MDRVF---
-----QQFVVAV------------------------------------------------
-------------LDHYRQ-----------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------------------------------T
>gi|50547211|ref|XP_501075.1|	   480 residues, 50 /line  hypothetical protein [Yarrowia lipolytica]
--MNPTIERSARL-------ADYVWSFLGAHKVVVGL------------------FLAAY
FIFKSRDHVK-ITKPR--------------------------------------------
--------------------KPLELHLKNG------------------------------
------------------------------------------KTE-----SLDALIQQVP
GLKNG--------------DTLWYNPLK-ILNHVQTIMASQNDLHGTDLVYYARRMVDFD
D---GVQIAADYVVPAPKTPE---------EKAAWKKGLEYKPEENTPKFPVRTRYKQPQ
EV--ELDHSD--D-SKPMLILLHGLTGGSYESYVRAVVAKITSQYNASADGTLVDFECVV
MNTRGC-ARTT---IKTPELFNGCWTEDVRRFVKD--------MRK------RYP---N-
-RRFYMVGFSLGASILANYLGQE------------------A-ED----IDIEAACVVAN
PWDLCASYYALRSSWSGRHLYNPQMAKNLLRMLRNH----REVMKRNPI-----------
--------------------------YDESLTKQVKS-IVDFDNLFT--------APM--
-------FGFD-TATDYYRHGS-SCNRIMNIRVPTLILHALDDPVAPG---F--------
----QLP--YH---EIKRNPYTVMAATN-HGGHIGWFHWG------KDKRW-FPSKI---
-----AGFFSQF------------------------------------------------
-------------EKEVDHTK---------------------------------------
-------------------------------------DNNTKVERLER------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------------------------------------RWENDRL---
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------------RAVRYD
>gi|58260734|ref|XP_567777.1|	   567 residues, 50 /line  lipid metabolism-related protein [Cryptococcus neoformans var. neoformans JEC21]
MLSLKESKKSKPSKEHPAATKAQGTTFSAILSAIYYYTLGALFSNISNSVYSLVGSLGMA
RWA----RDIVRIVPS--------------------------------------------
--------------------KPGIVKLRSSLGSG--------------------------
-----------------------------------GAKTGKGNKN-----LTEWINESVP
SLM----------------GRFTPAAWL-PNGHLQTLFTAAGDFTKVDKVHYIRTYLRLP
D---GGTLGIDATPENH-------------------------------------------
------DGLP--A-DAPTVVVCHGLTGGSHESYVRNILAWVAKPKEDGGL----GGRGVV
VNFRGC-AGVP---VTSCQLYSAGTTMDLALALHF--------IRN------RHP---S-
-SPLIGIGFSLGASIISRYLGEY------------------G-YS----SILSAGVVLGC
PWDLTAMSHKLENDWFTARVYSSTLGRNVLRLFFKAFDQNPAVFEA--------------
PDSP---IREYIEELKAERKN----------QGTQSR-LRRIDDLLVSKIGGPRGIGA--
-------WPFP-SAKEYYDWAS-STHVLRNVKVPLFAINAFDDPVVDG---G--------
----ALP--LD---EFVASSHIYTAVTG-GGGHLGWFDGPFFDKTKSKQRW-VLKPV---
-----SEFISAC------------------------------------------------
-------------TRDLSPPDEDPD-------------------SRVDIVAGSRI-----
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------------GPKGA----------------DVKLGAE-----
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------------------------------------------ANG
NADFKSNIDADVELNADGG-----------------------------------------
---------WEWVVNPKY-------------------------------------KIPGF
EK----------------------------------------------------------
--------------------------------------VGWKVLKEGE------------
---------------VVEGESDEGEG----------------------------------
----------------------------------------GLVQGL
>gi|6323866|ref|NP_013937.1|	   449 residues, 50 /line  Putative acyltransferase with similarity to Eeb1p and Eht1p, has a minor role in medium-chain fatty acid ethyl ester biosynthesis; may be involved in lipid metabolism and detoxification; Ymr210wp [Saccharomyces cerevisiae]
---------------------------------------------------------MRL
KELLPNFLIVHQEVPE--------------------------------------------
--------------------DPIAFKSTDK------------------------------
------------------------------------RENENKEIT-----IPELIDTKVP
ELADG--------------ATDTLYGLL-VNGHLQTAYGSFRHFDNIYKVQYKRMIIKYP
H---GGEGTVDFAVNGRSTKRRKVE-KEYV---------PTSQPVFNGNLKRRYSYYSPD
D---PKLNSD--D-AKPMLIILHGLTGGSRESYVRAIVHEITTK-----Y----DFEACV
FNARGC-CYSA---ITTPLLYNGGWTNDIRYCVND--------LRK------RFP---N-
-RKFYMMGFSLGASIMTNYLGEE------------------S-DR----TKIECAISVSN
PFDLYNSAYFINSTPMGSRFYSPALGHNLLRMVRNH----LSTLEENPD-----------
-----------------------FKDVIEKHLKKIRT-VRQFDNLLT--------GPM--
-------FGYK-NAEEYYKNAS-SYKRIPGIRTPFIALHAQDDPIVGGD-----------
-----LP--ID---QIKSNPYTLLLETS-TGGHVGWFKDR------SGRRW-YAEPL---
-----CRFLKIF------------------------------------------------
-------------HDEITVKGLKP------------------------------------
-------------------------------------DLENVQLPDPN------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------CEPIATTF--------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------------------------------------------RAN
>gi|6325162|ref|NP_015230.1|	   456 residues, 50 /line  Acyl-coenzymeA:ethanol O-acyltransferase responsible for the major part of medium-chain fatty acid ethyl ester biosynthesis during fermentation; possesses short chain esterase activity; may be involved in lipid metabolism and detoxification; Eeb1p [Saccharomyces cerevisiae]
---MFRSGYYPT--------------------------------------------VTPS
HWGYNGT-VKHVLGEK--------------------------------------------
--------------------GTKSLAFRDS------------------------------
----------------------------------------KRQIP-----LHEFVTKHVP
TLKDG--------------ANFRLNSLL-FTGYLQTLYLSAGDFSKKFQVFYGREIIKFS
D---GGVCTADWVMPEWEQTYSLNAEKASFNEKQFSNDEKATHPKGWPRLHPRTRYLSSE
EL--EKCHSK--GYSYPLVVVLHGLAGGSHEPLIRALSEDLSKV---GDG----KFQVVV
LNARGC-SRSK---VTTRRIFTALHTGDVREFLNH--------QKA------LFP---Q-
-RKIYAVGTSFGAAMLTNYLGEE------------------G-DN----CPLNAAVALSN
PWDFVHTWDKLAHDWWSNHIFSRTLTQFLTRTVKVN----MNELQVPEN-----------
---F---EVSHKPTVEKPVF-YTYTRENLEKAEKFTD-ILEFDNLFT--------APS--
-------MGLP-DGLTYYRKAS-SINRLPNIKIPTLIINATDDPVTGE---N--------
----VIP--YK---QARENPCVLLCETD-LGGHLAYLDN-------ESNSW-LTKQA---
-----AEFLGSF------------------------------------------------
-------------DELV-------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------------------------------L

Ad blocker interference detected!


Wikia is a free-to-use site that makes money from advertising. We have a modified experience for viewers using ad blockers

Wikia is not accessible if you’ve made further modifications. Remove the custom ad blocker rule(s) and the page will load as expected.