FANDOM


>gi|42568893|ref|NP_178405.2|	   283 residues, 50 /line  mitochondrial transcription termination factor-related / mTERF-related [Arabidopsis thaliana]
-----MIARCSL-F-----PPPCFSAVRIRC-----------------------------
------------------------------------------------------------
------------------------------------------------------------
--------FAGETSDTGILFREKLIYLQDL-----------------------------N
V---DPHK----------------------------------------------------
------------------ALRVNP-----------------SL-RSA-PISSVVSVET--
-----LLS--STGLSRPAVGR--------------------------------ILDMFPD
LLTSDPE-SEILPVLRFLSNEISISE-QDIPKSIS-RCPR------------LLISSVDY
QLRPALTFLKT-LGFVGRD---TITSRNTVLL-VSNVERTLIPKIEYLE-----------
------------------------------------------------------------
--------------------------EGLGFTREEVAKMVVRSPALLTYSVDNNLVPK--
-------------VEFFIEEMRGD-VKELKRFPQYFSFSLERKIKPRHRLLKEHG-----
----------------------------IL----------------MPLSEMLKVSDGQF
NHWLLELRLRSAER----------------------------------------------
------------------------------------------------------------
-----------------------------------------R
>gi|147798497|emb|CAN65475.1|	   266 residues, 50 /line  hypothetical protein [Vitis vinifera]
--MIIHFRLRGVSFLL--SNPPQNWRITVKS---FATQLSLLQHASLSFRFFSSSST---
-------------------------------------SPSS-------------------
-------------------PNPNQYSFTVSYL----------------------------
--------------------------TNSC-----------------------------G
L---SPQS----------------------------------------------------
------------------ALSASQ-----------------KL-RLV-TPERPDSVLT--
-----LLR--NYGITDAQLPK--------------------------------LLRVFPS
LLLADPE-KTLLPKLEFLHS-KAFTR-ADLGRILS-SCPL------------ILSRSLDN
QIIPCHNFLKS-ILRLDKT-VVSACKRSPRIL-LENVKKNIVPKITALQ----EIGVPQS
S----VVFLIKH-YPYVVQLKND---------------KFHEIVKEVMESGFDPSENGI-
--HYRNP-----------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------------SVCWN-----------------------------
------------------------------------------------------------
-----------------------------------------E
>gi|47225778|emb|CAF98258.1|	   375 residues, 50 /line  unnamed protein product [Tetraodon nigroviridis]
---MLRLVAASLSLR---------------------------------------------
------------------------------------------------------------
---------------------------------------------------CQCFTPLHF
NPRPCM-------TQSSAENQQVVEDLYHL-----------------------------S
V---DIQK----------------------------------------------------
------------------VRKLKG------------------WVLRQ-SPAYAKEIAD--
-----PLK--DIGASELSIAR--------------------------------ILTSHPE
AVLCHPE--HVQAQRELWMS-VCSSQ-KDLVSIIE-KFPAS----------FFISSSHHN
SQRDNIAYFQS-LNLNNRI-ITKLMASAPHSF-SRPVEQN-KMMVHTLQQAYQELGGDES
NMKIWLQKLLSQ-NPFVFLKAPE---------------ALKRNLLFLQDGGFSNAEL--L
HLLSKLRGFVIELSPDSMRRTLAYSQDTMGCSWPELRDMVLKCPALLYYP-EATISER--
-------------VKGLLH-AGVT-MAQLKETPTVLELTTQ-IVHYRLQRLKSHGY----
-------------------------------------------DVRTGSLEVLNGTKKDF
EMNY--------------------------------------------------------
----------------GKLQLRRER-----------------------------------
-------------------------PIFNPVAPL----KGDD
>gi|118792557|ref|XP_320384.3|	   286 residues, 50 /line  ENSANGP00000014043 [Anopheles gambiae str. PEST]
MSLEVFP-----------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------NTRPAFNFA---------------AYVNKSPTLQ--
-----QLV--SLGVELHKLEK--------------------------------RKGIAQF
VLGLDFD-RDMRNHIRFLAD-VGVPA-ESLGEFLT-KNPL------------IFKEDLG-
DLETRVNYLQS-KRFLPEE-IARIVTKNPFWL-MLNTKR-IDRRLGYFQK---TFALEGS
E----VRALSTK-QPRLITYNLE---------------HVRKNT----------------
---------------------FTVQE-EMGFEKEEVKQLLLSKPRIWMIKTE-ALQYR--
-------------FEYLHRRMKLS-HAELLQTPDLLL-TRDVRIKQRHGFLKFLGK----
-----------------------------VQYDP--------------------------
-----------------------------------------------------KKELYIP
LKSLAEGTDEEFVAEVAKSNMECYN-----------------------------------
---------------------------------RFLKT---L
>gi|91083877|ref|XP_974355.1|	   355 residues, 50 /line  PREDICTED: similar to CG5047-PA [Tribolium castaneum]
-----MLRNLLKTYSVRVY-----------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------FRIRQFSSVQSKAAEGALSTKSEYNLLDTRTIPNDDTIDSKDLEPEPS
VLEPCNEDISYVAPYLRP-----------------------SF-NFA-AYVNKSETLQ--
-----KLV--QLGVELYKLEK--------------------------------NPDVPPY
LLQLDFE-KDIKNHIIFLTD-LGLET-ADLGWLIT-KNPF------------IFKEDLD-
NLQVRINYLKF-KKFNDEM-ILRIVQDNPHWL-GFSTQE-IDKKLGFFQK---NFGLTGN
E----VRSLTVK-KPRLITYNLN---------------HVKLNTF---------------
----------------------VIRE-EMGFTPDETKQILLQKPKIFMKNQ-KGMLKT--
-------------FEYLHKEMNIP-LETIAKMPQVLTCR-EFRLQQRYLFLKHLGK----
-----------------------------IQFDP--------------------------
-----------------------------------------------------KQPNYIS
LIALVSDSDAHFATEVAGSSVNAFN-----------------------------------
---------------------------------EFLKT---L
>gi|30686636|ref|NP_850258.1|	   318 residues, 50 /line  mitochondrial transcription termination factor-related / mTERF-related [Arabidopsis thaliana]
MQQEALSFLSSS-LPSLHHNFPSLSRLR--------------------------------
------------------------------------------------------------
----------------------------------FNNFPALSFKPNTSSSSSSFFKSPDI
PSLSSTTTTTTTTETLESSIHEKLIYLDSL-----------------------------G
I---DFLT----------------------------------------------------
---------------------LINRHPPL---------------LST-ALSAVESVVD--
-----YMTTPPINFTLQDFRR--------------------------------LVSMCPE
LLTSPLT-SHTIPVITFLLREVGVDSIFDLRQALR-RRPR------------LLACSVDH
QLRPTLYFLQR-IGILDP-------HKHTYLL-SCSVDNKLVPRIDYFE-----------
------------------------------------------------------------
---------------------------KLGFSRRSATAMFKRFPQLFNYSIAENYEPK--
-------------LKYLMVEMGRD-VREVLEFPQYFSFSLENRIKPRHEACAAKGV----
---------------------------------------------RFPLPVMLKTNEAGF
RDTLEVH-----------------------------------------------------
------------------------------------------------------------
--------------------------------------FCNE
>gi|125562173|gb|EAZ07621.1|	   333 residues, 50 /line  hypothetical protein OsI_028853 [Oryza sativa (indica cultivar-group)]
---MASGGSSNA-GSLTQWLREKG-----------------------------FDEEAIG
RMSRRCKNLHGLD-----------------------------------------------
---------------------AGEASGVWDYL----------------------------
--------------------------LNVV-----------------------------K
I---ERRK----------------------------------------------------
------------------LRYVVTKC--------------PKVLTLS-VDDKLVPTVQ--
-----CLT--TLQAKPGEVAQ--------------------------------AIVKFPQ
ILFHSVE-EKLCPLLAFFQT-LGISE-KQLAKLLM-VNPR------------LISYSIEA
KFSQTVDFLVG-LGIDKEGMIGKIMAKEPYIM-GYSVDKRLRPTAEFLKS---AVGLEGS
N----LQRVIMS-FPDILSRDVD---------------K---------------------
----------------ILWPNLAFLR-SCGFSKDQVMALVAGYPPVLIKSVKHCLEPR--
-------------MKFLVEEMGRD-MGEVVDYPQFFRHGLKRSLEYRHKVLKQMN-----
----------------------------SR----------------CSLSEMLDCNQKKF
AMKFGLLAA---------------------------------------------------
------------------------------------------------------------
-----------------------------------------V
>gi|147807740|emb|CAN66552.1|	   378 residues, 50 /line  hypothetical protein [Vitis vinifera]
---MAKLHFKSL-LCLMQKRF--------------LTTSSTLYTSSLXS-----------
-------------------------------------SSS--------------------
--------------------TLLSPSYTAQFL----------------------------
--------------------------VKSC-----------------------------G
L---PLDS----------------------------------------------------
------------------AISISQ-----------------KLNLDENKRQKHESVLE--
-----FLK--SHGFSDTHVAK--------------------------------LVSKCPP
ILQARVD--MLKLKJDYLHD-SGFVG-PVLHELIV-SNPA------------ILRRSLDK
QIKPSFDFLKE-FLETNEK-IAAAIKRESWLL-TFDLKKILKPNTFLLI----NEGVPHS
R----MSKLITL-QPRVIMQHVD---------------RMVYATERARSLGIKPTDPIY-
--VTAIT-VILSMTESTWKRKVELYE-KFGFTEVEILKAIKRQPHFMACS-EEKIKSL--
-------------MNFYTNTMKLK-PSAIATYPRLLLYSFDARIRPRFNVLNILA-----
----------------------------SKK-LLKK---------HKKIAWLLTQSEASF
LTNYVIKYVDQVPD----LME--LYRGVKK------------------------------
------------------------------------------------------------
---------------------------------------IDL
>gi|124359483|gb|ABN05921.1|	   284 residues, 50 /line  Mitochodrial transcription termination factor-related [Medicago truncatula]
-MFFLQSFHHRQ-TPSSY--PPSQSSNSIVPN----------------------------
--------------------------------------RYPNRNGYIKFRTTYNENLH-Y
LKALTIINPNTKPNNLP-------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------------------------------HPD-TINHILTIIT--
-----FLK--SHSFTEADIPR--------------------------------LVHHSPH
LFTTSISPTSLSPVFTFLASDLLASV-EDSHGLIL-RCPN------------LLFTDVNH
ILKPTLHFLREEVGVS--N-LNRPTNRNAHLL-NTRVE-KMRMRVRFLE-----------
------------------------------------------------------------
--------------------------EVVGFTYEEARNVCARLPAILGYDVENNLWPK--
-------------FVYLVKEMERE-VEELKKFPQFFGFSLDKRIVPRHLHLKERG-----
----------------------------VR----------------IPLNRMLMWGDEKF
YAKWK-------------------------------------------------------
------------------------------------------------------------
------------------------------------------
>gi|145341626|ref|XP_001415907.1|	   365 residues, 50 /line  predicted protein [Ostreococcus lucimarinus CCE9901]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------MVSYLISL-----------------------------G
L---KTAD----------------------------------------------------
------------------LEKVVVNC--------------AELLNRP--VPRVITRVE--
-----YLQS-ELGLEKKNLRQ--------------------------------IVNKDPR
ILLQRNR--HSIPRCRYLTK-IGVPQ-EKLADVLG-KQPS------------ILHLSVQK
GLMPRVQYLKQEVGILAED-IPLLIQRSPAVL-TFSIENQIQPRVEFLR----DLGISKD
N----VVKMITR-HPQMLHYSFE-------------------------------------
----------------NLEEKLRFLG-EIGMNDSETALTVTRLSQFFSLSVEDSLRPK--
-------------FKYLTNELGGS-KDTCVKYPAYFSLSLDQRIRPRHTFLEQFD-----
----------------------------LAPD--------------PFPMKLLSVKDEDF
VVRASKSIAE-----FEAYKEEM-----------------------------------VP
IFAAQTAREKTLR-------------------EVSNSAEQQRMLLERKRIEFIRTTHEET
VRK-------------REYSERVAKARQSLRLLKGRSQHRSR
>gi|15230219|ref|NP_188517.1|	   274 residues, 50 /line  mitochondrial transcription termination factor-related / mTERF-related [Arabidopsis thaliana]
-MAVIASLHHLQ-PLSSFSSPPSPSSSKP-------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------LYLKFQTSHRENLRHLSSL-----------------------------G
I---VPQ-----------------------------------------------------
---------------------------------------NPRLAPPANDLSVILSAVN--
-----LLK--SKGISDEDFPR--------------------------------LVFLCPQ
LFSPTFDISKLDPVFDFLTGELGASA-EESRGLIV-NCPN------------ILFSDVEY
CLRPTLVYLKE-LGVRN---LNRASKTNAHVL-NTRVE-KLRAKMRFLK-----------
------------------------------------------------------------
---------------------------SIGFEHEEAARVCGRIPAIFGYSVEDNLRPK--
-------------FEFLVYDMERE-LEELKKFPQYFAFSLGKRIRPRHWHLKKKN-----
----------------------------VR----------------VSLSRMLMWGDQKF
YSKWK-------------------------------------------------------
------------------------------------------------------------
-----------------------------------------P
>gi|110735984|dbj|BAE99966.1|	   248 residues, 50 /line  hypothetical protein [Arabidopsis thaliana]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------N----------------------------------------------------
------------------IERFFHVF--------------PEVLGIG-TETRLKPLLD--
-----EFM--KMGFSKDDVKK--------------------------------EIAREPR
VLGLELG-E-LPRCLELINT-LKCRE-VIRVSIIS-EGAF------------RAGFEV--
--KLRVDC----------------------------------------LC---KYGLIRR
D----AFKVVWK-EPRVILYEIE---------------D---------------------
------------------------------------------------------IEKK--
-------------IEFLTNRMGFH-INCLADVPEYLGVNLQKQIVPRYNVIDYLK-----
----------------------------LKG-GLGC---------DIGLKGLIKPSMKRF
YNLYVMPYPECERI----FGK--RKENVRV-----------------------NKRHPAG
LWKLMKPPSNL----TTKEDVQNMK-----------------------------------
---------------------------------SFIES--LA
>gi|147823266|emb|CAN77550.1|	   188 residues, 50 /line  hypothetical protein [Vitis vinifera]
--------------------------------MNRPMAFMVRPNL---------------
------------------------------------------------------------
------------------------FRENLEEV----------------------------
---------------------------KKM-----------------------------G
F---NPSQ----------------------------------------------------
------------------MKFVIAIH--------------A--MRAM-GKSTWERKID--
-----XYK--RWGWSEEEIRL--------------------------------AFIKLPR
CMTHSED-K-IMATMDFFVN-K---M-GRESSLIA-RRPL------------LISLSLEK
RIIPRYSVIQ-------------------------------------VLL---SKGLIKN
D----TSLVVL-------FESTE---------------KMFLRKF---------------
---------------------------VNGFKEEAPQLMKLYQEKINLSKK-Q-------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------DXLQ-----------------------------------
---------------------------------EGSGD---C
>gi|66519881|ref|XP_393820.2|	   319 residues, 50 /line  PREDICTED: similar to CG5047-PA [Apis mellifera]
---MDYSEKL-----------------INTITENNKNIENINEKLSGPFD---RCNEDLS
HIEPYVTPTYNFA-----------------------------------------------
--------------------KFADQSNTIQQL----------------------------
---------------------------VKL-----------------------------G
V---ELYK----------------------------------------------------
------------------IERDKEVL--------------EMFLSLD-FDKDIKPYIQ--
-----FLH--DCGVTPENLGY--------------------------------FITRNPK
IFKEDID-D-LRTRIRYLRY-HNFSV-KMIESIVN-KHPP------------WLSFETQK
IDKRLGHFQH-------------------------------------------NFELNGN
Q----IRFLTVN-CPKLITYDMK---------------RIKNSTFA--------------
-----------------------IKE-IMGFNKLETKHILLKAPRVWIPKT-E-VIKT--
-------------FDYLHNQMQIS-HTSISREPNVLICRKSRLERRHRFLVELKR-----
----------------------------NQY-DP--------------------------
-----------------------------------------------------TKPLYVS
LLNLISGNDFDFCEKVAKVSIYTYN-----------------------------------
---------------------------------NFLKT---F
>gi|62732919|gb|AAX95038.1|	   309 residues, 50 /line  hypothetical protein [Oryza sativa (japonica cultivar-group)]
---MKATHYP-----------------LSTSA---PSAYGLRN-----------------
------------------------------------------------------------
----------------------CDIASRLEFL----------------------------
---------------------------IPL-----------------------------L
G---SYEV----------------------------------------------------
------------------LLKTVKRS--------------YRILTSD-IEEVIKPNFA--
-----QLQ--ECGLTVCD-----------------------------------IVKTNPR
LLSFNPE-R-IKRYVHRADM-LGVPR-CSPAFRMA-VCST------------NEG-----
--SVTARMEF-------------------------------------LSR---TLGCSMD
N----ILIAVGK-RPTILGLSMD---------------N---------------------
------------------------------------------------------LRRK--
-------------IEFLVTEVGLK-LECIVECLGILRYSLEKRMVPRHSVMEILR-----
----------------------------ARG-LMKK---------GASLYGLIMQGEADF
VARYIDTHKDMVHG----LAD--AYNASCFGKMPVVPDSTVKKRHGRRDIYCRGFAMF-E
IWNLLSYMLDNYTCRSALHLADTLL-----------------------------------
---------------------------------EFSEL--QQ
>gi|125579379|gb|EAZ20525.1|	   297 residues, 50 /line  hypothetical protein OsJ_034734 [Oryza sativa (japonica cultivar-group)]
---MTMEQDT-----------------DDATKERAERRREECKARSSPEP---NNLGALG
KEGDERDGRRN-------------------------------------------------
----------------------EEEGQDGHFI----------------------------
---------------------------LR-------------------------------
------------------------------------------------------------
-------------------------------------------LGDL-APCGLKNSTR--
-----LLH--ARGLTRRDALR--------------------------------VLA----
------------------------------------------------------------
------------------------------------------------------------
-----------A-EPRAILYGLE---------------D---------------------
------------------------------------------------------VERK--
-------------VDFLVSRMGFE-IGWLVEFPEFLGVNLERRIVPRHNVVEHLR-----
----------------------------SIG-GLGD---------PIEMKHYVRFSRQRF
YNMFVKPYPECERI----FGGIVREKGKEV----------------------RRWRHPVG
LWKLFKPVKYE----STEEDVNNMKMQLQDKKYPFFSLKGLRVLQESKATPTSDATTEAI
DFEESEFTRSGSMG---FELNDYPGSGANNRHSPHSEG--NR
>gi|116055278|emb|CAL57674.1|	   197 residues, 50 /line  Mitochondrial transcription termination factor, mTERF (ISS) [Ostreococcus tauri]
--------MF-----------------AQRSADAFGAHKTVSPTFSRRSI---VTESRLR
PGRQGVQRIYRLT-----------------------------------------------
--------------------QEKAMIGEYEYL----------------------------
---------------------------ESI-----------------------------G
V---PRAQ----------------------------------------------------
------------------ALQVMSRASTAFEAEMAKKGLDPKAMKFG-AE-EMCEVVD--
-----FLK--LRGVDEKGVGA--------------------------------LVIRHPA
VLSYSVK-ERLEPLFEYMEAQFDRNA-AMFVEDIE-RRPS------------LLGLDADE
NVRKMVDYLLA-SGKTKE------------------------------------------
------------------------------------------------------------
----------------------------------EVMEYLLRS-----------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------------L
>gi|125552291|gb|EAY98000.1|	   365 residues, 50 /line  hypothetical protein OsI_019233 [Oryza sativa (indica cultivar-group)]
-------------------------------------MVPVLDYLGKL-G---VRQDALP
DLLRRYPQVLHAS-----------------------------------------------
--------------------VVVDLAPVVKYL----------------------------
---------------------------QGM-----------------------------D
V---RPHD----------------------------------------------------
------------------VPRVLERY--------------PELLGFK-LEGTMSTSIA--
-----YLV--GIGVARRQVGS--------------------------------VITRFPE
VLGMRVG-KIIKPFVEHLEG-IGLQR-LAIARIIE-KKPY------------VLGFGLED
KVKPNIEALLE-FGVRKEA-LAFIVAQYPDIL-GIELRDKLAAQQSLFES---SILVSSE
D----FGRVIER-MPQAISLGRT---------------AVLKHV-N--------------
-----------------------FLT-SCGFLLSQVSKMVVACPQLLALNM-DIMKMS--
-------------FEYFQNEMERD-LVELVEFPAFFTYGLESTVRPRHEMVAKKG-----
----------------------------F----------------TCSLAWLLNCSDAKF
DERMKYDTIGI-------------------EEMEVDNSFDTNTLSERVEDEV--------
------------EDEDLDEDSDYDS-----------------------------------
---------------------------------TDDEF--IE
>gi|148708018|gb|EDL39965.1|	   346 residues, 50 /line  MTERF domain containing 2, isoform CRA_a [Mus musculus]
---MASLGRQVP-E-------WHRLLALSWACLVRQTPHLREQKQMSPSL---SCKLTTV
PGRGSFQEFSSITPQKCMQEPENRTRLVQCLHEEQKPCVDP-------------------
--------------------ESLEPEKVIRSL----------------------------
---------------------------QDM-----------------------------G
F---AEAH----------------------------------------------------
------------------IHSLFSIQ--------------PSVHP-----QQLLGIVS--
-----ELL--LLGLNPEPVFN--------------------------------ALKKNPQ
LLKLSNM--QMKRRSSYLR-----------------------------------------
----------K-LGLGEGK-LKRVLSVCPEVF-TMHQR-DIDRVVKVLRE---KCLFTAQ
H----ITDVLHR-CPTVLQEDPN-------------------------------------
-----------------------------------------------------ELEYK--
-------------FQYAYFRMGLT-HLDIVR-TNFLQYSITK-IKQRHIYLERLGR----
----------------------------YQT-PDKKGQTQI---PNPSLRNILRVSEAEF
LARTACSSVEEFQV----FKKLLD------QEEEEESESHASEEEEEEEEE---------
------------------------------------------------------------
------------------------------------EE--LL
>gi|125554612|gb|EAZ00218.1|	   376 residues, 50 /line  hypothetical protein OsI_021450 [Oryza sativa (indica cultivar-group)]
---MIHFRRRIL-T-------L-----LLQPASPRPIAGIFLPPCSLRRL---LST----
--------------------------------------TAP-------------------
--------------------VSPKPFAVEDYL----------------------------
--------------------------VAGC-----------------------------G
L---TRAE----------------------------------------------------
------------------AVKASA-----------------KISHLS-SPSNPDAVIA--
-----FLS--DLGLPRPAIAA--------------------------------AIAADPR
LLCADVE-KNLAKRVGELGD-LGLSR-SQIARLLP-LAGW------------CFRS---S
SLATNLAFWLP-VFGSFDK-ILKALRMNKNLL-SPGVQKSAKPILAFL-E---QCGINAS
D----VXRSSTMYSSRLLTANPE---------------YLRVRRGTGGG-----------
-----------------------VGP-GPQFEEDDLLVIMRKLPNFVALSE-KKIRRA--
-------------VEFLKRDVGLE-GRYIVQRPVLLSYSLERRLLPRHCLLKVLR-----
----------------------------TKG-LLNS---------ELDYYSTAALSEKKF
VNKFVHPYEDHIAG----LAD--AYASGCSEER-------------------------NG
VASL----------LSLQTEMDGVQ-----------------------------------
---------------------------------VYAGK--SG
>gi|147823267|emb|CAN77551.1|	   296 residues, 50 /line  hypothetical protein [Vitis vinifera]
MRMIVGFLRKAL-V-------LQVRFTLT-----------ASPTPQSLHF---LPHHFYP
FSSSSTS-------------------------------IST-------------------
--------------------SERSESFTVSYL----------------------------
--------------------------IDXC-----------------------------G
L---SHKD----------------------------------------------------
------------------ALSA------------------SKLLRFE-TPEKPDSVLA--
-----FFN--SHGFSKSQTSK--------------------------------IVKSLPR
LLASDPD-KTLLPKLQFFYS-KGASK-PDVAKIVV-STPG------------ILKRSLEN
QIIPSFNFLKD-FLQSDEM-AITVVKRFSRIL-LFDLHTYVASNMNAL-Q---EFGVPKS
N----IAGLLMY-RPMAFMVNPN---------------LFRKNLEEVTKMGFNPSQMKF-
--VLAIQ-AMRAGGESCWERKIDIYK-KWGWSEEEIRLAFTKSPWCMIYSR---------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------------G
>gi|115448699|ref|NP_001048129.1|	   382 residues, 50 /line  Os02g0749900 [Oryza sativa (japonica cultivar-group)]
---MQRLQKQLL-P-------ALRAAFPLPASHFSSRLLSAS------------------
--------------------------------------TAT-------------------
--------------------LSPTRFVDEDAL----------------------------
--------------------------VAAC-----------------------------G
L---TGAE----------------------------------------------------
------------------ALKASK-----------------RLQKVPSNLDAALTFLA--
-----FLA--DFRLSKDDIAA--------------------------------ASSRYPR
FLHLKVD-ETLTSQVARLRD-IGLST-PEIGRLIT-IAPC------------ILSN---P
RTISRLEFYLS-FLGSYPR-VHSALRNNSSLLRRNNIESEVKPNIAFL-E---QCGLTTC
D----IAKILMS-GSRILIMQPE---------------HVKEIVACADKFGMPRESAGF-
--RYALM-AVTGISPVRVSAKLDFLRMVIGCSDAQLHIAVSRFPLILTYSE-VKLSRS--
-------------LEFLKAEVGLE-PQYIVLRPALLGYSIQKRLMPRYHVMKVLN-----
----------------------------EKG-LLKK---------DTDFYSMVKIVEESF
FKKFLLPYHRSVPG----LEK--AYLAAREGKM---------------------------
------------------------------------------------------------
------------------------------------FP--EI
>gi|92898511|gb|ABE94205.1|	   349 residues, 50 /line  Mitochodrial transcription termination factor-related [Medicago truncatula]
---MNFSGTITK-PNFPFPPTEMPILTFGHSKLTAATLALQLPCNYIRKIRFITKLQCSV
AGRTDSYRTSAADSQGSKRDSGEIQRKRRGASSLYAGYARPSLSEMKKDKATLRKVVYEF
LRGIGIVPDE--LDGLELPVTVDVMKERVDFL----------------------------
---------------------------HSL-----------------------------G
L---TIED----------------------------------------------------
----------------------INNY--------------PLVLGCS-VKKNMVPVLD--
-----YLG--KLGVRKSTITQ--------------------------------FLRTYPQ
VLHASVV-VDLVPVVKYLQG-MDIKP-DDIPRVLE-RYPE------------VLGFKLEG
TMSTSVAYLIG-IGVGRRE-LGGILTRFPEIL-GMRVGRVIKPFVEYL-E---SLGIPRL
A----IARLIET-QPYILGFDLD---------------E---------------------
----------------KVKPNVKSLE-EFNVRETSLASIIAQYPDII-------------
------------------------------------GTDLE-------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------------P
>gi|125540017|gb|EAY86412.1|	   279 residues, 50 /line  hypothetical protein OsI_007645 [Oryza sativa (indica cultivar-group)]
---MLATTRLP--------PPPAAAAATATPTPPA-------------------------
------------------------------------------------------------
-----------------RGGGGVEFRRKLHFL----------------------------
--------------------------SSEL-----------------------------H
L---DPFP----------------------------------------------------
---------------------LLALH--------------PPLRSA--PLPQLRGSLA--
-----LLL--SHGLSAGDAAR--------------------------------VYSAFPS
LLTSPPG-EHL----RFLSADAPLPP-PLLRAAVV-RSPR------------LLAASVPG
TLRPALRFLRR-RVALRRR-PLP--LAAALLL-AFSVDRTLLPKVLFLRD---ATGMPDP
A----VCAILRR-APAILSYGIE---------------T---------------------
-----------------------------------------------------NLTPK--
-------------LRFLADRMGRDPAVELAEFPHYFAFSLEGRIRPRHEALKERR-----
----------------------------VQ----------------MSLKDMLTISDDEF
RERLVDAALSAP------------------------------------------------
------------------------------------------------------------
-----------------------------------------R
>gi|125562292|gb|EAZ07740.1|	   303 residues, 50 /line  hypothetical protein OsI_028972 [Oryza sativa (indica cultivar-group)]
------------------------------------------------------------
------------------------------------------------------------
---------------------------MEDYL----------------------------
--------------------------VDTC-----------------------------G
L---TAAQ----------------------------------------------------
------------------SLKASK-----------------NVSHLK-SATKPDVVLA--
-----ILS--GVGLSGADLAA--------------------------------VVAAEPW
LLCTKAP-SV-----ASLRHRVGLSD-PQIASLLL-L-PG------------GAKGLHTC
DMAPRLEFWIP-FLGSFEM-LLKILKRNNAIV-SSSLEK---------------------
--------MSQT-STRVLTFSPE---------------RLKVIVQQVEKLHMPGCSWAF-
--KNAVG-AVARSNEGIVNARMEFLSSSLGCSMEKLCSAVCKCPQILGLSE-SKLHSK--
-------------IEFLVGKVGLE-PDYILQRPVLLTYSLEKWLVPRHYVVEVLL-----
----------------------------GSQ-MPML---------QFVLGNCLRWSNSTS
SDRDIGGSSVEVPS----------------------------------------------
------------------------------------------------------------
------------------------------------KY--NY
>gi|22417145|gb|AAM96690.1|	   373 residues, 50 /line  MOC1 [Chlamydomonas reinhardtii]
MQQQLY---------------------RQTIRHQHQLLHARGPSLASTSG----------
--------------RPCARPAGDSRRSLRC------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------------YSYTTGSS-SLESHPVKR--
-----AFL--SIGVSPNDLER--------------------------------AARLEPS
VLAVDKL-DRLHGMIDLLLG-ASLSP-SDIGQVLL-AYPQ------------AFQLSLDR
-AREVLDFLRDDMHLSESQ-VRTVLTRYPSIL-NMNVKGQLRPQVAYL-N---SLGVGPE
S----LPELVLS-RPLVLGPGID---------------T---------------------
--------------------VITFLK-RLGVPRSQMHRMLRSCPLDYRVQF-KSFSAAAP
GGSSSSSSSGGMGRNYWRQGAGGA----GRRMVDCWAPLAATAAAPRHVKCTSAVN----
----------------------------IL---LLSGCSRL-------------------
---------------------------------AYRPGRLPPARK---------------
-------------------------------------APGIGANMECAHVGAPRSPRWSL
ERVGDQQRRCIQASGLERLQRRMAAHTGPRRWACEWQG---P
>gi|42573213|ref|NP_974703.1|	   363 residues, 50 /line  PDE191 (PIGMENT DEFECTIVE 191) [Arabidopsis thaliana]
------MEVTNT-SSIMWFFRDKG-----------------------------FDDPSID
KMLRKCKQLEKAQ-----------------------------------------------
---------------------SDVASENWDYL----------------------------
--------------------------SNIV-----------------------------G
I---QERK----------------------------------------------------
------------------LPYIVSRC--------------PKILTLR-LDERLIPMVE--
-----CLS--SLGRNPREVAS--------------------------------AITKFPP
ILSHSVE-EKLCPLLAFFQA-LGVPE-TQLGKMIL-FNPR------------LISYSIDT
KLTVIVSFLAS-LGLDQDGMIGKVLVKNPFLM-GYSVDKRLRPTTEFLKS---SVGLSED
G----IKSVVMN-FPQLLCRDVN---------------K---------------------
----------------ILKPNYDYLK-ECGFGDSQIATMVTGYPQILIKSVKNSLQPR--
-------------IRFLVQVMGRG-MDEVASYPEFFHHGLKKKVESRFKLVKKNN-----
----------------------------ID----------------CSLREMLDCNTKKF
HEKFGFSEVF--------------------------------------------------
------------------------------------------------------------
-----NCNQNGMYMLLDKSVSLLACDYCSNRQAKEV----SA
>gi|47229396|emb|CAF99384.1|	   302 residues, 50 /line  unnamed protein product [Tetraodon nigroviridis]
DAPTY--------SALEIIDDDEAVGIVVPPA----------------------------
----LPPSSTSLR-----------------------------------------------
--------------------DYVDHSETLKKL----------------------------
---------------------------VEL-----------------------------G
V---NLWK----------------------------------------------------
------------------IEQRPNVG--------------SMLMRLN-FDTDVAPKLL--
-----FLK--DIGVDGSRFGY--------------------------------IITRNPF
LLTENLE--NLQARVNYLKS-KNFSG-DTVASMVS-RAPY------------LLNFSVK-
RLDNRLCFFQNQ-LILSFQ-TRNVVARLPRLL-CGSLEP-IKENLKVCEI---EFGFKKN
E----IQH----------------------------------------------------
--------------------------------------IVTAVPKVLTAN-KKKLTQI--
-------------FDYLHNTMKVP-HHLIAKFPQVLN-SKYLRIRERHLFLEYLGK----
----------------------------AQY-DP--------------------------
-----------------------------------------------------ALPTYIS
LDRLVSLPDESFCTDVASATVKDFY-----------------------------------
---------------------------------LFQKT---L
>gi|51536070|dbj|BAD38196.1|	   378 residues, 50 /line  mitochondrial transcription termination factor-like [Oryza sativa (japonica cultivar-group)]
---MNHLRNQIL-L----LRVR-----------SSSTSLSPLSPLH---RLFSSST----
-------------------------------------AAAS-------------------
--------------------IAAEPFAVEDYL----------------------------
--------------------------VTTC-----------------------------G
L---TGDQ----------------------------------------------------
------------------ARKAAK-----------------TLSRLR-SPSKPDAAVA--
-----FLS--GLGLSRSGIAA--------------------------------AVAADPR
LLCADVE-KNLAKRVAELGE-LGISR-SQIARLIP-LARQ---------------SFRSS
SLATNLGFWLP-VLGSFEN-VLMALKANGAIL-GSDVEKVVKPNLALLQ----QCGIHVC
D----FPH--TR-LPTVLCRPPN---------------HVQEAVARIGEFGVPQYSPVF-
--RNALV-PFAYQNKEKLAAKIGVLE-MFGWSEDDLSMTMRKGPVVMNMSVE-RLRKN--
-------------VEFLTRDVKLE-TRYIARRPIMISYSLERRLLPRHRLLRFLS-----
----------------------------AKG-LLDG---------ELDFYSAVALTEKKF
LDKFVHSCKCSIAD----PAN--AYASSFVG-----------------------------
-------------DV---------------------------------------------
-----------------------------------------L
>gi|56744283|gb|AAW28562.1|	   318 residues, 50 /line  Putative mTERF domain containing protein, identical [Solanum demissum]
---MSLLLPEML-T----WINPPKTL----------------------------------
--------------------------------------IPF-------------------
--------------------SSITPNPSSPIPICSISPKPTKTSLKSLHLS---------
------TPPTLTSTDCGLKFREKILYLQEL-----------------------------N
I---NPTK----------------------------------------------------
------------------VLQLNP-----------------HL-RSA-TLDSIRSVEI--
-----CLF--SMGIERSAIGR--------------------------------ILDMHPQ
LLTSDPY-IHLYPIFDFLLNDVVIPF-HDIRKSII-RCPR------------ILVCSVED
QLKPTFEFLKE-FGFVGQN---RITCQTTVLL-VSSVELTLNPKIDYML-----------
------------------------------------------------------------
---------------------------SLGFERDDVVNMVLRSPGLLTFSIEKNFRPK--
-------------VEYFLKEMNGD-IGELKRFPQYFSFSLERKIKPRHRLLMEHG-----
----------------------------FS----------------LSLSEMLKVSDGEF
NARLIEMRLRIVE-----------------------------------------------
------------------------------------------------------------
-----------------------------------DKQ---L
>gi|89515699|gb|ABD75710.1|	   354 residues, 50 /line  MTERF3 [Drosophila melanogaster]
-MFCSALRN--I-L----RNSQNAAKNAT-------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------ITSQIRNLRGQQSVHHE--------VEVVTSPGITTKQNDK--KTEPAEC
EGSKEVALDFRNREAHVP-----------------------SF-NLA-AYVNNSSTLQ--
-----QFL--SLGVDLHSIER--------------------------------RKGLGDF
VLKLDFE-KNAKPYITFLVD-QGVSP-DDFGRMFT-KNPL------------LFKEDLD-
DLQTRVNYLKS-KRFSDEA-RQRILTQNPYWL-MFSTRR-VDRRLGYFQK---EFKLSGH
D----LRLLATR-EPNAITYNME---------------HLRKSVF---------------
----------------------TLK-EEMGFNAKELSDLVVRKPRLLMIPP-DDLVER--
-------------FSYIHQDMGLP-HAQIVQCPELLA-SREFRLRGRHEFLKLLG-----
----------------------------RAQYDSQK-------DLYISPKTIVEGNNFYF
------------------------------V-----------------------------
-------------RNVAISDLETFD-----------------------------------
---------------------------------LFLKT---R
>gi|92891194|gb|ABE90712.1|	   337 residues, 50 /line  Mitochodrial transcription termination factor-related [Medicago truncatula]
-MPTV-TWGVIQ-G----RKEKLVSRVII----FDYLKGLGIIPDELQD-----------
------------------------------------------------------------
-------------------------------------------------LE---------
------LP------STVEVMRERVEFIQKL-----------------------------G
L---TIDDINQY------------------------------------------------
------------------PLILGC-----------------SVLHAS-VIVELAPVIK--
-----FLR--GLDVEKDDIGF--------------------------------VLQKYPE
LLGFKLE-GTMSTSVAYLVS-IGVNP-RDIGPMVA-QYPY------------FLGMRVGT
MIKPFVDYLVN-LGLPKKI-LARMLEKRAYLL-GYVLEETMKPNVDCLI----SFGLRKE
C----LPSVIAQ-YPQIIGLPLT---------------AKLSLQQYFYSLKLKIDSEGFA
KVVEKMP-QVVSLHQNVIMKPVEFLL-GRAIPLQDVASMVIKCPQLIALRVE-LMKNN--
-------------YYFFKREMGRP-VKELVEFPEYFTYSLELRIKPGY------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------
>gi|115453109|ref|NP_001050155.1|	   301 residues, 50 /line  Os03g0360600 [Oryza sativa (japonica cultivar-group)]
-MEE-VLLRHAR-L----PRPTAPTARRS----R--------------------------
------------------------------------------------------------
----------------------------------RLRVVAVALRTRPTS-----------
--------------------------LAVP-----------------------------G
F---PPA-----------------------------------------------------
-------------------PAPAP-----------------EHVLLP-SPSVAAGAAE--
-----VLL--AAGVPPADLRR--------------------------------AAGMCPE
LLSVPVG-T-ITAALRFLTDEAGVPA-EDLPRVLR-RRPR------------LLVSPVAA
RLRPTLYFLRA-LGVPD-------LPRRADLL-SFSVEDKLLPRIEFLE-----------
------------------------------------------------------------
---------------------------SLGLPSRAARSMARRFPALFYYGIDGNMRPK--
-------------AEYLLGDMARD-ADDLFEFPEYFSYALATRIAPRHEACAARG-----
----------------------------VR----------------MPLPAMLRPGDDKF
RATLAGCVGSTPPRRRSPLWH--AYWVDDAG-----------------------------
-------------------EVEEIG-----------------------------------
---------------------------------AASQ----P
>gi|125586333|gb|EAZ26997.1|	   319 residues, 50 /line  hypothetical protein OsJ_010480 [Oryza sativa (japonica cultivar-group)]
-MEE-VLLRHAR-L----PRPTAPTARRS----R--------------------------
------------------------------------------------------------
----------------------------------RLRVVAVALRTRPTS-----------
--------------------------LAVP-----------------------------G
L---PSRA----------------------------------------------------
-------------------RAGAR-----------------ARAAAV-AVRGRGRRRG--
-----ADR--RGGCRPPTSGR--------------------------------AAGMCPE
LLSVPVG-T-ITAALRFLTDEAGVPA-EDLPRVLR-RRPR------------LLVSPVAA
RLRPTLYFLRA-LGVPD-------LPRRADLL-SFSVEDKLLPRIEFLE-----------
------------------------------------------------------------
---------------------------SLGLPFRAARSMARRFPGALLLRHRRQHAAQ--
-------------GGVPPRRHGPG-RRRPLRVPGVLLLRARHAHSRRATRPAPRG-----
----------------------------ASGCRCRPCSGRATTSSGPPSPAASAPRRRGG
GRRYGTPTGWTTPARWRRSGR--RRSRDTRR-----------------------------
-------------------DASAAC-----------------------------------
---------------------------------ALFS---SK
>gi|115447155|ref|NP_001047357.1|	   271 residues, 50 /line  Os02g0602400 [Oryza sativa (japonica cultivar-group)]
-MDHEEIKN---------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------VVRKFP-----------------AFAYYN-VDRKIKPLVA--
-----LLL--ELGVPRSNIPG--------------------------------IIKKRPQ
LCGISLS-DNLKPMMTYLEN-VGINK-DKWSKVLS-RFPA------------LLTYSR-Q
KVETTVSFLTE-LGVPKEN-IGKILTRCPHIM-SYSVNDNLRPTAEYFQ----SIGA---
D----AASLIQK-SPQAFGLNIE-------------------------------------
---------------AKLKPITEFFL-ERDFTMEEIGTMANRFGIIHTLSMEDNLLPK--
-------------YEYFLT-MGYP-RNELVKFPQYFGYSLEQRIKPRYARMIDCG-----
----------------------------VR----------------LILNQLLSVSDSRF
EDILRKR-----------------------------------------------------
------------------------------------------------------------
--------------------------------------MDGI
>gi|125594194|gb|EAZ34253.1|	   364 residues, 50 /line  hypothetical protein OsJ_017736 [Oryza sativa (japonica cultivar-group)]
-MFPTAGGRR-L-L----VLIRRASAAAA----AGANPNHHHHHATLFTHRYSSSP----
-------------------------------------LART-------------------
--------------------PEAESAAAASYL----------------------------
--------------------------VASV-----------------------------G
L---SPAA----------------------------------------------------
------------------AARISR-----------------K-ARFR-SNADAEAVVS--
-----LLR--GHGFSDANIAQ--------------------------------VLPKIPG
LLILNPD-KILRPKLEYFAS-LGVVP-S----ALS-RAP-------------LLARSLEK
HLVPCVEFIRG-VVGTDAN-LCAAISRNPWAL-WCDINSSMRPAVESLR----RHGLAEA
N----ISRLVVI-NLSALTMSPD---------------RIDGIFGDLEALELPISHSRF-
--VYGFW-ALSRLKRGAWEERMSVFM-RFGVSRSELLKAFREQPGILVFTA-KTIQRK--
-------------LSFYQEKLKVA-PADVIAHPLLLTFSLEKNIIPKCAVLNVLL-----
----------------------------REG-KIKR------YGREMDLLRTFGSVAYKF
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------------L
>gi|147846790|emb|CAN80627.1|	   269 residues, 50 /line  hypothetical protein [Vitis vinifera]
-------------------MPPKNVLQKH----PLYTPAHSN------------------
------------------------------------------------------------
------------------------------------------------------------
---------------LSLQFKEKILCLEIM-----------------------------G
V---DSGK----------------------------------------------------
------------------ALSLNP-----------------SL-HTA-TLHSIHSIIS--
-----FLQ--SKGIHQKDLGR--------------------------------IFGMCPK
LLTSNIR-TDLIPVFNFLSQDLKVPD-QSFRRVIN-KCPR------------LLVSSVRD
QLKPALIFLQR-LGFQ--D-LEALAHQDPVLL-VSSVEKTLIPKLEYLV-----------
------------------------------------------------------------
---------------------------SLGMSRADAVGMVLRCPGLFTFSVENNFKPK--
-------------FEYFVGEMEGN-LEELKEFPQYFAFSLEKRIKPRHMEAVQNG-----
----------------------------VK----------------VPLALMLKSTDEEF
RELMTRHG----------------------------------------------------
------------------------------------------------------------
----------------------------------------SG
>gi|115455761|ref|NP_001051481.1|	   310 residues, 50 /line  Os03g0785200 [Oryza sativa (japonica cultivar-group)]
-MPLC-------------SFYASTSLPVA----KPHSL----------------------
--------------------------------------PSS-------------------
--------------------SSSKPYTATPAP--APTAASASASAAALSLH---------
------LP------ELPSRVKDKILSLELM-----------------------------G
V---DYGR----------------------------------------------------
------------------ALALNP-----------------AL-RDA-APESIHAVVT--
-----FLQ--SRGLHFKDLGR--------------------------------VFGMCPS
LLTASVR-ADLRPVFAFLTDDLGIPD-TAYRRVVV-KCPR------------VLACSVRD
QLRPALLYLRR-LGFR--D-ARALAFQDPILL-VSSVERTMIPKLDFLA-----------
------------------------------------------------------------
---------------------------GLGMHRDDAVAMVLRCPALFTFSIERNYKPK--
-------------FEYLVAEMGGG-VHDIKAFPQYFTFSLDKRIAPRHRAAADAG-----
----------------------------VS----------------LPLPDMLKATDEEF
MEMLDK------------------------------------------------------
----------------------EIE-----------------------------------
---------------------------------LQKQA---A
>gi|125554608|gb|EAZ00214.1|	   323 residues, 50 /line  hypothetical protein OsI_021446 [Oryza sativa (indica cultivar-group)]
---MIHLRRC--------VLSRLLQPPCL----TAATHANSLLSLHLRRLL---------
----------------------------------------S-------------------
--------------------GAAEPFAVEDYL----------------------------
--------------------------VESC-----------------------------G
L---TRAR----------------------------------------------------
------------------AEKVSG-----------------KLSHLR-SPSKPDAVLA--
-----ILS--GLGLTRPDIAA--------------------------------AVASDPR
LLCARVD-RTLDARVAELGG-IGLSR-SQIARLIP-LARG---------------GFRIK
SLGSKLAFLVT-VFGSFDR-CLEVVRMN--------------------------------
------------------------------------------------------------
-----FV-KFAILSQGKITKKSGLFK-KLGWSQEDLSLAAKNMPSILAMG-EKRLRQR--
-------------MKFLTEDVGLE-IPYIAQRPALMFYSIERRLLPRHCLINVLK-----
----------------------------RNG-LLKI---------NYDFYSTALISNEKF
LDKFVHPYVESVPG----IGD--AYASSCAG-----------------------------
-------------CGVDQL-----K-----------------------------------
---------------------------------LLSKNKIMC
>gi|125576538|gb|EAZ17760.1|	   371 residues, 50 /line  hypothetical protein OsJ_031969 [Oryza sativa (japonica cultivar-group)]
---MLHLRQC--------LLPLLRAAAAA----HPHTSAASSSSLHLSRRLF--ST----
-------------------------------------AAGP-------------------
--------------------DTAPPFSVEEYL----------------------------
--------------------------VATC-----------------------------G
L---TGAQ----------------------------------------------------
------------------ALKASK-----------------KLSHLR-SPAKPDAVLA--
-----VLS--GVGLSRADLAA--------------------------------VVAADPM
LLCARAP-N-VARRLHSLRDRVGLSD-ADVARFLLAGRPNGLPKMRHRPEARVLDRLRRI
VVKPNIALLQE-CGLSVCE-IAKLSTLKWTVL-SLSPE----------------------
--------------------------------------RVKASVLCVEKLVVPRSSDRF-
--KHVLK-SACWISEDMLAMKMEFLRSTLGCSEDKLRAAVCISPHIFYLS-DKNLCRK--
-------------IDFLISEVGLE-REFIVERPWVLGYSLEKRMVPRHSVMKILR-----
----------------------------TMG-LMKD---------AVDFSSSLVYSEKKF
VARYIDPYKQAAPT----LAD--SYAAACAG-----------------------------
-------------KMPAHV-----------------------------------------
----------------------------------------HR
>gi|110739994|dbj|BAF01901.1|	   346 residues, 50 /line  hypothetical protein [Arabidopsis thaliana]
-AEFSSVVDK------------------------LK--GLQVGCDWLGRYLSDRKT----
-------------------------------------YS---------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------------------------------------------------WRRILETIE--
-----FLD--KVGCKEEKLSS--------------------------------LLKTYPA
LVIEGSG-KKFYVLFGRLFK-AGLQV-NEIYRLFI-DNPE------------MLSDKCVK
NIQKTLDFLIA-IRMETQF-ITKILLSHMELI-GSCSLPA--PRTACL-----SLNVKQD
E----LCKILKK-EPLRLFCFVSTTKKRKSKPLSEDSRKYLEKTEFLLRLGYVENSDEM-
--VKALK-QFRGRGD-QLQERFDCLV-KAGLNYNVVTEIIRHAPMILNLS-KDVIEKK--
-------------IHSLTELLGYP-IESLVRFPAYLCYDMQR-IHHRFSMYLWLR-----
----------------------------ERD-AAKP---------MLSPSTILTCGDARF
VKYFVNVHPE-GPA----IWE--SI-----------------------------------
------------------------------------------------------------
-----------------------------------NQS--ST
>gi|62901914|gb|AAY18908.1|	   351 residues, 50 /line  unknown [synthetic construct]
---MKHHHHH----------------H---------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------------------------------H
S---DYDIPTTENLYFQGSNEQSQKTQ--------NISSFDSELFLEELDELPPLSPMQP
ISEEEAIQIIADPPLPPA-----------------------SF-TLR-DYVDHSETLQ--
-----KLV--LLGVDLSKIEK--------------------------------HPEAANL
LLRLDFE-KDIKQMLLFLKD-VGIED-NQLGAFLT-KNHA------------IFSEDLE-
NLKTRVAYLHS-KNFSKAD-VAQMVRKAPFLL-NFSVER-LDNRLGFFQK---ELELSVK
K----TRDLVVR-LPRLLTGSLE---------------PVKENMK---------------
----------------------VYRL-ELGFKHNEIQHMITRIPKMLTAN-KMKLTET--
-------------FDFVHNVMSIP-HHIIVKFPQVFNTRLFK-VKERHLFLTYLG-----
----------------------------RAQYDPAK---------PNYI-SLDKLVSIPD
E---------------------------IFC-----------------------------
-------------EEIAKASVQDFE-----------------------------------
---------------------------------KFLKT---L
>gi|74182838|dbj|BAB27924.3|	   320 residues, 50 /line  unnamed protein product [Mus musculus]
---MALLAQQ----------------LPR----RFN--SVKLTSFIKAKQVTKRSA----
-------------------------------------RAGK-------------------
--------------------AVLPGFSAQPLL--SSD----------TSFL---------
------RR------GIKTYRTLFWNRFHSA-----------------------------S
T---NRTKSSAESTLLPSVAEQQER-----------ILSLESELPLEEVDDLPPLSPLQS
VSEEEAIQIAAYSPLPIS-----------------------SF-TLA-DYVDHSKTLQ--
-----KLV--QLGVDLSKIEK--------------------------------HPDAANL
LLRLDFE-KHIKQILLFLKD-LGLED-NQLGPFLT-KNYA------------IFSEDLE-
NLKTRVAYLQS-KNFSKTD-IARMVKNAPFLL-SFSVER-LDNRLGFFQK---ELELNVK
K----TRDLVVR-LPRLLTGSLE---------------PVKENMK---------------
----------------------VYHL-ELGFKHNEIQHMVIKIPKMLTA-----------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------
>gi|147817762|emb|CAN68940.1|	   379 residues, 50 /line  hypothetical protein [Vitis vinifera]
---MDLLGNK----------------MAG----YCH--LLSVLRMNLQRRIVLSC-----
------------------------------------------------------------
------------------------------------------------------------
---------------------SVTKDLLLN-----------------------------G
L---SPQS----------------------------------------------------
------------------ALSASR-----------------KL-QFE-TPEGADSVLA--
-----LLR--NYGCTNTHIXK--------------------------------IVSKYPA
LFTTDPE-KTLLPKLEFFRS-VGFSG-PDIAGILS-SNPY------------ILKRGLQN
NLIPTYTFLKS-VVMVNEN-VVRVLRKTHWIT-VQSVQKAITPNIAILT----EIGVPMS
N----ILFLVTC-HPNAVIQNRE---------------KFSTSVKKVXEMGFDPLKVSF-
--LKAVQ-VICGMGESIWEQRMEVYK-RWGLTDDEIMSMFRLDPLCMRSS-EKKIMSV--
-------------MDFLVNKMGWE-PATIARYPTVFMRSLEKKIIPRCSVVKVLQ-----
----------------------------MKG-LVKK---------DLCL-GILGCSENNF
FDKFVLKYEQEVPE----LLN--VYQGKIGI-----------------------------
-------------LELGFVSEEIWE-----------------------------------
-----------------------------------KKE---L
>gi|7267657|emb|CAB78085.1|	   210 residues, 50 /line  putative protein [Arabidopsis thaliana]
-----MVGNSLA-S----PLATLGSAKCF----RHS--AVDLVTYTNVLPLRLNS-----
------------------------------------------------------------
------------------------------------S----------YHGV---------
------NG------GVRTSSYSRSKWIVFC-----------------------------S
T---TQVETSNED---PNIWEE---CK--------EALSCFD----------------FS
VEEKDKILGKAFGHIHSPYWTEER-----------------VK-ENP-KVETLNQILE--
-----FLR--SLGLSDEDLHK--------------------------------VMKKFPE
VLGCSLE-EEMKPNIGILENQWGITG-KQLRNLLL-RNPK------------VLGYNVDC
K-----------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------GDC-VAQCTRCWVR-------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------------F
>gi|108882428|gb|EAT46653.1|	   302 residues, 50 /line  conserved hypothetical protein [Aedes aegypti]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------MLRFFQKLATRSYCTASTSKLVDSLSECIDG
LEKDTLTK----------------------------------------------------
---------------------LFQSA--------------PHLT-KY-APELWNRTHN--
-----LMA--QEGIETANFLS--------------------------------IVTGHPE
VLTRQPN--RLISSMNCWR-SCQFGD-RPMQVLLS-AHPQ------------LLDFSDHN
---------------------------------------QLAQRVAFLH-----------
------------------------------------------------------------
---------------------------SYFETRKNVWRLFMNCPNLVL-DKERDIRPK--
-------------IDYLLQTMRIE-VLEVVKSCAFAA------------------DMDLI
RCRHVFLERLGLFKPRSLKAEPGDPSNNPK----------------L--NQITDTTDKRF
AVKVAYVTLEEYEAF---------------------------------------------
-------------------------------------------------VELYRKERNRL
DEGRDELDEEEDDDFELDDGADEGRQERKQKYRKRTKRNSAR
>gi|70942674|ref|XP_741475.1|	   255 residues, 50 /line  hypothetical protein PC000271.04.0 [Plasmodium chabaudi chabaudi]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------KNFFETCNKEEDKIIKEEISFNSEG------------
------------------------------------------------------------
---------------------------------------------------EQIINKK--
-----EII--KNGLNLEMIKK--------------------------------VIKTSPR
LSLINKN--TLAKRIAHYRNEVNYTY-DELMDILY-NLPQ------------FYSFGNLK
---------------------------------------KKYNELLNL------------
------------------------------------------------------------
---------------------------HQSIKDEDLNKLIKIYPRIFTYNIYRTIRPK--
-------------LLYLIRHLNKT-FTDSISFPQYYSYSFRLRIIPRHVAYMSLYYDDYI
KYYKELLKKYNYADFNNKFNSLVYNSNIPP----------------INLKKLLQTSNKEF
IEYYKIPYYQFVKS----------------------------------------------
------------------------------------------------------------
----------------------------TQLAKNIQNPFIIY
>gi|125588569|gb|EAZ29233.1|	   214 residues, 50 /line  hypothetical protein OsJ_012716 [Oryza sativa (japonica cultivar-group)]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------MASQMRLMKQMCVGFFSHPVCDLFSSPNAR
FSKKKYGG----------------------------------------------------
---------------------RLTIQ--------------PNIE-FG-KTQNSRTQRKWR
TFSADQAQ--ATVVDAGDNKTWEEAKQILTSLDYSIEDADKMLKKAFGWIHSPYWSEERK
KEVPNAE--VVSGVLNYI-RTLGLSD-DDLRKLLK-KFPE------------VLGCDLDS
---------------------------------------EVKLNVGKLD-----------
------------------------------------------------------------
--------------------------SDWGINGKTLRSLLLRNPKVLGYNVDCR------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------GDCMAQCTRCWVRF
>gi|147789753|emb|CAN67409.1|	   249 residues, 50 /line  hypothetical protein [Vitis vinifera]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------MLYLDSI-----------------------------G
L---DLFS----------------------------------------------------
---------------------LINDH--------------PPIV-CA-SLDDIKSTVD--
-----FLY--SMGFTALEFCR--------------------------------ICGMCPE
ILNSRVS--DIVPVFTFLLREARVDG-SDLRRVVN-RRPR------------LLACNVKN
RLRPTLYFLQS-IGISE-------VNKHTNLL-SCSVEXKLIPRIDYLE-----------
------------------------------------------------------------
---------------------------KIGFSKRDAVSMVRRFPQLFNHSIKDNLEPK--
-------------FNYFVVEMGRE-LRELKEFPQYFSFSLENRIKPRHQCCVEKG-----
----------------------------VC----------------FPLPIMLKTTEAKF
HGRLEATLGLSKHIF---------------------------------------------
-------------------------------------------------TK---------
-------------------------------------LSSFE

Ad blocker interference detected!


Wikia is a free-to-use site that makes money from advertising. We have a modified experience for viewers using ad blockers

Wikia is not accessible if you’ve made further modifications. Remove the custom ad blocker rule(s) and the page will load as expected.