Fandom

Proteins Wiki

At2g02980.1/MSA

< At2g02980.1

47,923pages on
this wiki
Add New Page
Talk0 Share
>gi|15227067|ref|NP_178398.1|	   603 residues, 50 /line  pentatricopeptide (PPR) repeat-containing protein [Arabidopsis thaliana]
-----------MAISSASLISSFSHAETFTKHSKIDTVNTQNPI----------------
----------------------------------------------LLISKCNS------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------LRELMQIQAYAIKSH----------IEDV-------SFV-AKLINFCTE
--------------------SPTESSMS---YARHL-FE---------------------
----------AMSE--P-DIVIFNSMARGYSRF-TNP---LEVFSLFVEILED------G
IL-PDNYTFPSLLKACAVA----KALEEGRQLHCLSMKLGLDDNVYVCPTLINMYTECED
--VDSARCVFDRI-VE-PCVVCYNAMIT--------------------------------
----------------------------------GYARRNRPNEALSLFREMQG-----K
YL-KPNE-ITLLSVLSSCALLGSLDLGKWIHKYAKKH---SFCKYVKVNTALIDMFAKCG
SLDDAVSIFEKM-R-YKDTQAWSAMIVAYANHGKAEKSMLMFERMR--SE-NVQPDEITF
LGLLNACSHTGRVEEGRKYFSQMVS--K-FGIVPSIKHYGSMVDLLSRAGNLEDAYEFID
KLPI-SPTP---MLWRILLAACSSH-NNLDLAEKVSE--RIFELDDSH-------GGDYV
ILSNLYARNKKWEYVDSLRKVMKDRKAVKVPGCSSIEVN-NVVHEFFSG-DGVKSATTKL
HRALDEMVKELK-L-SGYVPD-TSMV-VHANMNDQE-KEITLRYHSEKLAITFGLLNTPP
GTTIRVVKNLRVCRDCHNAAKLISLIFGRKVVLRDVQRFHHFEDGKCSCGDFW
>gi|15232648|ref|NP_190263.1|	   657 residues, 50 /line  CRR2 (CHLORORESPIRATORY REDUCTION 2); binding [Arabidopsis thaliana]
--------------------M--FLSHPPQVIQPTYHTVNFLPRSPLKPPSCS-------
------------------------------------------------------------
----------VALNNPSISS----------------------------------------
---------------------GA---------------------------G---------
AKISNNQLIQSLC---KEGKLKQAI----RVLSQE-----------SSPSQQTYELLILC
CGH-----RSSLSDALRVHRHILDNG----------SDQD-------PFLATKLIGMYSD
--------------------LGS---VD---YARKV-FD---------------------
----------KTRKR---TIYVWNALFRALTLA-GHG---EEVLGLYWKMNRI------G
VE-SDRFTYTYVLKACVASECTVNHLMKGKEIHAHLTRRGYSSHVYIMTTLVDMYARFGC
--VDYAS-----------------------------------------------------
-----------YVFGGMPVR----NVVSWSAMIACYAKNGKAFEALRTFREMMRE---TK
DS-SPNS-VTMVSVLQACASLAALEQGKLIHGYILRR---GLDSILPVISALVTMYGRCG
KLEVGQRVFDRM-H-DRDVVSWNSLISSYGVHGYGKKAIQIFEEML--AN-GASPTPVTF
VSVLGACSHEGLVEEGKRLFETMWR--D-HGIKPQIEHYACMVDLLGRANRLDEAAKMVQ
DMRT-EPGP---KVWGSLLGSCRIH-GNVELAERASR--RLFALEPKN-------AGNYV
LLADIYAEAQMWDEVKRVKKLLEHRGLQKLPGRCWMEVR-RKMYSFVSV-DEFNPLMEQI
HAFLVKLAEDMK-E-KGYIPQ-TKGV-LY-ELETEE-KERIVLGHSEKLALAFGLINTSK
GEPIRITKNLRLCEDCHLFTKFISKFMEKEILVRDVNRFHRFKNGVCSCGDYW
>gi|15235472|ref|NP_195434.1|	   691 residues, 50 /line  pentatricopeptide (PPR) repeat-containing protein [Arabidopsis thaliana]
--MNHSNARKLTTLHGFILKR--NLSSFHASLKRFSDKKFFNPNHEDGGVVVERLCRAN-
-----RFGEAIDVLCGQKLL----REAVQLLGRAKKPPASTYCNLIQVCSQTRALEEGKK
VHEHIRTSGF--------------------------------VPGIVI--WNRLLRMYAK
-------CGSLVDARKVFDEMPN---------------------------R---------
DLCSWNVMVNGYA---E-------------------------------------------
------------------------------------------------------------
--------------------VGL---LE---EARKL-FD---------------------
----------EMTEK---DSYSWTAMVTGYVKK-DQP---EEALVLYSLMQRV------P
NSRPNIFTVSIAVAAAAAV----KCIRRGKEIHGHIVRAGLDSDEVLWSSLMDMYGKCGC
--IDEAR-----------------------------------------------------
-----------NIFDKIVEK----DVVSWTSMIDRYFKSSRWREGFSLFSELV-----GS
CE-RPNE-YTFAGVLNACADLTTEELGKQVHGYMTRV---GFDPYSFASSSLVDMYTKCG
NIESAKHVVDGC-P-KPDLVSWTSLIGGCAQNGQPDEALKYFDLLL--KS-GTKPDHVTF
VNVLSACTHAGLVEKGLEFFYSITE--K-HRLSHTSDHYTCLVDLLARSGRFEQLKSVIS
EMPM-KPSK---FLWASVLGGCSTY-GNIDLAEEAAQ--ELFKIEPEN-------PVTYV
TMANIYAAAGKWEEEGKMRKRMQEIGVTKRPGSSWTEIK-RKRHVFIAA-DTSHPMYNQI
VEFLRELRKKMK-E-EGYVPA-TSLV-LH-DVEDEQ-KEENLVYHSEKLAVAFAILSTEE
GTAIKVFKNLRSCVDCHGAIKFISNITKRKITVRDSTRFHCFENGQCSCGDYW
>gi|15237442|ref|NP_199458.1|	   697 residues, 50 /line  pentatricopeptide (PPR) repeat-containing protein [Arabidopsis thaliana]
--MWSRAIFQR-------------------------------------------------
-------------------------------------------------FRFRAFSISHV
IHGKCYRSFSVTVEFQNREVLICNHLLSRRIDEAREVFNQVPSPHVSL--YTKMITGYTR
-------SNRLVDALNLFDEMPV---------------------------R---------
DVVSWNSMISGCV---ECGDMNT--AVKL--FDEMPE-R----------SVVSWTAMVNG
CFR-----SGKVDQAERLFYQMP--------------VKD-------TAAWNSMVHGYLQ
--------------------FGK---VD---DALKL-FK---------------------
----------QMPGK---NVISWTTMICGLDQN-ERS---GEALDLFKNMLRC------C
IK-STSRPFTCVITACANA----PAFHMGIQVHGLIIKLGFLYEEYVSASLITFYANCKR
--IGDSR-----------------------------------------------------
-----------KVFDEKVHE----QVAVWTALLSGYSLNKKHEDALSIFSGML-----RN
SI-LPNQ-STFASGLNSCSALGTLDWGKEMHGVAVKL---GLETDAFVGNSLVVMYSDSG
NVNDAVSVFIKI-F-KKSIVSWNSIIVGCAQHGRGKWAFVIFGQMI--RL-NKEPDEITF
TGLLSACSHCGFLEKGRKLFYYMSS--GINHIDRKIQHYTCMVDILGRCGKLKEAEELIE
RMVV-KPNE---MVWLALLSACRMH-SDVDRGEKAAA--AIFNLDSKS-------SAAYV
LLSNIYASAGRWSNVSKLRVKMKKNGIMKKPGSSWVVIR-GKKHEFFSG-DQ--PHCSRI
YEKLEFLREKLK-E-LGYAPD-YRSA-LH-DVEDEQ-KEEMLWYHSERLAIAFGLINTVE
GSAVTVMKNLRVCEDCHTVIKLISGVVGREIVLRDPIRFHHFKNGTCSCGDYW
>gi|15239745|ref|NP_199702.1|	   646 residues, 50 /line  pentatricopeptide (PPR) repeat-containing protein [Arabidopsis thaliana]
--MNPTQ-----------------------------------------------------
------------------------TLFSPGGNSPASSPASHPSSLFPQINNCRTIRDLSQ
IHAVFIKSGQ--------------------------------MRDTLA--AAEILRFCAT
SDLH---HRDLDYAHKIFNQMPQ---------------------------R---------
NCFSWNTIIRGFS---ESDEDKALIAITL--FYEMMS-DE-----FVEPNRFTFPSVLKA
CAK-----TGKIQEGKQIHGLALKYG----------FGGD-------EFVMSNLVRMYVM
--------------------CGF---MK---DARVL-FY---------------------
----------KNIIE---K-----------------------------------------
------------------------------DMVVMTDRRKRDGEIVLWNVMIDGYMRLGD
--CKAAR-----------------------------------------------------
-----------MLFDKMRQR----SVVSWNTMISGYSLNGFFKDAVEVFREMK-----KG
DI-RPNY-VTLVSVLPAISRLGSLELGEWLHLYAEDS---GIRIDDVLGSALIDMYSKCG
IIEKAIHVFERL-P-RENVITWSAMINGFAIHGQAGDAIDCFCKMR--QA-GVRPSDVAY
INLLTACSHGGLVEEGRRYFSQMVS--V-DGLEPRIEHYGCMVDLLGRSGLLDEAEEFIL
NMPI-KPDD---VIWKALLGACRMQ-GNVEMGKRVAN--ILMDMVPHD-------SGAYV
ALSNMYASQGNWSEVSEMRLRMKEKDIRKDPGCSLIDID-GVLHEFVVE-DDSHPKAKEI
NSMLVEISDKLR-L-AGYRPI-TTQV-LL-NLEEED-KENVLHYHSEKIATAFGLISTSP
GKPIRIVKNLRICEDCHSSIKLISKVYKRKITVRDRKRFHHFQDGSCSCMDYW
>gi|15240085|ref|NP_196272.1|	   622 residues, 50 /line  pentatricopeptide (PPR) repeat-containing protein [Arabidopsis thaliana]
--MSNIVLNT--------------------------------------------------
--------------------------------------LRFKHPKLALLQSCSSFSDLKI
IHGFLLRTHL--------------------------------ISDVFV--ASRLLALCVD
DSTFNKPTNLLGYAYGIFSQIQN---------------------------P---------
NLFVFNLLIRCFS---TGAEPSK--AFGF--YTQMLK---SR----IWPDNITFPFLIKA
SSE-----MECVLVGEQTHSQIVRFG----------FQND-------VYVENSLVHMYAN
--------------------CGF---IA---AAGRI-FG---------------------
----------QMGFR---DVVSWTSMVAG-------------------------------
------------------------------------------------------YCKCGM
--VENAR-----------------------------------------------------
-----------EMFDEMPHR----NLFTWSIMINGYAKNNCFEKAIDLFEFMK-----RE
GV-VANE-TVMVSVISSCAHLGALEFGERAYEYVVKS---HMTVNLILGTALVDMFWRCG
DIEKAIHVFEGL-P-ETDSLSWSSIIKGLAVHGHAHKAMHYFSQMI--SL-GFIPRDVTF
TAVLSACSHGGLVEKGLEIYENMKK--D-HGIEPRLEHYGCIVDMLGRAGKLAEAENFIL
KMHV-KPNA---PILGALLGACKIY-KNTEVAERVGN--MLIKVKPEH-------SGYYV
LLSNIYACAGQWDKIESLRDMMKEKLVKKPPGWSLIEID-GKINKFTMGDDQKHPEMGKI
RRKWEEILGKIR-L-IGYKGN-TGDA-FF-DVDEEE-KESSIHMHSEKLAIAYGMMKTKP
GTTIRIVKNLRVCEDCHTVTKLISEVYGRELIVRDRNRFHHFRNGVCSCRDYW
>gi|22093801|dbj|BAC07088.1|	   643 residues, 50 /line  selenium-binding protein-like [Oryza sativa (japonica cultivar-group)]
--MSLAAVASPHF-----------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-PPSWAYQIRMAA---SQGQFLH--AISL--FLQMRA-SV----APRSSVPASLPAALKS
CAG-----LGLCTLAASLHALAIRSG----------SFAD-------RFTANALLNLCIK
LPGFHHPFGTNGPSGEGGLESAA---YE---SMRKV-FD---------------------
----------EMLER---DAVSWNTLILGCAEH-KRH---QEALSMVREMWRD------G
FM-PDTFTLSTVLPIFAEC----ADIKRGMVVHGYAIKNGFDNDVFVGSSLIDMYANCTQ
--MDYSM-----------------------------------------------------
-----------KVFDSFSDC----DAVLWNSMLAGYAQNGSVEEALGIFRRML-----QA
GV-RPVP-VTFSSLIPAFGNLSLLRLGKQLHAYLIRA---RFNDNIFISSSLIDMYCKCG
NVDIARRVFNGI-Q-SPDIVSWTAMIMGYALHGPTTEAFVLFERME--LG-NVKPNHITF
LAVLTACSHAGLVDNGWKYFNSMSN--Q-YGFVPSLEHCAALADTLGRAGDLDEAYNFIS
EMKI-KPTS---SVWSTLLRACRVH-KNTVLAEEVAK--KIFELEPKS-------MGSHV
ILSNMYSASGRWNEAAQLRKSMRIKGMKKEPACSWIEVK-NKLHVFIAH-DKSHPWYDRI
IDALNVYSEQMI-R-QGYVPN-MEDV-LQ-DIEEEQ-KREVLCGHSEKLAIVFGIISTPP
GTTIRVMKNLRVCVDCHIATKFISKIVAREIVVRDVNRFHRFKDGNCSCGDFW
>gi|45935146|gb|AAS79604.1|	   575 residues, 50 /line  putative pentatricopeptide repeat-containing protein [Ipomoea trifida]
------------------------------------------------------------
-------------------------------------------------MEITSMTQAMQ
LHARILKSGA--------------------------------YDSNHGQDFHKLFTFSAL
SP-----SGDLNYARHILRTLHT---------------------------P---------
NSFYYNTMIRAYS---DSTDPTR--AFTL--FLYMQN-PDDASVAVPRPDHFTYPFVLKA
CSK---------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------S----GHARFGKQIHGLVFKSGVGSDRYINNALIHLYSVSGE
--PNLAY-----------------------------------------------------
-----------KVFDKMPDR----DVVSWTSIIDGFVDNDRPIEAIRLFTHMI-----EN
GI-EPNE-VTVASVLRACADTGALNTGERIHSFVKEK---NFSSNANVSTALIDMYAKCG
CIDGALEVFDET-L-EKDVYVWTAIIAGLASHGLCMKAIEFFENMK--KS-DVKMDERAI
TAVLSAYRNAGLVSEGLLFFRRLK---K-HKIKPTIQHYGCVVDMLTRAGRLKDAEEFIR
KMPI-EPDA---VLWRTLIWGCKIL-GDVERSERLVRELELLNMDSRD-------TGSYV
LLENVYAATGKWEEKAKTRELMYQRGLMKPPACSRIEID-GVVHEFTAG-DSRHDEATAV
YEKLEDVEERLR-G-EGYNPI-VSEV-LL-EIDDDE-KASQLLHHSEKLAVSFGLVKSSP
GSVIRIVKNLRSCEDCHSFMKLISKVYQRDIIVRDRIRFHHFSGGNCSCGDRW
>gi|57899529|dbj|BAD87043.1|	   698 residues, 50 /line  vegetative storage protein-like [Oryza sativa (japonica cultivar-group)]
------------------------------------------------------------
-----------------MLR----HRV--------APNNYTFPFALKACSALADHHCGRA
IHRHAIHAGL--------------------------------QADLFV--STALLDMYVK
-------CACLPDAAHIFATMPA---------------------------R---------
DLVAWNAMLAGYA---HHGMYHH--AVAHLLSMQMQM---HR----LRPNASTLVALLPL
LAQ-----QGALAQGTSVHAYCIRACLHPNRNSKSKLTDG-------VLLGTALLDMYAK
--------------------CGS---LL---YARRV-FD---------------------
----------AMPAR---NEVTWSALIGGFVLC-SRM---TQAFLLFKAMLAQ------G
LCFLSPTSIASALRACASL----DHLRMGEQLHALLAKSGVHADLTAGNSLLSMYAKAGL
--IDQAI-----------------------------------------------------
-----------ALFDEMAVK----DTVSYSALVSGYVQNGRAEEAFLVFKKMQ-----AC
NV-EPDA-ATMVSLIPACSHLAALQHGRCSHGSVIIR---GLASETSICNALIDMYAKCG
RIDLSRQVFNMM-P-SRDIVSWNTMIAGYGIHGLGKEATALFLEMN--NL-GFPPDGVTF
ICLLSACSHSGLVIEGKHWFHVMGH--G-YGLTPRMEHYICMVDLLSRGGFLDEAYEFIQ
SMPL-RADV---RVWVALLGACRVY-KNIDLGKKVSR--MIQELGPEG-------TGNFV
LLSNIYSAAGRFDEAAEVRIIQKVQGFKKSPGCSWIEIN-GSLHAFVGG-DQSHPQSPEI
YRELDNILVGIK-K-LGYQPD-TSFV-LQ-DLEEEE-KEKALICHSEKLAIAYGILSLSE
DKTIFVTKNLRVCGDCHTVIKHISLVKRRAIIVRDANRFHHFKNGQCSCGDFW
>gi|79329389|ref|NP_001031987.1|	   612 residues, 50 /line  binding [Arabidopsis thaliana]
--MSRIGKHP--------------------------------------------------
--------------------------------------------AIALLDSGITFKEVRQ
IHAKLYVDGT--------------------------------LKDDHL--VGHFVKAVAL
SD-----HKYLDYANQILDRSEK---------------------------P---------
TLFALNSMIRAHC---KSPVPEK--SFDF--YRRILS---SG--NDLKPDNYTVNFLVQA
CTG-----LRMRETGLQVHGMTIRRG----------FDND-------PHVQTGLISLYAE
--------------------LGC---LD---SCHKV-FN---------------------
----------SIPCP---DFVCRTAMVTA-------------------------------
------------------------------------------------------CARCGD
--VVFAR-----------------------------------------------------
-----------KLFEGMPER----DPIAWNAMISGYAQVGESREALNVFHLMQ-----LE
GV-KVNG-VAMISVLSACTQLGALDQGRWAHSYIERN---KIKITVRLATTLVDLYAKCG
DMEKAMEVFWGM-E-EKNVYTWSSALNGLAMNGFGEKCLELFSLMK--QD-GVTPNAVTF
VSVLRGCSVVGFVDEGQRHFDSMRN--E-FGIEPQLEHYGCLVDLYARAGRLEDAVSIIQ
QMPM-KPHA---AVWSSLLHASRMY-KNLELGVLASK--KMLELETAN-------HGAYV
LLSNIYADSNDWDNVSHVRQSMKSKGVRKQPGCSVMEVN-GEVHEFFVG-DKSHPKYTQI
DAVWKDISRRLR-L-AGYKAD-TTPV-MF-DIDEEE-KEDALCLHSEKAAIAFGIMSLKE
DVPIRIVKNLRVCGDCHQVSMMISKIFNREIIVRDRNRFHHFKDGHCSCNGFW
>gi|79456853|ref|NP_191848.2|	   573 residues, 50 /line  binding [Arabidopsis thaliana]
---MSKGAAIIAYANPIFHI------RHLKLESFLWNIIIRAIVHNVSSPQRHSPISVY-
---------------LRMRN----HRV--------SPDFHTFPFLLPSFHNPLHLPLGQR
THAQILLFGL--------------------------------DKDPFV--RTSLLNMYSS
-------CGDLRSAQRVFDDSGS---------------------------K---------
DLPAWNS-----------------------------------------------------
-----------------------------------------------------VVNAYAK
--------------------AGL---ID---D----------------------------
------------------------------------------------------------
------------------------------------------------------------
-----AR-----------------------------------------------------
-----------KLFDEMPER----NVISWSCLINGYVMCGKYKEALDLFREMQLPKPNEA
FV-RPNE-FTMSTVLSACGRLGALEQGKWVHAYIDKY---HVEIDIVLGTALIDMYAKCG
SLERAKRVFNALGS-KKDVKAYSAMICCLAMYGLTDECFQLFSEMT--TSDNINPNSVTF
VGILGACVHRGLINEGKSYFKMMIE--E-FGITPSIQHYGCMVDLYGRSGLIKEAESFIA
SMPM-EPDV---LIWGSLLSGSRML-GDIKTCEGALK--RLIELDPMN-------SGAYV
LLSNVYAKTGRWMEVKCIRHEMEVKGINKVPGCSYVEVE-GVVHEFVVG-DESQQESERI
YAMLDEIMQRLR-E-AGYVTD-TKEV-LL-DLNEKD-KEIALSYHSEKLAIAFCLMKTRP
GTPVRIIKNLRICGDCHLVMKMISKLFSREIVVRDCNRFHHFRDGSCSCRDFW
>gi|79507160|ref|NP_196098.2|	   627 residues, 50 /line  binding [Arabidopsis thaliana]
--MNILGFT----VNFLIRC------KVLPRRSNTSSL--------------SRNISVL-
---------------ASYDQ----EEVSPGRYSNEFSNRNLVHEILQLCARNGAVMEAKA
CHGKIIRIDL--------------------------------EGDVTL--LNVLINAYSK
-------CGFVELARQVFDGMLE---------------------------R---------
SLVSWNTMIGLYT---RNRMESE--ALDI--FLEMRN---EG----FKFSEFTISSVLSA
CGV-----NCDALECKKLHCLSVKTC----------IDLN-------LYVGTALLDLYAK
--------------------CGM---IK---D----------------------------
------------------------------------------------------------
------------------------------------------------------------
-----AV-----------------------------------------------------
-----------QVFESMQDK----SSVTWSSMVAGYVQNKNYEEALLLYRRAQ-----RM
SL-EQNQ-FTLSSVICACSNLAALIEGKQMHAVICKS---GFGSNVFVASSAVDMYAKCG
SLRESYIIFSEV-Q-EKNLELWNTIISGFAKHARPKEVMILFEKMQ--QD-GMHPNEVTF
SSLLSVCGHTGLVEEGRRFFKLMRT--T-YGLSPNVVHYSCMVDILGRAGLLSEAYELIK
SIPF-DPTA---SIWGSLLASCRVY-KNLELAEVAAE--KLFELEPEN-------AGNHV
LLSNIYAANKQWEEIAKSRKLLRDCDVKKVRGKSWIDIK-DKVHTFSVG-ESGHPRIREI
CSTLDNLVIKFR-K-FGYKPS-VEHE-LH-DVEIGK-KEELLMQHSEKLALVFGLMCLPE
SSPVRIMKNLRICVDCHEFMKAASMATRRFIIVRDVNRFHHFSDGHCSCGDFW
>gi|79527297|ref|NP_198857.2|	   608 residues, 50 /line  binding [Arabidopsis thaliana]
--MIKANVYSCSKFRFLYRR------RFLSQSSFVHSL----------------------
--------------------------------------DANVSSLIAAVKSCVSIELCRL
LHCKVVKSVS--------------------------------YRHGFI--GDQLVGCYLR
-------LGHDVCAEKLFDEMPE---------------------------R---------
DLVSWNSLISGYS---GRGYLGK--CFEV--LSRMMI-SEVG----FRPNEVTFLSMISA
CVY-----GGSKEEGRCIHGLVMKFG----------VLEE-------VKVVNAFINWYGK
--------------------TGD---LT---S----------------------------
------------------------------------------------------------
------------------------------------------------------------
-----SC-----------------------------------------------------
-----------KLFEDLSIK----NLVSWNTMIVIHLQNGLAEKGLAYFNMSR-----RV
GH-EPDQ-ATFLAVLRSCEDMGVVRLAQGIHGLIMFG---GFSGNKCITTALLDLYSKLG
RLEDSSTVFHEI-T-SPDSMAWTAMLAAYATHGFGRDAIKHFELMV--HY-GISPDHVTF
THLLNACSHSGLVEEGKHYFETMSK--R-YRIDPRLDHYSCMVDLLGRSGLLQDAYGLIK
EMPM-EPSS---GVWGALLGACRVY-KDTQLGTKAAE--RLFELEPRD-------GRNYV
MLSNIYSASGLWKDASRIRNLMKQKGLVRASGCSYIEHG-NKIHKFVVG-DWSHPESEKI
QKKLKEIRKKMK-SEMGYKSK-TEFV-LH-DVGEDV-KEEMINQHSEKIAMAFGLLVVSP
MEPIIIRKNLRICGDCHETAKAISLIEKRRIIIRDSKRFHHFLDGSCSCSDYW
>gi|87240430|gb|ABD32288.1|	   620 residues, 50 /line  Tetratricopeptide-like helical [Medicago truncatula]
--MSFYSIKKTQHTSFIFNL-------FPFSQSFYHSL------------------ATH-
---------------QTAS---------VDSFPPQPTTHYGYTSLLQSCIDSKALNPGKQ
LHAQFYHLGI--------------------------------AYNQDL--ATKLVHLYAV
-------SNSLLNARNLFDKIPK---------------------------Q---------
NLFLWNVLIRGYA---WNGPHDN--AIIL--YHKMLD---YG----LRPDNFTLPFVLKA
CSA-----LSAIGEGRSIHEYVIKSG----------WERD-------LFVGAALIDMYAK
--------------------CGC---VM---D----------------------------
------------------------------------------------------------
------------------------------------------------------------
-----AG-----------------------------------------------------
-----------RVFDKIVVR----DAVLWNSMLAAYAQNGHPDESISLCREMA-----AN
GV-RPTE-ATLVTVISSSADVACLPYGREIHGFGWRH---GFQSNDKVKTALIDMYAKCG
SVKVALALFERL-R-EKRVVSWNAIITGYAMHGLAVGALDLFDKMR--KE-D-RPDHITF
VGVLAACSRGRLLDEGRALYNLMVR--D-YGITPTVQHYTCMIDLLGHCGQLDEAYDLIR
NMSV-KPDS---GVWGALLNSCKIH-GNVELAELALE--KLIELEPDD-------SGNYV
ILANMYAQSGKWEGVEKLRQVMIDKRIKKNIACSWIEVK-NKVYAFLAG-DVSHSNSDAI
YAELKRLEGLMH-E-AGYAPD-TGSV-FH-DVEEDE-KTSMVCSHSERLAIAFGLISTSP
GTRLLITKNLRICEDCHVAIKFISKIMEREITVRDVNRYHSFKHGMCSCGDHW
>gi|108711755|gb|ABF99550.1|	   646 residues, 50 /line  pentatricopeptide, putative, expressed [Oryza sativa (japonica cultivar-group)]
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------------------------------M
-------VGL---------VAL-SLDTVATKDEFVRLCATGRLRDALRRP----------
-------------------------------------FRGVL----WSDAARLFSHLFRA
CRA--------LRPLRQLHAFAATSG----------AATD-------RFTANHLMLAYAD
--------------------LGD---LT---AAREL-FERIPRRNVMSWNILFGGYIKNG
DLGGARKLFDEMPE--R-NVATWNAMVAGLTNL-GFD---EESLGFFLDMRRE------G
MH-PDEFGLGSVFRCCAGL----RDVVTGRQVHAYVVRSGLDRDMCVGSSLAHMYMRCGC
--LQEGEAVLRML-PS-LSIV---------------------------------------
---------------------------SCNTIIAGRTQNGDSEGALEYFCMMRS-----V
GV-AADV-VTFVSAISSCSDLAALAQGQQIHGQVMKA---GVDKVVPVMTCLVHMYSRCG
CLGDSERVFFGY-C-GSDTFLLSAMISAYGFHGHGQKAIELFKQMM--NG-GAEPSDVTF
LALLYACSHSGLKEEGMDCFELMTK--T-YGMQPSVKHYTCVVDLLGRSGCLDEAEALIL
SMPL-TPDG---VIWKTLLSACKTQ-KNFDMAERIAK--RVIELDPHD-------SASYV
LLSNIRATSRRWGDVSEVRKAMRDNNVRKEPGVSWVELK-GHIHQFCTG-DESHPRQKEI
DECLEEMMAKIR-Q-CGYSPD-MSMV-LH-DMEDEE-KEVSLSHHSEKLAIAFAFLSLPE
GVPIRVMKNLRVCDDCHLAIKLMSQVTGREIVVRDVSRFHHFKDGRCSCRDYW
>gi|108864632|gb|ABG22571.1|	   692 residues, 50 /line  pentatricopeptide, putative, expressed [Oryza sativa (japonica cultivar-group)]
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------------------------------M
-------THRQATPRRRGSRAL-HDLRLPNPPR--------LLARRPPTPADLHPASRGG
PAFSCSLTGGERRRIIDQSIQNE--RLRY--WGGRHEADLCM----LSPAATAVAAVRAT
AGS--------PAAVRGMHARILKEG----------LAHH-------PPNPAALVSAYAK
--------------------SRL---LP---DALHL-FD---------------------
----------ETPR--R-DIYIYSSLLTAVSHS-ASP---ELALPILRCMLSA-----DA
LH-PDHFVISSVASVFARL----RSRRLGRQLHAHFVVSPYNGDDVVKSSLVDMYCKCGS
--PDDGRKVFDSM-SA-KNSVVWTALVSG-------------------------------
YASNGRSEEALQLFRSMPGR----NLFAWTALISGLVNTGESVGAVELFVEMRR-----D
GV-RIDDAFVLSIVIGGSADLAAFVLGRQLHGSTMRL---GFLSNMIVGNALIDMYSKCS
DILSAREVFEGI-T-FRDVISWTTMVVGEAQHGRAEEALALYDRMV--LA-GAKPNEVTF
VGLIYACSHAGLVQKGRQLFESMKN--E-YGITPRLQHYTCYLDLLSRSGHLLEAEELMT
TMPY-EPDE---ATWGALLSACTKY-KDAEMCIRISD--KLLELRPKD-------SSTYI
LLSNVYAVNGKWDSVAKVRKCMIGLEIRKEPGYSWIEAG-REFRLFHAG-EVPLDVREEI
MVFLEEMVLEMR-K-RGYVPD-TSSV-MH-DLEESE-KEHHLFLHSERLAVAFGLIKSPP
GSVIRVVKNLRVCVDCHTVMKLISEITHRKIVVRDSSRFHHFEGGKCSCSEFW
>gi|110736949|dbj|BAF00431.1|	   659 residues, 50 /line  hypothetical protein [Arabidopsis thaliana]
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------------------------------M
-------KVRSKKALFCSVSRL------LHTERHTERQNLTTLFNRYVDKTD--------
-VFSWNSVIADLA---RSGDSAE--ALLA--FSSMRK---LS----LYPTRSSFPCAIKA
CSS-----LFDIFSGKQTHQQAFVFG----------YQSD-------IFVSSALIVMYST
--------------------CGK---LE---DARKV-FD---------------------
----------EIPK--R-DIVSWTSMIRGYDLN-GNA---LDAVSLFKDLLVDENDDDDA
MF-LDSMGLVSVISACSRV----PAKGLTESIHSFVIKRGFDRGVSVGNTLLDAYAKGGE
GGVAVARKIFDQI-VD-KDRVSYNSIMSV-------------------------------
YAQSGMSNEAF-----------------------------------EVFRRLVK-----N
KVVTFNA-ITLSTVLLAVSHSGALRIGKCIHDQVIRM---GLEDDVIVGTSIIDMYCKCG
RVETARKAFDRM-K-NKNVRSWTAMIAGYGMHGHAAKALELFPAMI--DS-GVRPNYITF
VSVLAACSHAGLHVEGWRWFNAMKG--R-FGVEPGLEHYGCMVDLLGRAGFLQKAYDLIQ
RMKM-KPDS---IIWSSLLAACRIH-KNVELAEISVA--RLFELDSSN-------CGYYM
LLSHIYADAGRWKDVERVRMIMKNRGLVKPPGFSLLELN-GEVHVFLIG-DEEHPQREKI
YEFLAELNRKLL-E-AGYVSN-TSSV-CH-DVDEEE-KEMTLRVHSEKLAIAFGIMNTVP
GSTVNVVKNLRVCSDCHNVIKLISKIVDREFVVRDAKRFHHFKDGGCSCGDYW
>gi|110737061|dbj|BAF00484.1|	   629 residues, 50 /line  hypothetical protein [Arabidopsis thaliana]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------PPT--------TITYYHPMSIGLLVHPLSP
H---------------------------I--PPASSPSASTA----GNHHQR-IFSLAET
CSD--------MSQLKQLHAFTLRTT----------YPEEPA----TLFLYGKILQLSSS
--------------------FSD---VN---YAFRV-FD---------------------
----------SIEN--H-SSFMWNTLIRACAHDVSRK---EEAFMLYRKMLERG-----E
SS-PDKHTFPFVLKACAYI----FGFSEGKQVHCQIVKHGFGGDVYVNNGLIHLYGSCGC
--LDLARKVFDEM-PE-RSLVSWNSMIDA-------------------------------
LVRFGEYDSAL-----------------------------------QLFREMQR------
SF-EPDG-YTMQSVLSACAGLGSLSLGTWAHAFLLRKCDVDVAMDVLVKNSLIEMYCKCG
SLRMAEQVFQGM-Q-KRDLASWNAMILGFATHGRAEEAMNFFDRMVDKRE-NVRPNSVTF
VGLLIACNHRGFVNKGRQYFDMMVR--D-YCIEPALEHYGCIVDLIARAGYITEAIDMVM
SMPM-KPDA---VIWRSLLDACCKKGASVELSEEIAR--NIIGTKEDNESSNGNCSGAYV
LLSRVYASASRWNDVGIVRKLMSEHGIRKEPGCSSIEIN-GISHEFFAG-DTSHPQTKQI
YQQLKVIDDRLR-S-IGYLPD-RSQAPLVDATNDGS-KEYSLRLHSERLAIAFGLINLPP
QTPIRIFKNLRVCNDCHEVTKLISKVFNTEIIVRDRVRFHHFKDGSCSCLDYW
>gi|115434844|ref|NP_001042180.1|	   665 residues, 50 /line  Os01g0176300 [Oryza sativa (japonica cultivar-group)]
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------------------------------M
-------VRALSRARSLLDGIP-HRR----------------------------------
-GRAASSSVSGHG-------AEE--AVAG--YVRMLA---GG----ARPDAYTFPSLLKA
AAAARGAAVAAASVGGAIHAHVVKFG----------MESN-------AHAASSLIVMYAA
--------------------RGD---GA---AARAV-LEAACLAT---------------
------------GG--G-APVMWNALISGHNRS-GRF---ELSCCSFVDMVRA------S
AM-ATAVTYVSVLSACGKG----KDLLLGMQVHKRVLESGVLPDQRVENALVDMYAECGD
--MDAAWVLFEGM-QM-RSMASWTSVISG-------------------------------
LVRSGQVDRARDLFDHMPER----DTIAWTAMIDGYVQVGRFRDALETFRYMQI-----C
KV-RADE-FTMVSVVTACAQLGALETGEWARIYMGRL---GIKMDVFVGNALIDMYSKCG
SIERALDVFKDM-H-NRDKFTWTAIILGLAVNGRGEEAIDMFYRML--RA-LQTPDEVTF
VGVLTACTHAGLVDKGREFFLSMTE--A-YNISPTVVHYGCLIDVLGRAGKLKEALDTID
KMPM-KPNS---TIWGTLLASCRVY-GNSEIGELAAE--RLLELDPDN-------STAYI
LLSNMYAKSNRWKDVRRIRQIIMEKGIKKEPGCSMIEMN-GIIHEFVAA-DRSHPMNKEI
YSKLENVLTDLR-N-AGYVPD-VTEV-LV-EVTEEE-KQKVLYWHSEKLAVTFALLTSES
NVIIRIVKNLRMCLDCHNAIKLISKLYGREVIVRDRTRFHHFRHGSCSCKDYW
>gi|115435158|ref|NP_001042337.1|	   667 residues, 50 /line  Os01g0205200 [Oryza sativa (japonica cultivar-group)]
------------------------------------------------------------
----------------------------------------------KCITGLSGVMDGLV
VHGYLVKYGF----------------------------------GAQCAVCNALISFYAK
-------SNRIEDALMVFDEMP-Q--------------------------RD--------
-IISWNSIIGGCA---SNGLYDK--AVEL--FVRMWL---EG----QELDSTTLLSVMPA
CVQ-----SHYSFIGGVVHGYSVRTG----------LISE-------TSLGNALLDMYSN
--------------------CSD---WR---STNKI-FR---------------------
----------NMEQ--K-NVVSWTAMITSYTRA-GHF---DKVAGLFQEMGLE------G
IR-PDVFAITSALDAFAGN----ESLKHGKSVHGYAIRNGIEEVLPVANALMEMYVKCGY
--MEEARFIFDHV-TK-KDTISWNTLIGG-------------------------------
-----------------------------------YSRSNLANEAFTLFNEMLL-----Q
-L-RPNA-VTMACILPAAASLSSLERGREMHAYAVRR---GYLEDNFVANALVDMYVKCG
ALLLARRLFDML-T-NKNLISWTIMIAGYGMHGRGRDAIALFEQMK--GS-GIQPDAGSF
SAILYACSHSGLRDEGWRFFNAMRN--E-HRIEPKLKHYACMVDLLCHTGNLKEAYEFIE
TMPI-EPDS---SIWVSLLRGCRIH-RNVKLAEKVAE--MVFELEPEN-------TGYYV
LLANIYAEAERWEAVRKLKNKVGGRGLRENTGCSWIEVR-GKAHIFFAE-NRNHPQGMRI
AEFLDDVARRMQ-E-EGHDPK-KKYA-LM-GADDAV-HDEALCGHSSKLAVAFGVLNLSQ
GRPIRVTKNSRVCSHCHEAAKFISKMCGREIILRDSNRFHHFEEGRCSCRGYW
>gi|115440653|ref|NP_001044606.1|	   604 residues, 50 /line  Os01g0814300 [Oryza sativa (japonica cultivar-group)]
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------------------------------M
-------HHQQLKPG-----------EAASLPRHLLE-----------------------
--------------------------------------------------AHVVALVRRC
CPG--------LLALRAAHARLIRLR----------LPRLTAAFALSKLLASSSSSSSSS
--------------------CGA---AP--SYARNL-FD---------------------
----------QIPE--P-TAFCYNSLIRALSSA-AGAAPAADTVLVYRRMLRAG-----S
PL-PNSFTLAFALKACSVV----PALGEGRQLHSQAFRRGLEPSPYVQTGLLNLYAKCEE
--VALARTVFDGMVGD-KNLAAWSAMIGG-------------------------------
YSRVGMVNEAL-----------------------------------GLFREMQA-----A
DV-NPDE-VTMVSVISACAKAGALDLGRWVHAFIDRK---GITVDLELSTALIDMYAKCG
LIERAKGVFDAM-A-ERDTKAWSAMIVGLAIHGLVEVALKLFSRML--EL-KVRPNNVTF
IGVLSACAHSGLVNEGRRYWSTMQ---E-LGIKPSMENYGCMVDLFCRSSLLDEAYSFVT
GMAI-PPNS---VIWRTLLVASKNS-NRFDIVQSASK--KLLELEPCN-------PENYV
LLSNLYASNSQWDRVSYMRKKMKENNVNVVAGCSSIEIN-GYLHKFVVS-DDSHPEIKEI
RLLLREIADRVV-R-AGHKPW-TAAV-LH-DVGEEE-KEVALCEHSERLAIAYGLLKTKA
PHVIRVVKNLRFCPDCHEVAKIVSKSYDREIIVRDRVRFHRFVEGSCSCKDFW
>gi|115446651|ref|NP_001047105.1|	   586 residues, 50 /line  Os02g0552100 [Oryza sativa (japonica cultivar-group)]
---------MAPALPRR---LLPWL---------RTPPSSSSAAAFSSAPSRGCPLHAAL
ARRGAPAAASLALYARIREEASPPTPFTFSLLLAALASSSSSSPSPSPSAGCARLAAACL
AHAQAFKCGA----------------------------------LAHPVVTNSLLKLYC-
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------------------------------S
--------------------LGL---LD---RARRVLYSGGAALDVVSWNTMVSGYGKGG
DLGAAREVFA--------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------RMPER----NLVSWSAMVDACVRAGEFGEALWVFDRMMR-----E
EF-RPDV-VVLVSVLKACAHLGAVERGRWVHRYLETGSFGGRRGNLMLETALVDMYCKCG
CMEDAWQVFDGV-H-RRDVVLWNAMIGGLAMNGYGERALELFRRML--QK-GFMPNESTF
IAVLCACTHTGRVDEGKRVFKSMQ---D-YGIKPQREHYGCLADLLGRAGNVEEAEALLL
DMPM-EPHA---SQWGALMSSCQMH-NDINVGERVGK--RLIELEPYD-------GGRYV
VLFNLYAVNGRWEEARTIRQMMEDRGAKKETGLSFIELN-GLVHEFISG-DTRHPLTRKI
YALLEDIERRLQ-L-IGYVKD-TSQV-IM-DMDDEEDKGIALSYHSERLALAFGILNIPQ
GVPIRIVKNLRVCRDCHVHSKLVSKLYEREIIVRDRHRFHVFRDGVCSCNDYW
>gi|115465559|ref|NP_001056379.1|	   687 residues, 50 /line  Os05g0572900 [Oryza sativa (japonica cultivar-group)]
---------MAAARACPMGVSVDQR---------RAAVAVL-------------------
----------------------------------------------RAAAAAGELSLGKA
VHARVVRAA-----------------------------------RFDVVQYNNLIALYVK
-------CGRLGLARQVFDAMP-SRN----------------------------------
-PVSGNLLMSGYA---SSGRHRD--ALAL--LR-VAD---------FGLNEYVLSSAVAA
TAH-----VRSYDMGRQCHGYAIKAG----------LAEH-------PYVCSAVLHMYCQ
--------------------CAH---MD---EAVKV-FD---------------------
----------NVSS--F-NVFAFNSMINGFLDR-GQM---DGSTSIVRSMVRN------V
GQ-WDHVSYVAVLGHCAST----KEVVLGSQVHTQALKRRLELNVYVGSALVDMYGKCDF
--PHEANRVFEVL-PE-KNIVSWTAIMTA-------------------------------
-----------------------------------YTQNELFEDALQLFLDMEM-----E
GV-RPNE-FTYAVALNSCAGLATLKNGNALGACTMKT---GHWGLLPVCNALMNMYSKSG
SVEDARRVFLSM-P-CRDVVSWNSIIIGYAHHGRAREAMEAFHDML--FA-EEVPSYVTF
IGVLSACAQLGLVDEGFYYLNIMMK--E-VGVKPGKEHYTCMVGLLCRVGRLDEAERFIE
SNCI-GTDV---VAWRSLLSSCQVY-RNYGLGHRVAE--QIFQLKPKD-------VGTYV
LLSNMYAKANRWDGVVKVRRLMRELGVRKEPGVSWIQVG-SEVHVFTSE-DKKHPYMEQI
TKKLQELIDKIK-V-IGYVPN-IAVA-LH-DVEDEQ-KEEHLMYHSEKLALAFGLIRTPK
GEAIRIMKNVRICDDCHVAIKLISLATGRRIVVRDTVRFHCIEDGVCSCDDYW
>gi|115468940|ref|NP_001058069.1|	   615 residues, 50 /line  Os06g0613100 [Oryza sativa (japonica cultivar-group)]
---------MLAARGLL-------------------------------------------
----------------------------------------------RPEAAARGLALQRC
FVAPLRA-----------------------------------------------------
------------------------------------------------------------
----------------------------------ASGMALPG----ASARFHEYEAAITA
CIE-----RRALWEGRQVHARMITAR----------YRPA-------VFLGTRLVTMYVR
--------------------CGA---LD---DARNV-LD---------------------
----------RMPE--R-SVVSWTTMISGYSQT-ERH---VEALDLFIKMLRA------G
CI-PNEYTLATVLTSCSGP----QSIYQGKQVHSLLVKTNFESHMFVGSSLLDMYAKSEN
--IQEARRVFDTL-PE-RDVVSCTAIISG-------------------------------
-----------------------------------YAQKGLDEEALDLFRQLYS-----E
GM-QCNH-VTFTTLVTALSGLASLDYGKQVHALILRK---ELPFFVALQNSLIDMYSKCG
KLLYSRRVFDNM-L-ERSVVSWNAMLMGYGRHGLGHEVISLFKDLH---K-EVKPDSVTL
LAVLSGCSHGGLVDEGLDIFDTVVK--E-QSALLHTGHYGCIIDLLGRSGRLEKALNLIE
NMPF-ESTP---SIWGSLLGACRVH-ANVHVGELVAQ--KLLEMEPEN-------AGNYV
ILSNIYAAAGMWKDVFKVRKLMLEKTVTKEPGQSWIILD-KVIHTFHSS-ERFHPSKKDI
NAKIKEIFVDIK-A-AGFVPD-LSCV-LH-DVDDEQ-KERMLLGHSEKLAITFGLMNTPP
GLTIRVMKNLRICVDCHNFAKFVSKVYEREISLRDKNRFHLLTHGNCTCGDYW
>gi|115474825|ref|NP_001061009.1|	   613 residues, 50 /line  Os08g0153600 [Oryza sativa (japonica cultivar-group)]
---------MILCRCPFLASA---------------------------------------
------------------------------------------------------------
---------R----------------------------------SHTCSLSTVAVAAAVR
-------RGDLTGAEEAFASTP-RKT----------------------------------
-TATYNCLLAGYA---RA------------------------------------------
------------------------------------------------------------
--------------------LGR---LA---DARHL-FDRIPTPDAVSYNTLLSCHFASG
DADGARRLFASMPV--R-DVVSWNTMVSGLSKS-GAV---EEAKAVFLAMPVR-------
----NSVSWNAMVSGFACS----RDMSAAEEWFRNAPEKG---DAVLWTAMVSGYMDIGN
--VVKAI-----------------------------------------------------
-----------EYFEAMPVR----NLVSWNAVVAGYVKNSHADDALRLFRTMVR----EA
NV-QPNA-STLSSVLLGCSNLSALGFGKQIHQWCMKL---PLSRNLTVGTSLVSMYCKCG
DLSSACKLFGEM-H-TRDVVAWNAMISGYAQHGDGKEAINLFERMK--DE-GVEPNWITF
VAVLTACIHTGLCDFGIRCFEGMQE--L-YGIEPRVDHYSCMVDLLCRAGKLERAVDLIR
SMPF-EPHP---SAYGTLLAACRVY-KNLEFAELAAG--KLIEKDPQS-------AGAYV
QLANIYAGANQWDDVSRVRRWMKDNAVVKTPGYSWIEIK-GVMHEFRSN-DRLHPQLYLI
HEKLGQLAERMK-A-MGYVPD-LDFV-LH-DVDETL-KVQMLMRHSEKLAISFGLISTAP
GMTLRIFKNLRVCGDCHNAAKVISKIEDREIILRDTTRFHHFRGGHCSCGDYW
>gi|11994419|dbj|BAB02421.1|	   694 residues, 50 /line  selenium-binding protein-like [Arabidopsis thaliana]
---------MSEASCLASP-LLYTN---------SGIHSDSFYA----------------
----------------------------------------------SLIDSATHKAQLKQ
IHARLLVLGL----------------------------------QFSGFLITKLIHASSS
-------FGDITFARQVFDDLP-RPQ----------------------------------
-IFPWNAIIRGYS---RNNHFQD--ALLM--YSNMQL---AR----VSPDSFTFPHLLKA
CSG-----LSHLQMGRFVHAQVFRLG----------FDAD-------VFVQNGLIALYAK
--------------------CRR---LG---SARTV-FEGLP------------------
-----------LPE--R-TIVSWTAIVSAYAQN-GEP---MEALEIFSQMRKM------D
VK-PDWVALVSVLNAFTCL----QDLKQGRSIHASVVKMGLEIEPDLLISLNTMYAKCGQ
--VATAKILFDKM-KS-PNLILWNAMISG-------------------------------
YAKNGYAREAI-----------------------------------DMFHEMIN-----K
DV-RPDT-ISITSAISACAQVGSLEQARSMYEYVGRS---DYRDDVFISSALIDMFAKCG
SVEGARLVFDRT-L-DRDVVVWSAMIVGYGLHGRAREAISLYRAME--RG-GVHPNDVTF
LGLLMACNHSGMVREGWWFFNRMA---D-HKINPQQQHYACVIDLLGRAGHLDQAYEVIK
CMPV-QPGV---TVWGALLSACKKH-RHVELGEYAAQ--QLFSIDPSN-------TGHYV
QLSNLYAAARLWDRVAEVRVRMKEKGLNKDVGCSWVEVR-GRLEAFRVG-DKSHPRYEEI
ERQVEWIESRLK-E-GGFVAN-KDAS-LH-DLNDEE-AEETLCSHSERIAIAYGLISTPQ
GTPLRITKNLRACVNCHAATKLISKLVDREIVVRDTNRFHHFKDGVCSCGDYW
>gi|124360204|gb|ABN08217.1|	   596 residues, 50 /line  Tetratricopeptide-like helical [Medicago truncatula]
---------MVDPQHQLQLPHSFNQ---------Q-------------------------
-----------------------PLYRNLCNTL-------------LSLTF---------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------SRSLPKGLQLHAHIIKLG----------LQTI-------PLLSHHLINFYSK
--------------------THL---PY---SSLQI-FH---------------------
----------DSPH--K-SATTWSSVISSFAQN-DLP---LLSLNYFRLMLRQ------G
VP-PDDHIFPSATKSCGIL----SSLPVAKMLHCFALKTAYHLDIFVGSSVIDMYAKCGD
--ICYAHNVFDEM-PY-RNVVSWSGLIYG-------------------------------
-----------------------------------YVQLGEDDESLRLFKRFLV----EE
ENEGVND-FTLSSVLRVCGGSTLLQMGRLIHGLSFKT---SFDSSCFVASSLISLYSKCG
VVEEAYDVFEEV-T-VRNLGMWNAMLIACAQHAHTDKTFELFDKMK--SVGGMKANFITF
LCVLYACSHAGLVEKGKYYFELMK---D-YGIEPGTQHYSTMVDLLGRAGKLNDAVKLIE
EMPM-EPTE---SVWGALLTGCRLH-GNTKLASYVAD--RVSELGSVS-------SGLHV
MLSNAYAAAGRWEEAAKARKMMRDRGIKKETGLSWVEEG-NRIHTFAAG-DRSHAKSVEI
YDKLDELGEEMD-K-AGYVAD-TSFV-LK-EVDGEE-KSRSIRYHSERLAIAFGFITFPH
GQPIRVMKNLRVCGDCHTAIKFISKCTGRVIIVRDNNRFHRFEDGKCTCGDYW
>gi|124360227|gb|ABN08240.1|	   687 residues, 50 /line  Tetratricopeptide-like helical [Medicago truncatula]
---------MVPPSLPTNIP----------------------------------------
------------------------------------------------------------
-----------------------------------------------SHLGLRLIRVALN
-------VGDFNRARQLFDNIP-QPD----------------------------------
-PTTCSTLISALT---THGLSNE--AIKI--YSSLQE---RG----IKPDMPVFLAAAKA
CAV-----SGDALRVKEVHDDATRCG----------VMSD-------VFVGNALIHAYGK
--------------------CKC---VE---GARRV-FD---------------------
----------DLVV--R-DVVSWTSLSSCYVKC-GFP---RKGMDVFREMGWS------G
VK-PNPMTVSSILPACAEL----KDLKSGKEIHGFAVRHGMVVNLFVCSALVSLYAKCLS
--VREARMVFDLM-PH-RDVVSWNGVLTA-------------------------------
YFKNKEYEKGFSLFLKMSRDGVRADEATWNAVIGGCMENGRSEEAVEMFRKMQK-----M
GF-KPNE-ITISSILPACSFSENLRMGKEIHCYVFRH---WKVGDLTSTTALLYMYAKCG
DLNLSRNVFDMM-R-RKDVVAWNTMIIANAMHGNGKEALFLFDKML--LS-RVQPNSVTF
TGVLSGCSHSRLVEEGVQIFNSMGR--D-HLVEPDANHYSCVVDIYSRAGRLNEAYKFIQ
GMPM-EPTA---SAWGALLAACRVY-KNVELAKISAK--KLFEIEPNN-------PGNYV
SLFNILVTAKMWSEASQVRILMKERGITKTPGCSWLQVG-NKVHTFVVG-DKSNIESDKI
YNFLDELVEKMK-M-AGYKPD-TDYV-LQ-DIDQEE-KAESLCNHSEKLAVAFGILNLNG
QSTIRVFKNLRICGDCHNAIKYMSKVVGVIIVVRDSLRFHHFKNGNCSCKDLW
>gi|125532805|gb|EAY79370.1|	   681 residues, 50 /line  hypothetical protein OsI_033329 [Oryza sativa (indica cultivar-group)]
--------------------MHLPV---------FLDDPRRLLS----------------
----------------------------------------------SSAAASASARTLAR
LHALLIVSSS----------------------------------ATHT-LISSLAAAYAR
-------AGDLAAAESTLTATAASSS----------------------------------
-IAAWNAIIAAHS---RRGSPAS--ALRV--FRALP----PA----ARPDSTTFTLALSA
CAR-----LGDLRGGESVRDRAFDAG----------YKDD-------VFVCSSLLHLYAR
--------------------WGA---MG---DAVKV-FD---------------------
----------RMPR--R-DRVTWSTMVAGFVSA-GQP---LDAIQMYRRMRED------G
VK-GDEVVMIGVIQACTAA----RNVRMGASVHGHLLRHGMRMDVVTATSLVDMYAKNGL
--LDVACRVFGLM-VH-RNDVSWSAMISG-------------------------------
-----------------------------------FAQNGQSDEALRLFRNMQA-----S
GI-QPDS-GALVSALLACSNIGFLKLGRSVHGFIVRR----FDFNCILGTAAIDMYSKCG
SLASAQMLFNMI-S-DRDLILWNAMIACCGAHGRGQDALTLFQEMN--ET-GMRPDHATF
ASLLSALSHSGLVEEGKLWFGCMVN--H-FKITPAEKHYVCLVDLLARSGLVEEASDLLT
SMKA-EPTV---AIWVALLSGCLNN-KKLELGESIAD--NILELQPDD-------VGVLA
LVSNLYAATKKWDKVRQVRKLMKDSGSKKMPGCSSIEIR-GTRHAFLME-DQSHPQREEI
VSKVAKLDLEMR-K-MGYIPR-TEFV-YH-DLEEEV-KEQQLSYHSEKLAIAFGLLNTGP
GTRLVIIKNLRVCGDCHDAIKYISKIADREIVVRDAKRFHHFKDGVCSCRDYW
>gi|125546238|gb|EAY92377.1|	   602 residues, 50 /line  hypothetical protein OsI_013610 [Oryza sativa (indica cultivar-group)]
---------MPPLVSSPSAPRLSPS---------AARAAEQHCL----------------
----------------------------------------------RLLAASST------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------PTSLLQSVAFLLKSG----------LHANSL-------VLTRLFAASAS
--------------------AAP---AL--LDP---------------------------
---LVAALLRPSVP--L-DAFLANTLIRAHATS-PIHSLRLRAAAFFPLMLRG------A
VV-PNKFTFPFLLKACAALP---GSPDVGLQAHAAALKFGFATDQYVSNTLIHMYSCFGG
GFLGDARNVFDRM-PK-ESAVTWSAMIGG-------------------------------
YVRG-----------------------------------GLSSDAVELFREMQA-----N
GV-QADE-VTVIGVLAAATDLGALELARWVRRFVERE---GIGKSVTLCNALIDTLAKCG
DVDGAVAVFEGM-Q-QRSVVSWTSVIDALAMEGRGKEAVRVFEEMK--VA-GVPPDDVAF
IGVLTACSHAGMVDEGCGYFDAMKV--E-YGIEPKIEHYGCMVDMFGRAGMVERAMEFVR
TMPI-QPNP---VIWRSLVSACRAH-GRLELGESITR--SLLHEYPAH-------EANYI
MLSNVFALTQRWKEKSEIRREMSKRGIKKVPGCSIVELD-GEVHEFIAG-DESHPQYKDI
YRMVEEMARELR-R-VGHIAA-TSEV-LL-DLDEED-KEGALQWHSEKLAIAFALLRTPP
GTQVRVVKNLRVCSDCHAAIKCISQVYRREIVVRDRSRFHRFKDGSCSCKDFW
>gi|125547017|gb|EAY92839.1|	   702 residues, 50 /line  hypothetical protein OsI_014072 [Oryza sativa (indica cultivar-group)]
---------MLAGGHPLTSFT--------------LVSVLRAVS----------------
----------------------------------------------HLPAAAAAVRLGRE
AHAFALKNGL--------------------------------LHGHQRFAFNALLSMYAR
-------LGLVADAQRLFAGATPGRG----------------------------------
DVVTWNTMVSVLV---QSGMFDE--AVQT--LYDMVA---LG----VRPDGVTFASALPA
CSR-----LELLDVGREMHAYVIKDD---------ELAAN-------SFVASALVDMYAT
--------------------HEQ---VG---KARQV-FD---------------------
----------MVPDSGK-QLGMWNAMICGYAQA-GMD---EEALRLFARMEAE-----AG
FV-PCETTMASVLPACARS----EAFAGKEAVHGYVVKRGMAGNRFVQNALMDMYARLGK
--TDVARRIFAMV-DL-PDVVSWNTLITG-------------------------------
-----------------------------------CVVQGHVADAFQLAREMQQL--EEG
GV-VPNA-ITLMTLLPGCAILAAPARGKEIHGYAVRH---ALDTDVAVGSALVDMYAKCG
CLALSRAVFDRL-P-RRNTITWNVLIMAYGMHGLGGEATVLFDRMT--ASGEARPNEVTF
MAALAACSHSGMVDRGLQLFHAMER--D-HGVEPTPDILACVVDILGRAGRLDEAYAMVT
SMEAGEQQV---SAWSTMLGACRLH-RNVHLGEIAGE--RLLELEPEE-------ASHYV
LLCNIYSAAGQWTRAAEVRSRMRRRGVAKEPGCSWIEVD-GAIHRFMAG-ESAHPASEEV
HAHMEALWGEMV-A-RGYTPD-TSCV-LH-DMDDGD-KAAVLRCHSEKLAIAFGLLRAAP
GATIRVAKNLRVCNDCHEAAKFLSKMVGREIVLRDVRRFHHFRNGQCSCGDYW
>gi|125588087|gb|EAZ28751.1|	   698 residues, 50 /line  hypothetical protein OsJ_012234 [Oryza sativa (japonica cultivar-group)]
------------------------------------------------------------
------------------------------------------------------------
--------------------------------------------------------MFAK
-------SGRLADARGVFAEMPER------------------------------------
DAVSWTVMVVGLN---RAGRFGE--AIKT--LLDMTA---DG----FTPTQFTLTNVLSS
CAV-----TQAGAVGRKVHSFVVKLG----------LGSC-------VPVANSVLNMYGK
--------------------CGD---SE---TATTV-FERMPVRSVSSWNAMVSLNTHLG
RMDLAESLFESMPD--R-SIVSWNAMIAGYNQN-GLD---AKALKLFSRMLHE-----SS
MA-PDEFTITSVLSACANL----GNVRIGKQVHAYILRTEMAYNSQVTNALISTYAKSGS
--VENARRIMDQSMETDLNVISFTALLEG-------------------------------
YVKIGDMESAREMFGVMNNR----DVVAWTAMIVGYEQNGRNDEAIDLFRSMIT-----C
GP-EPNS-YTLAAVLSVCASLACLDYGKQIHCRAIRS---LLEQSSSVSNAIITMYARSG
SFPWARRMFDQV-CWRKETITWTSMIVALAQHGQGEEAVGLFEEML--RA-GVEPDRITY
VGVLSACSHAGFVNEGKRYYDQIKN--E-HQIAPEMSHYACMVDLLARAGLFSEAQEFIR
RMPV-EPDA---IAWGSLLSACRVH-KNAELAELAAE--KLLSIDPNN-------SGAYS
AIANVYSACGRWSDAARIWKARKEKAVRKETGFSWTHIR-SKIHVFGAD-DVVHPQRDAV
YAMAARMWEEIK-G-AGFVPD-LQSV-LH-DVDDEL-KEELLSRHSEKLAIAFGLISTPE
KTTLRVMKNLRVCNDCHAAIKAISKVTDREIIVRDATRFHHFRDGLCSCKDYW
>gi|140061725|gb|ABO81894.1|	   514 residues, 50 /line  Pentatricopeptide repeat [Medicago truncatula]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------MRS---SD----MK------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---PDSVILCTVLSACGHA----GNLSYGRTIHEFVKDNGYAIDSHLQTALINMYANCGA
--MDLARKIYDGL-SS-KHLIVSTAMLSG-------------------------------
YAKLGMVKDARFIFDQMIER----DLVCWSAMISGYAESDQPQEALKLFDEMLQ-----K
RS-VPDQ-ITMLSVISACSHVGALAQANWIHTYVDRS---GFGRALSVNNALIDMYAKCG
NLVKAREVFENM-P-RKNVISWSSMINAFAMHGNADSAIKLFRRMK--EV-NIEPNGVTF
IGVLYACGHAGLVEEGEKLFSSMIN--E-HGISPTREHYGCMVDLYCRANFLRKAIELIE
TMPF-APNV---IIWGSLMSACQVH-GEAELGEFAAK--RLLELEPDH-------DGALV
VLSNIYAKEKRWNDVGLIRKSMSYKGISKEKASSRIEIN-NQVHMFMMA-DRYHKQSDEI
YEKLDEVVSKLK-L-VGYKPS-TSGI-LI-DLEEED-KKELVLWHSEKLAVCYGLISRRN
ESCIRIVKNLRICEDCHSFMKLVSKVYQIEIVVRDRTRFHHCSGGICSCRDYW
>gi|140070676|gb|ABO84378.1|	   616 residues, 50 /line  Tetratricopeptide-like helical [Medicago truncatula]
---------MVVGRIRVLEWE---------------------------------------
-------------------------------------------AVRIIESHCTT------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------LNHAKQLHAHIYRNN----------LHQS-------SYVITNLLRFITT
--------------------LPH---IPVHTYPHLL-FS---------------------
----------QVHS--P-NPFLYSALIRAYARN-GPF---HHSIRLYTSMLNN------N
VS-PVSFTFSALFSLL-------KNPSLGSQLHLHAFLFGFVNDLYVGNTIIHMYVKFGV
--LDCARKVFDEM-PH-RDVVTWTELIVA-------------------------------
YARSGDMDSACELFVGLPVK----DMVAWTSMVTGYSQNAMPKKALQFFRKMRE-----A
GV-VTDE-ITLVGAISACAQLGVSGYADWIREIAESSR-FGSGSNVFVGSALIDMYSKCG
NVEEAYNVFKGM-K-EMNVFSYSSMIVGFAVHGRARSAIKLFYEML--EN-GIKPNHVTF
VGLFTACSHAGMVEQGQQLFGAMKE--C-YGVSPTADHYACMADLLGRAGHLEKALQLVQ
TMPM-EPNG---GVWGALLGASHIH-GNPDVAEIASR--SLFELEPDN-------LGNYL
LLSKTYALAAKWDDVSRVRKLMREKQLRKNPGCSWVEAKNGIIHEFFAG-DVKHPEINEI
KKALDDLLQRLK-C-TGYQPK-LNSV-PY-DIDDEG-KRCLLVSHSEKLALAYGLLSTDA
GSTIKIMKNLRICEDCHIVMCGASKLTGRKIIVRDNMRFHHFLNGACSCNNFW
>gi|145333528|ref|NP_001078414.1|	   595 residues, 50 /line  binding [Arabidopsis thaliana]
----------MSPFSETSVLLLPMV---------EKC-----------------------
-------------------------------------------INLLQTYGVSS------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------ITKLRQIHAFSIRHG----------VSISD------AELGKHLIFYLVS
--------------------LPSPPPMS---YAHKV-FS---------------------
----------KIEK--PINVFIWNTLIRGYAEI-GNS---ISAFSLYREMRVSG-----L
VE-PDTHTYPFLIKAVTTM----ADVRLGETIHSVVIRSGFGSLIYVQNSLLHLYANCGD
--VASAYKVFDKM-PE-KDLVAWNSVI---------------------------------
---------------------------------NGFAENGKPEEALALYTEMNS-----K
GI-KPDG-FTIVSLLSACAKIGALTLGKRVHVYMIKV---GLTRNLHSSNVLLDLYARCG
RVEEAKTLFDEM-V-DKNSVSWTSLIVGLAVNGFGKEAIELFKYME--STEGLLPCEITF
VGILYACSHCGMVKEGFEYFRRMRE--E-YKIEPRIEHFGCMVDLLARAGQVKKAYEYIK
SMPM-QPNV---VIWRTLLGACTVH-GDSDLAEFARI--QILQLEPNH-------SGDYV
LLSNMYASEQRWSDVQKIRKQMLRDGVKKVPGHSLVEVG-NRVHEFLMG-DKSHPQSDAI
YAKLKEMTGRLR-S-EGYVPQ-ISNV-YV-DVEEEE-KENAVVYHSEKIAIAFMLISTPE
RSPITVVKNLRVCADCHLAIKLVSKVYNREIVVRDRSRFHHFKNGSCSCQDYW
>gi|147770365|emb|CAN78152.1|	   606 residues, 50 /line  hypothetical protein [Vitis vinifera]
---------MLFALSSFPIPQSPNRNQIHHV---KPQSSETLKI----------------
----------------------------------------------DLLRNFNSP-----
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------FELRQVHAQIIKTN----------APLS-------ILPLTRVGLVCAF
--------------------TPS------FHYAQQI-FE---------------------
----------CVEKQKP-ETFVWNSCLKALAEG-DSP---IDAIMLFYRLRQY------D
VC-PDTFTCSSVLRACLNL----LDLSNGRILHGVVEKVGFRSNLYLQNMIVHLYASCGE
--MGEARLLFEKM-PQ-RDVVTWNIMIAQ-------------------------------
LIKQGDHEGAYDLFSRMPER----NVRSWTSMIAGYVQCGKAKEAIHLFAKMEE-----A
GV-KCNE-VTVVAVLAACADLGALDLGMRIHEYSNRH---GFKRNVRISNTLIDMYVKCG
CLEEACKVFEEM-E-ERTVVSWSAMIGGLAMHGRAEEALRLFSDMS--QV-GIEPNGVTF
IGLLHACSHMGLISEGRRFFASMTR--D-YGIIPQIEHYGCMVDLLSRAGLLHEAHEFIL
NMPM-KPNG---VVWGALLGACRVH-KNVEMAEEAIK--HLLELDPLN-------DGYYV
VLSNIYAEAGRWEDTARVRKFMKDRQVKKTPGWSSITVD-GVVHEFVAG-EESHPDTEQI
FQRWEELLEEMR-L-KGYVPN-TSVV-LL-DIEEGE-KVKFVSRHSEKLALVFGLMNTPA
ETPIRIMKNLRICEDCHSAFQI----------------------DISNC----
>gi|147790932|emb|CAN77232.1|	   575 residues, 50 /line  hypothetical protein [Vitis vinifera]
---------------------------MEDK---K-------------------------
------------------------------------------------------------
--------------------------------------------PPAXVPLDKLQRSYA-
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------------------------------S
--------------------LGR---LD---YSVAL-FG---------------------
----------RTQN--P-SVFFWTAIIHGHALR-GLH---EQALNFYAQMLTQ------G
VE-PNAFTFSSILKLCP--------IEPGKALHSQAVKLGFDSDLYVRTGLLDVYARGGD
--VVSAQQLFDTM-PE-KSLVSLTAMLTC-------------------------------
YAKHGELDAARVLFDGMEER----DGVCWNVMIDGYTQNGMPNEALVLFRRMLK-----A
KA-KPNE-VTVLSVLSACGQLGALESGRWVHSYIENN---GIQFNVHVGTALVDMYSKCG
SLEDARLVFDKI-D-DKDVVAWNSMIVGYAMXGFSQEALQLFKSMC--RM-GLHPTNITF
IGILSACGHSGWVTEGWDIFNKMKD--E-YGIEPKIEHYGCMVNLLGRAGHVEQAYELVK
NMNI-EPDP---VLWGTLLGACRLH-GKIALGEKIVE--LLVDQNLAN-------SGTYI
LLSNIYAAVGNWDGVARLRTMMKDSGVKKEPGCSSIEVN-NKVHEFLAG-GLNHPKRKEI
YMMLEEINGWLK-S-HGYTPQ-TDIV-LH-DIGETE-KERSLEVHSEKLAIAFGLINTQP
GTTIKIVKNLRVCADCHEVTKLISKITGRKIVVRDRNRFHHFVNGSCSCGDYW
>gi|147806246|emb|CAN72195.1|	   558 residues, 50 /line  hypothetical protein [Vitis vinifera]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------MNHIYKLHARLLKTG----------HHNHP-------LALRRLLLSCAA
--------------------SA-PASLS---YARSI-FD---------------------
----------LIAF--P-DTFAFNTIIRAHADS-S-P---SFSLSLFSKMTMA------G
VS-PDHFTFPFVLKACAR-------LQTGLDLHSLLFKLGFDSDVYVQNGLIHFYGCCGF
--LDFALKAFEEM-PE-RDLVSWSSMI---------------------------------
---------------------------------ACFAKNGFGYEALALFQRMQL-----V
GTVKPDE-VIVLSVVSAISILGDLELGKWIRGFISRN---GLEFTVSLGTALVDMFSRCG
CIEESMRVFDEM-G-ERNVLTWTALINGLAVHGRSAEALRMFYEMR--NH-GFQPDHVTF
TGVLVACSHGGLVSEGWHVFESIRN--E-YGMEPLPEHYGCMVDLLGRAGLLNEACKFVD
GMPI-RPNS---IIWRTLLGACVNH-NYIELAEKVKE--KINELDSYH-------DGDYV
LLSNVYGGVGRWAEKAGVRNSMREKRISKKPGCSLINVN-HLIHEFVAG-DNNHPQFESI
REFLVSMIDSLK-V-VGYTPD-ISNV-LF-DIEEEE-KESTLGYHSEKLAVAFALLCFKD
SRTIRVMKNLRICHDCHCFMKYASDVFEREIIIRDRNRFHHFSKGSCSCRDYW
>gi|147811587|emb|CAN70294.1|	   562 residues, 50 /line  hypothetical protein [Vitis vinifera]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------MEEFKQSHARILKXG----------LFXD-------SFCASNLVATCAL
--------------------SD-WGSMD---YACSI-FR---------------------
----------QMDE--P-GSFZFNTMMRGHVKD-MNT---EEALITYKEMAER------G
VK-PDNFTYPTLLKACARL----PAVEEGMQVHAHILKLGLENDVFVQNSLISMYGKCGE
--IGVCCAVFEQM-NE-RSVASWSALITA-------------------------------
-----------------------------------HASLGMWSDCLRLLGDMSN-----E
GYWRAEE-SILVSVLSACTHLGALDLGRSVHGFLLRN---VSGLNVIVETSLIEMYLKCG
XLYKGMCLFQKM-A-KKNKLSYSVMISGLAMHGYGREGLRIFTEML--EQ-GLEPDDIVY
VGVLNACSHAGLVQEGLQCFNRMKL--E-HGIEPTIQHYGCMVDLMGRAGKIDEALELIK
SMPM-EPND---VLWRSLLSASKVH-NNLQAGEIAAK--QLFKLDSQK-------ASDYV
VLSNMYAQAQRWEDVARTRTNMFSKGLSQRPGFSLVEVK-RKMHRFVSQ-DAGHPQSESV
YEMLYQMEWQLK-F-EGYXPD-TTQV-LC-DVDEEE-KKQRLSGHSQKLAIAYALIHTSQ
GSPVRIVRNLRMCNDCHTYTKLISIIFDREITVRDRHRFHHFKDGACSCRDYW
>gi|147832325|emb|CAN66581.1|	   622 residues, 50 /line  hypothetical protein [Vitis vinifera]
---------MAPILCTPT----------SQL---SSESNAAQTL----------------
----------------------------------------------HLLQRCSN------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------MEELRQIHGQMLKTG----------LILD-------EIPASKLLAFCAS
--------------------PN-SGSLA---YARTV-FD---------------------
----------RIFR--P-NTFMWNTMIRGYSNS-KEP---EEALLLYHHMLYH------S
VP-HNAYTFPFLLKACSSM----SASEETQQIHAHIIKMGFGSEIYTTNSLLNVYSKSGD
--IKSARLLFDQV-DQ-RDTVSWNSMIDG-------------------------------
YTKCGEIEMAYEIFNHMPER----NIISWTSMISGCVGAGKPKEALNLFHRMQT-----A
GI-KLDN-VALVSTLQACADLGVLDQGKWIHAYIKKH---EIEIDPILGCVLIDMYAKCG
DLEEAIEVFRKM-E-EKGVSVWTAMISGYAIHGRGREALEWFMKMQ--TA-GVEPNQMTF
TGILTACSHAGLVHEAKLLFESMER--I-HGFKPSIEHYGCMVDLLGRAGLLKEAEELIE
NMPV-KPNA---AIWGALLNACHIH-GNLELGKQIGK--ILIQVDPGH-------GGRYI
HLASIHAAAGEWNQAARVRRQMKEQGVSKLPGCSVISVN-GTAHEFLAG-DESHPQIKEI
DHMLEQIVERLR-E-EGYKPK-LGDL-LL-DLEDKE-KETAIHHHSEKLAVTFGLISTKP
GMTIRIVKNLRVCEDCHTVIKLISKVYAREILMRDRTRFHLFKDGNCTCGDYW
>gi|147855060|emb|CAN82371.1|	   697 residues, 50 /line  hypothetical protein [Vitis vinifera]
---------MPPVNFNFYRHLS---SNPTQR---LCPLAQ--------------------
-------------------------------------------SHASILRKLKDLKPLQQ
IHAQIITSGL----------------------------------THNTFLSNSLMNAYVY
-------CGLLADAKQIFHHTPC-KN----------------------------------
-VVSWTILISGLA---KNDCFVE--AIDV--FREMTM---GN----FKPNAVTISSVLPA
FAN-----LGLIRIAKSVHCFWVRGG----------FEGN-------VFVETALVDMYSK
--------------------FGC---MG---VARQL-FE---------------------
----------SMSE--R-NVVSWNAIVSGYSDH-GFS---EEAIDLFNLMRRK------G
LL-VDFYTIMSLIPASLSV----GCLQVGTGIHGFIIRTGYENDKHIKTALMDIYVSHNC
--VDDAHRVFSEM-FV-KDVAAWTLML---------------------------------
---------------------------------TGFSSGRHWDRAIKHFNKMLGI----Q
NL-KLDS-IVLMGILSSCSHSGALQQGRRVHALAIKT---CFANNIFVGSAVIDMYANCG
NLEDAKRFFYGM-G-EKDVVCWNAMIAGNGMNGYGTDAIDLFLQMK--GS-GLDPDESTF
VSVLYACSHAGMVYEGLQIFYHMVK--T-SHDIPNLQHYACVIDILGRAGQLDAAYSFIN
NMPF-QPDF---DVYSTLLGACRIH-GNIKLGHEISQ--KIFEMEPND-------AGYYV
LLSNMYALAGNWEGVKMTRASLRSKRLKKDPGFSSIEIN-QEIYTFMAG-EKDHPQYFKI
EGILKGLILKIK-K-AGYVPN-TNVL-LQ-DVSDDM-KKDILYHHSEKMAIAFGLMRTKP
GTIIRITKNLRTCNDCHSASKFVSKVFGRVLVIKDANRFHVFQDGVCSCRDYW
>gi|15221306|ref|NP_177601.1|	   643 residues, 50 /line  pentatricopeptide (PPR) repeat-containing protein [Arabidopsis thaliana]
-----------------------------MT---IAIH----------------------
-------------------------------------------HCL--------------
------------------------------------------------------------
------------------------------------------------------------
-------------------------------------------------------SLLNS
CKN--------LRALTQIHGLFIKYG----------VDTD-------SYFTGKLILHCAI
--------------------SI-SDALP---YARRL-LL---------------------
----------CFPE--P-DAFMFNTLVRGYSES-DEP---HNSVAVFVEMMRKG-----F
VF-PDSFSFAFVIKAVENF----RSLRTGFQMHCQALKHGLESHLFVGTTLIGMYGGCGC
--VEFARKVFDEM-HQ-PNLVAWNAVITACFRGNDVAGAREIFDKMLVRNHTSWNVMLAG
YIKAGELESAKRIFSEMPHR----DDVSWSTMIVGIAHNGSFNESFLYFRELQR-----A
GM-SPNE-VSLTGVLSACSQSGSFEFGKILHGFVEKA---GYSWIVSVNNALIDMYSRCG
NVPMARLVFEGM-QEKRCIVSWTSMIAGLAMHGQGEEAVRLFNEMT--AY-GVTPDGISF
ISLLHACSHAGLIEEGEDYFSEMKR--V-YHIEPEIEHYGCMVDLYGRSGKLQKAYDFIC
QMPI-PPTA---IVWRTLLGACSSH-GNIELAEQVKQ--RLNELDPNN-------SGDLV
LLSNAYATAGKWKDVASIRKSMIVQRIKKTTAWSLVEVG-KTMYKFTAG-EKKKGIDIEA
HEKLKEIILRLKDE-AGYTPE-VASA-LY-DVEEEE-KEDQVSKHSEKLALAFALARLSK
GANIRIVKNLRICRDCHAVMKLTSKVYGVEILVRDRNRFHSFKDGSCSCRDYW
>gi|15226158|ref|NP_180932.1|	   583 residues, 50 /line  pentatricopeptide (PPR) repeat-containing protein [Arabidopsis thaliana]
---------------------------MTTK---VAANSA--------------------
-------------------------------------------AYEAIVRAGPRV-----
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------KQLQQVHAHLIVTG----------YGRS-------RSLLTKLITLACS
--------------------A---RAIA---YTHLL-FL---------------------
----------SVPL--P-DDFLFNSVIKSTSKL-RLP---LHCVAYYRRMLSS------N
VS-PSNYTFTSVIKSCADL----SALRIGKGVHCHAVVSGFGLDTYVQAALVTFYSKCGD
--MEGARQVFDRM-PE-KSIVAWNSLVS--------------------------------
----------------------------------GFEQNGLADEAIQVFYQMRE-----S
GF-EPDS-ATFVSLLSACAQTGAVSLGSWVHQYIISE---GLDLNVKLGTALINLYSRCG
DVGKAREVFDKM-K-ETNVAAWTAMISAYGTHGYGQQAVELFNKME--DDCGPIPNNVTF
VAVLSACAHAGLVEEGRSVYKRMTK--S-YRLIPGVEHHVCMVDMLGRAGFLDEAYKFIH
QLDA-TGKATAPALWTAMLGACKMH-RNYDLGVEIAK--RLIALEPDN-------PGHHV
MLSNIYALSGKTDEVSHIRDGMMRNNLRKQVGYSVIEVE-NKTYMFSMG-DESHQETGEI
YRYLETLISRCK-E-IGYAPV-SEEV-MH-QVEEEE-KEFALRYHSEKLAVAFGLLKTV-
DVAITIVKNLRICEDCHSAFKYISIVSNRQITVRDKLRFHHFQNGSCSCLDYW
>gi|15226299|ref|NP_178260.1|	   584 residues, 50 /line  pentatricopeptide (PPR) repeat-containing protein [Arabidopsis thaliana]
--------------------------MLAKQ---TPLTKQM-------------------
-------------------------------------------LSELLRASSSKP-----
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------KQLKKIHAIVLRTG----------FSEK-------NSLLTQLLENLVV
--------------------IGD---MC---YARQV-FD---------------------
----------EMHK--P-RIFLWNTLFKGYVRN-QLP---FESLLLYKKMRDL------G
VR-PDEFTYPFVVKAISQL----GDFSCGFALHAHVVKYGFGCLGIVATELVMMYMKFGE
--LSSAEFLFESM-QV-KDLVAWNAFL---------------------------------
---------------------------------AVCVQTGNSAIALEYFNKMCA-----D
AV-QFDS-FTVVSMLSACGQLGSLEIGEEIYDRARKE---EIDCNIIVENARLDMHLKCG
NTEAARVLFEEM-K-QRNVVSWSTMIVGYAMNGDSREALTLFTTMQ--NE-GLRPNYVTF
LGVLSACSHAGLVNEGKRYFSLMVQSND-KNLEPRKEHYACMVDLLGRSGLLEEAYEFIK
KMPV-EPDT---GIWGALLGACAVH-RDMILGQKVAD--VLVETAPDI-------GSYHV
LLSNIYAAAGKWDCVDKVRSKMRKLGTKKVAAYSSVEFE-GKIHFFNRG-DKSHPQSKAI
YEKLDEILKKIR-K-MGYVPD-TCSV-FH-DVEMEE-KECSLSHHSEKLAIAFGLIKGRP
GHPIRVMKNLRTCDDCHAFSKFVSSLTSTEIIMRDKNRFHHFRNGVCSCKEFW
>gi|15227724|ref|NP_178481.1|	   630 residues, 50 /line  pentatricopeptide (PPR) repeat-containing protein [Arabidopsis thaliana]
------MKSVMSKIKLFRP-----------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------------VVTLRCSYSSTDQ---------------------
-----TLLLSEFTRLCYQRDLPR--AMKA--MDSLQS---HG----LWADSATYSELIKC
CIS-----NRAVHEGNLICRHLYFNG----------HRPM-------MFLVNVLINMYVK
--------------------FNL---LN---DAHQL-FD---------------------
----------QMPQ--R-NVISWTTMISAYSKC-KIH---QKALELLVLMLRD------N
VR-PNVYTYSSVLRSCNGM----SDV---RMLHCGIIKEGLESDVFVRSALIDVFAKLGE
--PEDALSVFDEM-VT-GDAIVWNSII---------------------------------
---------------------------------GGFAQNSRSDVALELFKRMKR-----A
GF-IAEQ-ATLTSVLRACTGLALLELGMQAHVHIVK-----YDQDLILNNALVDMYCKCG
SLEDALRVFNQM-K-ERDVITWSTMISGLAQNGYSQEALKLFERMK--SS-GTKPNYITI
VGVLFACSHAGLLEDGWYYFRSMKK--L-YGIDPVREHYGCMIDLLGKAGKLDDAVKLLN
EMEC-EPDA---VTWRTLLGACRVQ-RNMVLAEYAAK--KVIALDPED-------AGTYT
LLSNIYANSQKWDSVEEIRTRMRDRGIKKEPGCSWIEVN-KQIHAFIIG-DNSHPQIVEV
SKKLNQLIHRLT-G-IGYVPE-TNFV-LQ-DLEGEQ-MEDSLRHHSEKLALAFGLMTLPI
EKVIRIRKNLRICGDCHVFCKLASKLEIRSIVIRDPIRYHHFQDGKCSCGDYW
>gi|15228954|ref|NP_191214.1|	   581 residues, 50 /line  pentatricopeptide (PPR) repeat-containing protein [Arabidopsis thaliana]
------------------------------MCEKAR------------------------
-------------------------------------------VIVRMLQGCNSM-----
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------KKLRKIHSHVIING----------LQHH-------PSIFNHLLRFCAV
--------------------SV-TGSLS---HAQLL-FD---------------------
----------HFDS--DPSTSDWNYLIRGFSNS-SSP---LNSILFYNRMLLSSV-----
SR-PDLFTFNFALKSCERI----KSIPKCLEIHGSVIRSGFLDDAIVATSLVRCYSANGS
--VEIASKVFDEM-PV-RDLVSWNVMI---------------------------------
---------------------------------CCFSHVGLHNQALSMYKRMGN-----E
GV-CGDS-YTLVALLSSCAHVSALNMGVMLHRIACDI---RCESCVFVSNALIDMYAKCG
SLENAIGVFNGM-R-KRDVLTWNSMIIGYGVHGHGVEAISFFRKMV--AS-GVRPNAITF
LGLLLGCSHQGLVKEGVEHFEIMSS--Q-FHLTPNVKHYGCMVDLYGRAGQLENSLEMIY
ASSC-HEDP---VLWRTLLGSCKIH-RNLELGEVAMK--KLVQLEAFN-------AGDYV
LMTSIYSAANDAQAFASMRKLIRSHDLQTVPGWSWIEIG-DQVHKFVVD-DKMHPESAVI
YSELGEVINRAI-L-AGYKPEDSNRT-AP-TLSDRC-LGSADTSHSEKLAIAYGLMRTTA
GTTLRITKNLRVCRDCHSFTKYVSKAFNREIIVRDRVRFHHFADGICSCNDYW
>gi|15229561|ref|NP_189042.1|	   633 residues, 50 /line  pentatricopeptide (PPR) repeat-containing protein [Arabidopsis thaliana]
-MALRFPPRLLSQLKLSRRLNSLPAP-VSEDSED--------------------------
----------------------ESLKFPSNDLLLRTSSND--------------------
------------------------------------------------------------
------------------------------------------------------------
-------------------------------------LEGSY----IPADRRFYNTLLKK
CTV-----FKLLIQGRIVHAHILQSI----------FRHD-------IVMGNTLLNMYAK
--------------------CGS---LE---EARKV-FE---------------------
----------KMPQ--R-DFVTWTTLISGYSQH-DRP---CDALLFFNQMLRF------G
YS-PNEFTLSSVIKAAAAE----RRGCCGHQLHGFCVKCGFDSNVHVGSALLDLYTRYGL
--MDDAQLVFDAL-ES-RNDVSWNALI---------------------------------
---------------------------------AGHARRSGTEKALELFQGMLR-----D
GF-RPSH-FSYASLFGACSSTGFLEQGKWVHAYMIKS---GEKLVAFAGNTLLDMYAKSG
SIHDARKIFDRL-A-KRDVVSWNSLLTAYAQHGFGKEAVWWFEEMR--RV-GIRPNEISF
LSVLTACSHSGLLDEGWHYYELMKK----DGIVPEAWHYVTVVDLLGRAGDLNRALRFIE
EMPI-EPTA---AIWKALLNACRMH-KNTELGAYAAE--HVFELDPDD-------PGPHV
ILYNIYASGGRWNDAARVRKKMKESGVKKEPACSWVEIE-NAIHMFVAN-DERHPQREEI
ARKWEEVLAKIK-E-LGYVPD-TSHV-IV-HVDQQE-REVNLQYHSEKIALAFALLNTPP
GSTIHIKKNIRVCGDCHTAIKLASKVVGREIIVRDTNRFHHFKDGNCSCKDYW
>gi|15229764|ref|NP_187753.1|	   623 residues, 50 /line  pentatricopeptide (PPR) repeat-containing protein [Arabidopsis thaliana]
MIVVTSFVRNSAVAAV--------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
ASTPWNVRLRELA---YQSLFSE--SISL--YRSMLR---SG----SSPDAFSFPFILKS
CAS-----LSLPVSGQQLHCHVTKGG----------CETE-------PFVLTALISMYCK
--------------------CGL---VA---DARKV-FE---------------------
----------ENPQSSQ-LSVCYNALISGYTAN-SKV---TDAAYMFRRMKET------G
VS-VDSVTMLGLVPLCTVP----EYLWLGRSLHGQCVKGGLDSEVAVLNSFITMYMKCGS
--VEAGRRLFDEM-PV-KGLITWNAVI---------------------------------
---------------------------------SGYSQNGLAYDVLELYEQMKS-----S
GV-CPDP-FTLVSVLSSCAHLGAKKIGHEVGKLVESN---GFVPNVFVSNASISMYARCG
NLAKARAVFDIM-P-VKSLVSWTAMIGCYGMHGMGEIGLMLFDDMI--KR-GIRPDGAVF
VMVLSACSHSGLTDKGLELFRAMKR--E-YKLEPGPEHYSCLVDLLGRAGRLDEAMEFIE
SMPV-EPDG---AVWGALLGACKIH-KNVDMAELAFA--KVIEFEPNN-------IGYYV
LMSNIYSDSKNQEGIWRIRVMMRERAFRKKPGYSYVEHK-GRVHLFLAG-DRSHEQTEEV
HRMLDELETSVM-E-LAGNMD---------CDRGEE-VSSTTREHSERLAIAFGILNSIP
GTEILVIKNLRVCEDCHVFLKQVSKIVDRQFVVRDASRFHYFKDGVCSCKDYW

Ad blocker interference detected!


Wikia is a free-to-use site that makes money from advertising. We have a modified experience for viewers using ad blockers

Wikia is not accessible if you’ve made further modifications. Remove the custom ad blocker rule(s) and the page will load as expected.