FANDOM


>gi|18395457|ref|NP_565293.1|	   555 residues, 50 /line  nucleoside phosphatase family protein / GDA1/CD39 family protein [Arabidopsis thaliana]
MRRSHAR--------------------------SRVKNSSSSKSDMDPIKFQIRSGNRAP
--SSSSTYTLTKPNS-----KHAKSNLL-LTVGSI---------------SVVLGVL---
-----------------------------FL---CYSIL-FSGGN-LRGSLRYSVVIDGG
STGTRIHVFGYRIESGKPVFE------------FRGANYASLKLHPGLSAFADD---PDG
ASV---SLTELVEFAKGRVPKGMWIETEVRLMATAGMRLLELP---VQEKILGVARRVLK
S---SGFLF--RDEWASVISGSDEGVYAWVVANFALGSLGGD------------------
-----PLKTTGIVELGGASAQVTFVSSEPMP---------PE-----FSRTISF------
-GNVTYNLYSHSFLHFGQNAAHDKLWGSLLSRDHNS------------------------
---------AVEPTREKIFTDPCAPKGYNLDANTQKHLSGL-------LAEESRLSDSFQ
AGG-------NYSQCRSAALTILQDG--NEKCS--YQHCSIGSTFT-PKLRGRFL---AT
ENFFYTSKFFGLG-------EKA-----WLSNMISAGERFCGE--DWSKLR------VKD
PSLHE-EDLLRYCFSSAYIVSLLHDTLGIPLDDE-----------------RIGYANQAG
D----IPL---------DWALGAFIQQ--------------------TATETSQH-AASG
N--LHWFHALFSNHPKTLHYLIGIPILMTVLVYLV-T-----------------------
-----------------KWRKPQLKTIYDLE--KGRYIVT--------------------
--RI-R
>gi|111185885|gb|AAL37302.2|	   502 residues, 50 /line  ecto-nucleoside triphosphate diphosphohydrolase-1 [Torpedo marmorata]
----------------------------------------------------------MP
--EARG-GT-KSSHW-----RR---CLV-VITAVLL-------------LVVIAVLVIVA
V----------------------------------------RQNRPTPPNLKFGIVLDAG
SSHTGLFIYQWLAEKMNDTGVV------------RQ-RDSCSVKGPGISSYWAD---VEQ
AGL---SLRDCLNEAKRSIPVEQHRETPVFLGATAGMRLLRSQNSSQAEKLLQAVEAFIH
S---YPF----DFQGAQIVTGADEGAFGWITINYLMGNFLQD--------------MA-G
-----PHETVGALDLGGASTQITFVPDGEIES--------LD-----NSMHFRL------
-YGKNYEMYTHSYLCYGKDQALKMFLQKLGVSAN--------------------------
----------------GTVFNPCFNEGYEKSINVSNFFTSPCTPMPP---WTTHQTLRVI
GTG-------NSHQCRDHVRQIFNQ----SSCA--WNQCSFNGVYQ-PHVWGKYG---AI
SAFYFVMKFFNMDK------EKV-----SLDEVKVAVDKFCST--PWDQAK------NEY
-KIKE-KYLSENCFSGHYVLILLVDGYNFTSST----------------WNNIQFMKKIG
G----SDA---------GWTLGYMLNR--------------------TNMIPAEL-PRPK
-------PMSKASYLSVMIIFSLL-SFCW----SS-V-----------------------
-----------------CLYS-------------------GGRFADRDRR--IWRRDL--
-----I
>gi|113205358|gb|AAT66769.2|	   466 residues, 50 /line  Apyrase-like protein, putative [Solanum demissum]
MESAKLQ--------------------------------------Y------------RP
--SRSSHRS-PNRNS-----SKSKSRIF-CYTSIVF-------------VIAFLCYVFVF
S----------------------------------------SHVR-FSVKRKYGIVIDGG
STGTRIHVFEYEVRNGVPVYDF------------GDQGLVSMRVNPGLSAYAEE---PEM
ASE---SVGKLVEFGKQNVPQEYWSSTEIRLMATAGMRLLDSG---VQEKILEVCRGVLR
D---SGLKF--TDDWASVISGSDEGLYAWVIANYALGTLGSD------------------
-----PLQTTGIIELGGASAQVTFVSNEPMP---------PE-----YSRTIKF------
-RNFTYRIYSHSLLQFGQNVAFDLLLESLVARGHHQA-----------------------
---------P----ESVKLMDPCSPRGYPHNLIKTKFFG---------------------
------------------------------------------------------------
-----------LP-------PKA-----FLSDLMAAGKSFCEE--DWSSLK------SKY
PSLQE-EDLHRYCFSSAYILALLHDSLGIALDD-----------------DRIGYANQVE
N----IPL---------DWALGAFILQ-------------------STAELDKEH-SGWF
-------ANMFSEDSLILLLFFAF-FILV----MF-T-----------------------
-----------------AWRKDQSGSSTTSS--KNLCTLCCLVPRAKDAI--LRRGQINL
MGLL-K
>gi|115453259|ref|NP_001050230.1|	   508 residues, 50 /line  Os03g0378000 [Oryza sativa (japonica cultivar-group)]
----------------------------------------------------------MP
--DLTKPPS-PRPRR-----RRCRLCGI-CLGTALL-------------ALLVSSLAHLF
S----PPQPQPQL---------------Q---------P-PRPSP-SSSPPRFAVIIDGG
STGSRAHVFATGPGGRP---DL------------AR--SAVMRVTPGLSSFADE---PAR
AGD---SLRPLIDFAREKVGG---AAAEVRLMATAGLRLQEGR---LQEAILSSCRDVLR
A---SGFRF--EDSWAEVIPGSDEGIYAWVAANYALGTLGGD------------------
-----PHKTIGIIELGGASAQLTFVSDEVLP---------PE-----LSRNFTF------
-GGTTYTLYSNSFLNFGQNAAQESFREILRSKDS--------------------------
--------------KNGTLVDPCAPKGYSRIKEVI---SRPSSASKS----KLENQFADS
GDG-------DFTVCRSSSLALLKKG--NEECR--YQQCQLGPTFV-PELRGHFL---AT
ENFYFTSKFFGLK-------QSS-----SLSDFVLAGEQFCNK--DLSTLR------KMY
PNRSD-DDFSRYCFSSAYIVALLHDSLGVPLDD-----------------KRIEYSNQVG
D----TQV---------EWALGAFISN--------------------IKGVIVEP-SATG
-------RSAHRSRPLLAVLLGVF-LLGGAL--CL-A-----------------------
-----------------RWRKPKTKIIYDLE--KGRYIIT--------------------
--RI-S
>gi|115476580|ref|NP_001061886.1|	   537 residues, 50 /line  Os08g0436100 [Oryza sativa (japonica cultivar-group)]
MRRPNAR--------------------------------------AHHPRGESQE---AA
--ATTLAPP-PRPTI-----SSAMGSRR-ARGRRLL-------------AALLAAAFAVA
L-----------L---------------L---------L-VPRSP-RRRPHEYGVVIDAG
STGSRVHVIAYRSSSSSPASALPR---------IDWARTASMKAAPGLSSFASD---PGG
AGR---SLAPLLEFARRRVPPESWAETDVRLMATAGLRLLDAA---VAEAVLDSCRVLLR
G---SGFQF--QDDWATVISGAEEGMYAWIAANYALGTLGDD------------------
-----SQDTTGIIELGGASVQVTFVTDKPLP---------PE-----FSHTLKF------
-GDATYNLYSHSFLQLGQNVAYESLHDMLSTPGHKSM-----------------------
---------ATHLISQAKYRDPCTPRGFSPMEGAVK---LPASVLES----KVEYRPYAH
AVG-------NFSECRSAALTLLQKG--REECR--YHECRMGAAFV-PDLDGKFL---AT
ENFYHTSKFFRLR-------SKS-----FLSDLMLAGEKFCRG--DWSKIK------KEY
RSFNE-GELLLFCFSSAYIVALLHDTLKVPLDD-----------------KRIDVANQIG
G----VPV---------DWALGAFIVQKA---------------SNQTDMLHPEGEKISP
-------EDGI-------------------------------------------------
-----------------------RHGERPVH--HNQGETMSLARRRWDLVELLRWGASDR
VCKF-S
>gi|125535617|gb|EAY82105.1|	   432 residues, 50 /line  hypothetical protein OsI_036064 [Oryza sativa (indica cultivar-group)]
-----MA--------------------------------------ADHL-----------
-------------------------------VVAML-------------LLLA------L
S----PPAVADDT---------------AVL---GRKGG-VVEGQ-AAGPGRYAVILDAG
STGTRVHVFRFDNK-LDLLK-------------VGDNIELFAKVDPGLSSYAGR---PQD
AAN---SILPLLDKANTVVPARLMNKTPLKLGATAGLRLIGDE---KANQILEAVRDVVH
TK--SKYQY--NPNWINVLEGSQEGSYIWVALNYLLDKLGGD------------------
-----YSKTVGVVDLGGGSVQMAYAISSNTAA--TAP-KVPE-GKDPYVVKEYL------
-KGKDYNIYVHSYLHYGGFASRAHILER--------------------------------
---------------KDGPFSNCMLRGFSGNFTYNG---------------KQYDATAAP
HGA-------DYHKCREEVVKLLKV---NAPCE--TKNCSFNGVWN-GGG---GA---GQ
DDLYVASAFYYIA-------SHA------------VAEKVCKL--SVKEAK------VEY
PNVRD-H--AYLCMDLIYEYSLLVDGFGLHPS------------------KEITLVDKVK
HGEYYIDA---------AWPLGTAIEAVS---------------PK--------------
------------------------------------------------------------
---------------------KRLREIY--------------------------------
-----K
>gi|125586123|gb|EAZ26787.1|	   505 residues, 50 /line  hypothetical protein OsJ_010270 [Oryza sativa (japonica cultivar-group)]
MTSPPPP--------------------------------------APPPRMPRGCAGFWP
--PPGA-RQ-QQQQG-----EAVSDRVL-RFRGVLV-------------VVLAPVLLISL
VLLLMPRAPASATVEGSA------GELVAAA---GRRWGPRAVSGLGDGSTRYAVIFDAG
SSGSRVHVYCFDGNLD-LLP-------------IGKEIELFKQKKPGLSAYAMD---PQE
AAK---SLVSLLEEAEKVIPVELREQTPVRVGATAGLRALGTE---KSEEILQAVRDLLQ
DK--SSFRS--QPEWVTVLDGSQEGAFQWVTINYLLGNLGKP------------------
-----YSHTVGVVDLGGGSVQMAYAISEKDAG--KAP-PVAE-GEDSYVKELLL------
-KGTTYYLYVHSYLRYGLLAARAEILKAGEGND---------------------------
-------------------YRNCMLEGHHGQYRYGD---------------DIFEASGLS
SGA-------SYSKCRAVAVRALKVD--EPACT--HMKCTFGGVWN-GGG---GD---GQ
KNLFVASFFFDRAAEAGFVNPKAPFAKVKPSDFEEAARRVCKL--NVKDAQ------ATY
PDVSE-ENVPYLCMDLVYQYTLLVDGFGVDP------------------YQDITLVKKVP
YSNSFVEA---------AWPLGSAIEVAS---------------SS--------------
------------------------------------------------------------
------------------------------------------------------------
------
>gi|134133300|ref|NP_001077050.1|	   497 residues, 50 /line  hypothetical protein LOC100005551 [Danio rerio]
------------------------------------------------------------
----------------------MAKVAV-VLAAAFM-------------LASIAVIISIA
--VVQT----------------------------------HKKTY-VSRGLKYGIVLDAG
SSRTTVYLYEWPAEKENNTGVVSQ-------------TTKCQVQGPGISDLGLDRDQDQN
TWY---SLKECMKKMTEAIPSHQHNSTPVFLGATAGMRLLHMTNEGRSNDVLTQMKNYLS
S---LPFK----FQNASIISGQEEGLYGWITVNYLKGNFLEK---------NLWNAWV-H
PH---GAKTVGSLDLGGASTQIAFATSDDAK---------GE-----DIIKVSL------
-YGYEYNIYTHSFLCYGKNEAEKRVLAKLAKEPI--------------------------
--------------NWANVKHPCFPTGYNTSIPAEEIFGSECTKNNVPSRYDPKRSITFF
GQS-------NPEQCKALVRSIFDL----TSCQ-GTENCSFDGVYQ-PPLNGDFT---AY
AGFYWTALALKVN-------GSN-----SMEKFNTNMKLFCSN--DWKNLK------QNY
EN-KD-SHLKSFCYSANYVHTILADGYKFNTDN----------------WENLEFSKEVN
N----TSI---------AWSLGYMLAL--------------------SNMIPAEG-KIIK
L------PINNVLFTGLLLLFSVL-TII-TL-----------------------------
-----------------------------------------------------TYLVIAL
VRYC-Y
>gi|145495746|ref|XP_001433865.1|	   433 residues, 50 /line  hypothetical protein [Paramecium tetraurelia]
------------------------------------------------------------
--------------------------------MIIF-------------LVIAPALSYL-
-----------------------------ID---QHYQP-LNWFQ-YGDTVCYGVMFDAG
SSGTRVYVYSWSCRENKTMAYINI-----------TEKSLEYKVEPGIDSFGKD---LDS
LKS---YINELIQFAYENVPYTMHKYTPIMLAATAGMRMIPTY---YQIQIISTIRDLFR
S---SKFLFH-RDDWCRIITGQEEGAYMWLSINYMIGKLGIT------------------
-----DNEHALTVDLGGGSTQLAFKPQSTIDK--S------------EVNLRIP------
-NHNQYKIYSQSYLYYGIDQAKKAIFEKEINKLD--------------------------
-------------KNNLVYQSPCFPNGYRNNYRYNK-------------------SYIII
GTG-------NINNCLELINQYLNND--KSKCI--YENCGINGVYQ-PEIDSELI--YAL
GGVSFMAEFLNL--------EQY-----TLEQYFINAVKFCSL--SYEEIQ------KHE
AYGRN-KYSNGNYFSVLYVYSLLSHGYGIKEN------------------QLIRSPKLIG
N----ITP---------TWTLAAMFYQ--------------------IAQIDCEQ-DSPI
C-----------------------------------------------------------
------------------------------------------------------------
STIMNN
>gi|145499478|ref|XP_001435724.1|	   430 residues, 50 /line  hypothetical protein [Paramecium tetraurelia]
------------------------------------------------------------
------------------------------MIQILL-------------LLGVA------
-IAN----------------------NLRFR---AKGTI-PNLW-NIQASTCYGVMFDAG
SSGTRVYVYSWNCRETQTMPYVSL-----------SEKSIEKKVKPGISSFATK---LNE
IPA---YLQPLIDFALSNIPKSMKAYTPIMLGATAGMRLLPVE---SQTQIMKEVQRVFL
KS---GLLFL-SEQWARVITGQEEGAYMWLSLNYLLQTMSDQ------------------
-------QQVTTIDLGGASTQISFKPKGKIED--------------GMMDLIIP------
-NLNEYEIFSSSYLLFGMDQALIQVHKQFQDND---------------------------
---------------TFTITTPCYFSGYENVYEY-------------------DARFKVI
GQG-------NYQECRRLIRQYLNND--PEKCQ--HSNCGINGQYQ-PKIDGDII--YGI
SGIQSMVNLFGF--------ENY-----TLTQYSNKVVSFTSL--VWSDIE------QIP
EYISN-PYITTDYFSSIYVDELLSYGYGISRD------------------QLLYSPDEIN
N----ISP---------SWTVAAMFYQ--------------------LAQIQCQY-DSPV
C-----------------------------------------------------------
------------------------------------------------------------
IQLI-K
>gi|145612185|ref|XP_362563.2|	   549 residues, 50 /line  hypothetical protein MGG_08146 [Magnaporthe grisea 70-15]
MRRTSVS------------------------------LPTNNKVARDPYEKRARYEANQR
--EVGLFEKITEAMS-----QARQTRWF-KTLAVLV-------------VILFLFFFL--
----SPSGGVDLYKSGAASPNSGQAPADASY---GTDKCTRSFS-KDKPIVQYVLMIDAG
STGSRIHVYKFNNCGAAPELENEV-----------FKQTEKREGGSGLSAYPDD---PEA
AAK---SLDVLMEAAVKEVPEKLRSCTPVAVKATAGLRLLGDV---KSGKILEAVRRHLE
ND--YPFPVVADQSGVSIMDGKDEAIYAWVTVNYLLGKIGG-------------------
PD---KSETAAVLDLGGGSTQIVFEPTFKGAP--NGG-MPTKLAEGDHKYELQF------
-GGRHFELYQHSHLGYGLMSAREAIFKALIDEIYSSKK----------------------
---------GDKSWLNAPVVNPCFGAGMTKTIKVKFGEGHP-------LGKEMEINMTGP
KSG-------APAQCRALAEKILKKD---AECK--LAPCSFNGVHQ-PSIAKTF----AK
EDMYFLSYFTDRAEALGM-PESF-----SLKEMRDLAEQVCGGKESWGVFS------GVK
GALEELEGRPEYCLDLNFMLALVHTGYEMPID------------------REVKVAKKIK
G----NEL---------GWCLGASLPLLA---------------KGS-------------
------------------------------------------------------------
-------------------------------------------------------GWTCK
IAEV-H
>gi|146081775|ref|XP_001464341.1|	   425 residues, 50 /line  nucleoside diphosphatase, putative [Leishmania infantum JPCM5]
----------------------------------------------------------MR
--PYSSVRR-MTQQS-----KR-----L-RIAGTLV-------------LSALVIFGFL-
-----------------------------VY---YQSPL-LSPCD-SAYANVYDVVIDAG
STGSRVHVFQYERGR---TGLVLL-------------RERFKRVEPGLSSFATD---PDG
AKE---SLAGLLRFADKVVPQSYQKCTFVTLKATAGLRLLPES---VQQVLLDAAQHTLN
A---SPF----QSRGASIISGAQEGVYGWLTVNYLLNRLDTD------------------
------VATVATIDMGGASTQVVFETTPTSGE--WLP---FN-----YAHQLRT------
-PKRTITMYQHSYLGLGMNEAKKKLMMSFAEAN---------------------------
----------------GTSSFPCFPRGYAKRLNDVELRN--------------------S
DAT-------DFDACAGLFREHVIT---KTTCK--FDACGARGVPQ-PLFPSR------R
HLIYAFSYFYDRLYHFSKEGSPV-----YVSSYKEVGQEVCHRES---------------
ARRTT-APEETACMELAYMYSFLTYGLGLSDA------------------TALTVPNRIE
G----MAV---------SWSLGSSLSFLL---------------KME-------------
------------------------------------------------------------
------------------------------------------------------------
------
>gi|147866651|emb|CAN81571.1|	   553 residues, 50 /line  hypothetical protein [Vitis vinifera]
MEQLKLQ------------------------------MR---------------------
--PNATARA----QK-----NATRSNLV-VL--ILL-------------ATVIAAFFLLL
VLVC------------------------------------NSRNS-MRRGKKYGIVIDGG
STGTRIHVFGFELDGGG-RPVFD----------FGKKGLGSMRVSPGLSSYAED---PNR
SGG---SLVELLEFGKSRVPKEHWGDTEIRLMATAGLRRLELR---VQEAILESCRRVLR
V---SGFQF--RDSWASVITGSDEGIYAWVVANHALGSLGGD------------------
-----PRETTGIIELGGASAQVTFVSSEPVP---------PE-----FSHTLRF------
-GNVTYNLYSHSLLDFGQNVALESLQKSLYSTDLMGFLPSKWWAWSLIFHGLGIGILSEL
LTLSFLHA-AAESLQKGILIDPCTPKGYS-------------------LDGKNEYSSAIH
AQG-------NFSECRAAALTLLQKG--K------------GSTFM-PKLQGKFL---AT
ENFFYTSKFFGLG-------SRA-----FLSDLTVAGQHFCEE--DWSKLK------RKY
YSFNE-EDLLHYCFSSAYIVAFLHDSLGIALDDER--------------FSHLYILAAH-
-RNASVEEMWDQNVGEGGWNLRFIRDFND------------WEVEMVGNLLQVLR-GFKI
T------WEE-----------------------DS-V-----------------------
-----------------FWKGGGNGQFRVKEAYSRLDRPLEVVFSKNKIW---VERVPTK
IMFF-A
>gi|16518970|gb|AAL25086.1|AF426405_1	   493 residues, 50 /line  ecto-ATP-diphosphohydrolase [Gallus gallus]
-----ME------------------------------YK---------------------
----------------------GKVVAG-LLTATCV-------------FSIIALILSAV
D---------------------------------------VKDV-FLPPGTKYGLVFDAG
STHTALYVYQWPADKENGTGIVSQ-------------VESCTVNGSGISSYADD---PAG
AGA---SLKPCLDKAMAVIPVEQQWQTPTYLGATAGMRLLREQNSTKAEQVFAEVSKAIR
E---FPV----DFRGAQILTGNEEGSFGWITVNYLLETLIKF---------SFAGKWE-H
PQ---NTEVLGALDLGGASTQITFQPGVTIED-------------KNTSVLFRL------
-YGTNYSLYTHSYLCYGQIQASKRLMAALHQDGS--------------------------
--------------YVQNISHPCYPKGYQENITIAEIYDSPCVPT--PSMLSPAQILTVT
GTG-------NPAACRTAILKLFNFT----CGA--NRTCGFDGVYQ-PPVRGQFF---AF
AGFYYTFSFLNLT-------GQQ-----SLSHVNATVWDFCNK--NWSELV------ETF
PQ-NK-EHLHTYCVVGLYILTLLVDGYKFDEHT----------------WSNIHFSQKAG
N----ADI---------GWTLGFMLNL--------------------TNMIPTEA-LEHV
K------GQQPSLWAGAISFIVLA-IVA-GL-----------------------------
-----------------------------------------------------VAILLQC
FWKS-K
>gi|17539006|ref|NP_501289.1|	   485 residues, 50 /line  Nucleoside TriPhosphatase family member (ntp-1) [Caenorhabditis elegans]
------------------------------------------------------------
------------------------------------------------------------
-----MSGGSSERVQRS----------------------VRSVV-ETKNNIKYGVICDAG
SSGTRLFVYTLKPLSGGLTNIDTL---------IHESEPVVKKVTPGLSSFGDK---PEQ
VVE---YLTPLLRFAEEHIPYEQLGETDLLIFATAGMRLLPEA---QKDAIIKNLQNGLK
SV--TALRV--SDSNIRIIDGAWEGIYSWIAVNYILGRFDKE------------------
-----NDSKVGMIDMGGASVQIAFEIANEKES--------YN---GGNVYEINL-GSIET
NEDYKYKIYSTTFLGYGANEGLKKYENSLVKSG---------------------------
-----------------NSNDSCSPRGLNRLI----------------------GEFTVN
GTG-------EWDVCLAQVSSLIGDKA-QPSCP--NPTCFLRNVIA-PSVNLSTVQLYGF
SEYWYTT------SNFGS-GGEY-----HYQKFTDEVRKYCQK--DWNDIQDGF-KRNEF
PNADI-ERLGTNCFKAAWVTSVLHDGFNVDKTKH-----------------LFQSVLKIA
G----EEM---------QWALGAMLYH--------------------SKDLKFNL-LEQL
E------VAQSTQQISNFFSFFVI-LIIVLA-----V-----------------------
-----------------ALYRQLQSESTYKK--YNF-----LRTDSKPD-----------
--FLNV
>gi|19075701|ref|NP_588201.1|	   572 residues, 50 /line  hypothetical protein SPCC11E10.05c [Schizosaccharomyces pombe 972h-]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------MVRKYGIFIDAG
SSGSRLLIYSWDYDTDSSLSDKVKKLPLIETG-IGDGGKWSLKVQPGISSFANN---PKH
VGKK--HLKELLDFAAHAIPKDVHKETPVFLSATAGMRLLGVD---AQNKILSHACRYIK
KN--YDFDIPNCSNSIRVIDGKAEGMYGWLATNYLLKTLEEK------------------
-----DTSTVGFLDMGGASVQIAFELPPSQLK--NYK----------DSISTVHIGL-QN
GQQLEYPLFVTTWLGFGANEAYRRYLGLLIESENGK------------------------
--------------VGNTLSDPCSLRGRTYDID----------------------GIEFA
GTG-------DLKQCLKLTYNLLNKD---KPCS--MDPCNFDGISI-PPVDFANTEFVGV
SEFWYTTN-----DVFDM-GGSY-----HFPNFYKKVDEYCGT--EWETMLSRLYNKELT
PSTDE-NKLEKLCFKASWALNVLHEGFDVPKSNTSSNDAKDGLSVIPAYHSPFTSLEKIE
R----TEV---------SWTLGQVLLYASNQQLLAKPEYANYYMDPYGKLIASPS-----
---KHWMRLFPNKL-----FFILSFIFCLFFLFSL-VLFGYDPKRRQRFKKFLLRLQRRK
APYIMSANGSYEDIADFSDDLEMSSPSKWHG--PPIRTTSSHVLADRLSF--TASRERTP
RSPF-P
>gi|26892020|gb|AAN83921.1|	   427 residues, 50 /line  hypothetical protein [Aplysia californica]
------------------------------------------------------------
----------------------------------ML-------------YLAVALLVVVS
---------------------------------------VGGLS-LPQQHVEYGVMFDAG
STGTRVRIYSYTWDNSVPLGIKNM------------VQVSSMKVRPGLSSLLNN---VSG
IQN---YLQPLMDMASSSVPKAQQAETPILFMATAGMRFEPQD---ESEKVLDEVRRLFR
HPSFNPFNY--TQPNVQVLSGEEEGVYAWVALNYILGYFDS----------------I-K
P----VNETAGIMEMGGGSTQIAFIPEDQ----------PYE-----GEYSVIL------
-AKRKFDLYVHSYLNYGTNGIQRQVAEELVRI----------------------------
----------------QEPDNPCVLKGDSKSFLLQK-----------------GSYVQMN
GTG-------EPNFCELLLWPLIEPEY-GIECE--PKPCAIKNQYM-PELPSI--PFYAL
QGFAYAAK------DLGVLGEESS---LDLRKMLENGTEYCRQ--TLQEAI------AAG
AS---LEYASQNCLISLYTPLLLEGVYNVREV------------------NQLKAPLDIN
G----RRI---------EWAMGALIVD--------------------ISEMKTGI-YSAV
S-----------------------------------------------------------
------------------------------------------------------------
PRRR-R
>gi|30520059|ref|NP_848791.1|	   529 residues, 50 /line  ectonucleoside triphosphate diphosphohydrolase 3 [Mus musculus]
---------------------------------------------------MFTVMTRQP
--C-------EQAGF-----RALSRTPA-IVTLVVL-------------LVSIVVLVTLT
--LIQ----------------------------------IRHPQ-VLPPGLKYGVVLDAG
SSRTTVYVYQWPAEKENNTGVVSQ-------------TFRCSVKGSGISSYENN---PQD
APK---AFEDCILKVKEQVPEHLHGSTRIYLGATAGMRLLRLQNETAAREVLESIQSYFK
S---QPF----DFRGAQIISGQEEGVYGWITANYIMGNFLEK---------NLWHMWV-H
PH---GVDTTGALDLGGASTQISFVAGEKMEP--NAS----------DTVQVSL------
-YGYTYTLYTHSFQCYGQNEAEKKFLAMLLQSPS--------------------------
--------------TEANISNPCYPQGYSTAFTLGHVFGSLCTEKQRPESYNSSKSVTFM
GTG-------DPRLCREKVASVFDFN----ACQ-EQDACSFDGIYQ-PKVQGPFV---AF
AGFYYTASALNL-------SGSF-----SLTSFNDSSWDFCRH--TWSELP------ALL
SRFDE-TYARSYCFSAHYIYHLLVNGYKFTEET----------------WPQIRFEKEVG
N----SSI---------AWSLGYMLSL--------------------TNQIPAGS-PLIH
L------PIQPPVFMGVLAFFTAI-ALLCLAFLLY-LCS---------------------
----------------SFRTKERSENAFDQA-----------------------------
--VDSD
>gi|33468702|emb|CAE30379.1|	   455 residues, 50 /line  novel protein similar to human ectonucleoside triphosphate diphosphohydrolase 2 (ENTPD2) [Danio rerio]
------------------------------------------------------------
------------------------------------------------------------
----------------------------------------------------FGIVFDAG
SSHTALFLYQWQGNKENNTGIVSQ-------------KQSCDVDGDGISSYVQN---PAG
AGE---SLKKCLDIAKAAIPTEQQKSTPVYLGATAGMRLLNLQNQTQSDSILAEVAKTIQ
T---YPF----DFRGARILTGMEEGAYGWITTNYLLESFIKH---------TFEGSWI-H
PK---AGKIIGALDLGGASTQISFTPKDPVRD--------PN-----SAFNLQL------
-YGYKYELYTYSYLCYGKDQALKKLQAYLHKNAG--------------------------
--------------SSSSISHPCYHKGYNLNLTLAELYNSPCVVP--PSSFNPKDTILFK
GTG-------NSSLCLSLIENIVNLT----GCA-LSPDCGFNGIYQ-PPVNGE---FFAF
SAYFYTFDFLGLT-------PKA-----PLTKVLSTIDTLCSK--NWTALT------AEN
PSIKP-KYLKDYCASGHYITTILLKGYKFNNT-----------------WDQISFVKQVA
D----TDI---------GWTLGYMLNL--------------------TNMIPSER-SSAV
T------GVPHSQWAAEIFFIAFA-LFLTLLIIVI-LS----------------------
------------------------------------------------------------
VRDITK
>gi|39598133|emb|CAE68825.1|	   553 residues, 50 /line  Hypothetical protein CBG14784 [Caenorhabditis briggsae]
------------------------------------------------------------
-------------MR-----VSRRFTIL-AITAMIF-------------LSLIICIYAVA
AHT------------------------------------TVNVI-LQKQERSYGVICDAG
STGTRLFVYNWVSTSDSELIQ-------IEPV-IYDNKPVMKKISPGLSTFGTK---PDE
AAE---YLRPLMELAELHIPEEKRPYTPVFIFATAGMRLIPDE---QKEAVLTNLRTELP
KI--TSMQV--LKEHIRIIEGKWEGIYSWIAVNYALGKFNRT------FTPDFPGTSP-G
QQ---RSKTVGMIDMGGASAQIAFELPDNDDF--NSI-N---------VENINL-GCRED
DSLFRYKLFVTTFLGYGVNEGIRKYEKTLMAKLKDQ------------------------
--------------NGTVIQDDCMPLNLHKTVTMEN-----------------GDNFVRR
GTG-------NWDTCAAEVKKLLNPETSSEVCKAEVAKCYFGAVPA-PNIPLSNVEMYGF
SEYWYSTH-----DVLGL-GGQY-----NAENIAKKSEQYCGQ--RWSTIQAAS-KKNLY
PRADE-ERLKTQCFKSAWITSVLHDGFSVDKTH-----------------NKFQSVSTIA
G----QEV---------QWALGAMIYH--------------------MRFFPLRD-STRN
LIVKETHSASESLWAPLFFLSAVF-CLFVLVCAKEHSLLCFDDKRRASF-------GLTR
RQYSYK------------------------------------------MLKEDRTSSSAF
LENF-A
>gi|45384424|ref|NP_990285.1|	   495 residues, 50 /line  ectonucleoside triphosphate diphosphohydrolase 2 [Gallus gallus]
------------------------------------------------------------
-------------MA-----RRAAAVLL-LLA---L-------------GCLLGILLLCL
G----------------------------------------SGDARGPPSFKYGIVLDAG
SSHTAVFIYKWPADKENDTGVVSE-------------HSMCDVEGPGISSYSSK---PPA
AGK---SLEHCLSQAMRDVPKEKHADTPLYLGATAGMRLLTIADP-PSQTCLSAVMATLK
S---YPF----DFGGAKILSGEEEGVFGWITANYLLENFIKR---------GWLGEWI--
QS---KKKTLGAMDFGGASTQITFETSDAIED--------PK-----NEVMLKL------
-YGQPYKVYTHSFLCYGRDQVLKRLLSKVLQAEN--------------------------
--------------YQETVANPCWPTGYRKSLSLSSIYDSPCTEKERPG-LPLNTTVVVS
GTG-------NGNLCAVHVNKLFDF----TSCS--FSHCSFDGVFQ-PEVSGNFI---AF
SAFFYTVDFIRTV---ME-RPVH-----SPSDLKDAAETICAT--SWNELY------QKA
PRL-E-KRLPDYCATSTFVYLLITKGYNFNNRS----------------FPSIAFQKKAG
E----TSI---------GWALGYMLNL--------------------TNMIPAQE-PASH
R------SMLYNYWVILILLFVIT-TLTALLTAVY-------------------------
-----------------------------------------LLRRSKSST----------
-----I
>gi|47224091|emb|CAG12920.1|	   484 residues, 50 /line  unnamed protein product [Tetraodon nigroviridis]
------------------------------------------------------------
------MAS-KRQMS-----YK---CRI-AGVMILL-------------LASIAALVAVA
--VIQ-----------------------------------DAWAS-KDYTMEYGIVIDSG
SSRSNVYVYEWPGEKENETGVVTE-------------TLNCRVSGNGISEMKVD---PEK
DKTSWTAFQDCMDKAMKVIPAKKHNSTPLFLGATAGMRLLHLTDEQRSNKIMSNINHYLN
S---LPF----DFKNASIISGQEEGLYGWVTVNYLMGNFQN-----------LWNAYI-K
PE---GSKTVGSMDLGGASTQIAFAVQDELT---------GS-----DYMHIKL------
-YGYSYNVYTHSYLCYGKNEAEKMILDRVVQASS--------------------------
--------------DPSNITNPCYPKGMNTTMMASAIYETPCNKK--PQNYTPNQELFMV
GSG-------DSDVCETLVKSIFDF----KSCS--SSQCSFNGVEQ-PPVSGDFL---AY
AGYFYVARALLI-------NDTS-----EMEEFTGSVKHFCQT--HWKELK------QEK
NWISD-RYLKTYCYAAHYVNTLLADGYKFDKDN----------------WNHIHFTKEVK
S----TSI---------GWSLGYMLAM--------------------SNMIPSEV-KKTP
-------PMTNPIFAGLIFLFSAL-TIV--------------------------------
------------------------------------------------------------
------
>gi|4868375|gb|AAD31285.1|AF139807_1	   462 residues, 50 /line  nod factor binding lectin-nucleotide phosphohydrolase [Dolichos biflorus]
MNWVWPK-----------------------------------------------------
----------------------TKSMSF-LLLITFL-------------LFSL-------
-----PKLSSSQYVGNSI------------------LLNHRKILPNQELLTSYAVIFDAG
SSGSRVHVFNFDQNLD-LLH-------------IGNDLEFTKKIKPGLSSYADK---PEK
AAE---SLIPLLEEAEDVVPEELHPKTPLKLGATAGLRLLDGD---AAEKILQAVREMFR
NR--SSLSV--QPDAVSVIDGTQEGSYLWVTVNYLLGKLGKK------------------
-----FTKTVGVIDLGGASVQMAYAVSRNTAK--NAP-KPPQ-GEDPYMKKLVL------
-KGKKYDLYVHSYLRYGNDAARVKIFKTT-------------------------------
----------------DGAASPCLLAGYEDIYRYSG---------------ESYNIYGPT
SGA-------NFNECRDLALQILRL---NEPCS--HENCTFGGIWD-GGKGSGQKNLVVT
SAFYYRS------SEVGFVTP--PNSKNRPLDFETAAKQACSL--TFEEAK------STF
PNVEK-DKLPFVCVDFTYQYTLLVDGFGLDPEQ------------------EITVAEGIE
YQDAIVET---------AWPLGTAIEA--------------------ISSLPKFN-----
------------------------------------------------------------
-----------------------------------------------------------R
LMYF-I
>gi|50548971|ref|XP_501956.1|	   539 residues, 50 /line  hypothetical protein [Yarrowia lipolytica]
MPSYFKF--------------------------SDLEQ---NNNKRDDDFKPRKDAMSS-
----------PLSMF-----NQVPTRIL-RLVGLSV-------------CALVFVFLFLR
NTD-SNTVVVNDTTKAAASGNVKSAPEATPQ---DPLTCTKSFD-GVTPITQYVVMIDAG
SSGSRIHVYKFNNCQSTP-------------R-LLD--EHFVMDKPGLSAFTD----PEE
AAQ---SLDKYLDSALEYIPEEYHSCSPLQVKATAGLRMVGEQ---KSKEILQAVRDRIQ
AK--YPFPIA-GDDGVGMMSDSDEGVYAWITINYLLGKIGS-------------------
PE---KKPTVAAFDLGGGSTQIVFEPELKGDKKPTAKQIQSAMQPGDHVYDLKF------
-GDLSYSLYQKSHLGYGLNAAKDQMYKQVVMNHINSDDSVV-------------------
-------------EDGATLVNPCVPSGLEIKNVKVKI------------NAEKTYTVNFR
GPSKPQ----TSAQCRKIAEDILHKD---HECT--VEPCAFNGVYM-PSLAETFL---RE
YKLYIISFFYDRTAPLGM-PSDF-----SVEELQDLTQRVCQG--EYDGFK------AIP
GAISELKENPAWCMELTYMVSLLHQGYEIPVG------------------REVTIAKKIK
D----YEL---------GWCLGASLPLLH--------------------KNGKDGW----
------------------------------------------------------------
----------------------------------------------------------TC
KLKK-Q
>gi|54261809|ref|NP_001004643.1|	   502 residues, 50 /line  ectonucleoside triphosphate diphosphohydrolase 2 a.1 [Danio rerio]
------------------------------------------------------------
-----------MVST-----GNRQQCQIITATGALF-------------LAVGGILLLVL
P----------------------------------------SEDIKGSPGFMYGIVLDAG
SSHTSMFIYKWPADKQNGTGIVSQ-------------HSECHAKGGGISSYAGV---KGG
AAR---SLKECMDKAMREIPTVRYKHTPVYLGATAGMRLLNISKPKESAEVLKEVEEKLK
S---YPF----SFKGASILTGQEEGAYGWITVNYLLENYIKY---------GFVGQWI-T
P----GRDTVGALDFGGASTQITFVTKQTVEN--------KD-----DLMKLRL------
-YGRDYQIYTHSFLCYGRDQVLLRLLAHLITIQG--------------------------
--------------SDTSIIHPCYPADYSSSIKLSSVFGTPCVEK--QTSYNPDGELQIK
GTG-------NYNQCLGNVSQLFSF----SSCS--YSKCSFDGVFQ-PNITGNFM---AF
SAFFYTHSFLQEA-------TGI--KIWTPAHLEDAARVICNM--SLQEMG------KKS
QD-NE-SRLKDYCAVSVFVRALLVNGYSFNDRT----------------FPQISFQKKAG
D----TSV---------GWSLGYMLSL--------------------SNLLPAEN-VALK
K------SLRSGAWSFLIFLFSIL-LTSALIFLFR-------------------------
----------------------------------------AICHKNKDDV----------
-----V
>gi|55742043|ref|NP_001006796.1|	   508 residues, 50 /line  ectonucleoside triphosphate diphosphohydrolase 1 [Xenopus tropicalis]
MDEPKAA-----------------------------------------------------
------------KQK-----KTWHKKV-IIFLGALF-------------VLGVISLVAIA
--VVQ--------------------------------------NKPLPKNIKYGIVLDAG
SSHTSVYIYEWPAEKENDTGVVQQ-------------INECKVEGNGISSYGHE---PLK
AGL---SLQKCMNKARQVIPEKQQRETPVYLGATAGMRLLRLTNATMAEEVLSSVENTLR
S---FPF----DFQGARIITGQEEGAYGWITINYLLGNFIQD---------SGWFKYIPN
FK---PTETSGALDLGGASTQITFESKREIES--------QE-----NSLHFRL------
-YGKSYDIYTHSFLCYGKDQALRLQIANSIKDA---------------------------
--------------TDSILLDPCFNSGYRRNASTNDLYSSPCISK--LRIPTAPSTLDIR
GTG-------NYQLCKRNVQAIFNR----THCT--YSHCSFNGVFQ-PSLDGTFG---AF
SAYYFVMNFLNLT------NEQM-----SLDKVKETVERHCSR--PWDEVK------KDF
PKIKE-KYLSEYCFSGTYILNLLEYGYGFSSEN----------------WNDIRFLGKIK
D----SDA---------GWTLGYMLNL--------------------TNMIPAEL-PYSP
-------PLSHAGYTGLMVFFSIL-LVCIILTCW----LSFRKPKCL-------------
------------------------------------------------------------
-HKGII
>gi|62955697|ref|NP_001017862.1|	   442 residues, 50 /line  hypothetical protein LOC550560 [Danio rerio]
MRFPKLA-----------------------------------------------------
--------------------------FIFMFVGCLV-------------VYLTY------
-------------VKRHYDDSKLSVPEQLPQYRTDTRKHPTSGQ-VVSENFQYGIMIDAG
STGTRIHIFKFQMEPNEAP------------K-LAH--ETFRAIKPGLSAYADE---PEK
SKE---GILELLNVAKDTVPEVLWSSTPLMLRATAGLRLLPGE---KATILLDKVREVFS
E---SLFLY--KPDSVSIMDGTDEGMSAWITINFLIGALHGT------------------
-----ETPTVGMLDLGGGSTQITFALQDEITIQ---------TSPIDYVTSFQM------
-FNISHALYSHSYLGLGLMSARLAVLGGIEGQPL--------------------------
-------------AGPQELVSPCLAPDYSGQWEHAEVLYTVKGQK---------------
-PGEPI-----YESCLRKVEKMIYKQ---VRK--AEEV--------------KNMDFYA-
-----FSYYYDRAVDLGLIDE-RTGGTVRVSDYIEGAKKVCNN----------------M
SAGG-IKESPFLCLDLTYISVLLQE-LDFPPD------------------KELKLARQIN
N----AET---------SWALGAAFHCIE--------------------SFRKHGT----
------------------------------------------------------------
------------------------------------------------------------
-----C
>gi|68478733|ref|XP_716635.1|	   599 residues, 50 /line  guanosine diphosphatase [Candida albicans SC5314]
MINPRNLRLIIAVIGLVGIFAFFASSQHSLVDRTALQV---NKPAADSPHVPPPAAAAAP
VSPPPPSQQQKQQEGSQKQLNDENSDEKNTLQGTSYSGTKPPYEKVDGKSNKILADKLDT
TKNSKPNQQQQQ------NTQKGASEEKSAQNKITTPEEVSMDN-GKCNDIDYVVMIDAG
STGSRVHVYEFNTCVKPP-------------Q-LLS--EEFEMLKPGLSSFDTD---TVG
AAK---SLDPLLEVALKKVPKNKQSCTPVAVKATAGLRLLGET---KSKAILDEVRSHLE
KD--YPFAVV-SEDGISIMDGKDEGVYAWVTANYLLGNIGGK------------------
-E---KLPTAAVFDLGGGSTQIVFEPDYKVDEVP---------VDGETKYHFTF------
-GDNQYTLYQFSHLGYGLMQGRNKVNQLVLKNKLSELNLQKY------------------
-----TKKEVKGAKATVDVSNPCIPPGVVAKDVQVELGEDEFYVV------------NMK
GPSSKDSTVAGGSQCRYLAEKVLNKD---AECT--SKPCSFNGVHQ-PSLTRTFN---KN
SDMYVFSYFYDRTNPIGM-PSSF-----SVEELKDLSKLVCQGETFWKDIL------LDD
HVKNL-NEEPQWCLDLSFITAMLHTGYDIPLH------------------RELKTAKTID
N----NEL---------GWCLGASLPLLD--------------------KNNAK------
------------------------------------------------------------
--------------------------------------------------------WTCR
IDKT-D
>gi|72072108|ref|XP_785341.1|	   537 residues, 50 /line  PREDICTED: hypothetical protein [Strongylocentrotus purpuratus]
MARCPLY---------------------------------------------------LP
LPAFWHISF-RLTHL-----RRQTACV-ALLVTCLL-------------ILCIYVY----
---------------ETSTYGPSSRGDRDYENYVQKYVHVEATN-TEDPNLYYGVVVDAG
SSGTRVFVYFWPSHTGKNNELLQ-----IHQMRDPNRQPVVKKIKPGLAELAST---PSE
ASI---YMKPLLNFAVNHIPESKIPETPLYILATAGMRMLPES---QSQAILDDLKKDIP
LE--YGFLF--PEKNVEVISGKQEGVYAWIGINYVLGRFDHSNNDEPVVEVELPGAET-S
PQTVSRKRTVGVLDMGGGSAQIAYEVPQSVSF--NLA-SPQEVAAKELMAEFNL-GCDQH
ESDHVYRVYVTTFLGYGGNAARSRYEGLLINSTLSNKD----------------------
-----ESKSTIGLSPSSPFLDPCLPSSMTDQIVRG------------------GKTYHFK
GTG-------DYVACKEVMVPVLGSN---KQCQ--KEPCSLGGVYQ-ANINFDNSEFYGF
SEYWYCME-----DVLRM-GGVY-----EYNQFENAAKKFCAT--RWTLLQEHH-EKGLY
SKADE-HRLKYQCFKSAWITTVLHKGFKFPKD-----------------YHYLRSASLIH
D----KEV---------QWTLGAILYR--------------------TRFLPL-------
------------------------------------------------------------
------------------------------------------------------------
-----R
>gi|74231263|gb|ABA00732.1|	   424 residues, 50 /line  NTPDase5 [Xenopus tropicalis]
MKMEWKVSFVFMILAACMIDFSLCHM----------------------------------
------------------------------------------------------------
-----EPTNTLKSVL----------------------PLATSGQ-NSHSDTIYGIMFDAG
STGTRIHIYRFKQRARGSH--------------LELEGEVFESIKPGLSAFADQ---PKK
GAA---TVRLLLDLAQKEVPSTQWSHTPVVLKATAGLRLLPET---QSDALLSEVREVFR
E---SPFLV--PENSVSIINGADEGIFAWITVNFLTGRLHS-------------------
------HRTVGILDLGGGSTQITFLPLTKNTLD---------QTPHDFLASVEL------
-FNSTYRLYTHSYLGLGLKLARLAVLGVSEDND---------------------------
-------------QQKQFFHSNCFLHGVKGEWSFAGV--------------TLKYEKKSD
GQS-------GFDACYSEILPIIQDK-----------------LHQVPEMQ--HSPFYA-
-----FSYYYDRAADANLID-HMHGGVLQVYDFAKSAKEVCERT----------------
-EQSP-THSHFLCMDLTFITALLKEGFGFEDN------------------TSLQLTKKMY
D----VEM---------SWTLGAIFHVLQ--------------------SL---------
------------------------------------------------------------
------------------------------------------------------------
------
>gi|92880822|gb|ABE85847.1|	   434 residues, 50 /line  Nucleoside phosphatase GDA1/CD39 [Medicago truncatula]
MDHPTTKKLQIR------------------------------------------------
--STNLFSRTTNTNS-----------RCISFNNTFI-------------GFLIFSFILIF
TYY------------------------------------TLFSSP-PEKSLRYRIIIDGG
STGTRVHVFKYKMKNALD---------------FGKKGLVSMRVNPGLSSFGND---PDG
AGR---SLLEVVDFAKRRIPKENWRETEIRLMATAGMRMLDVE---VQEKILESCRKVLR
V---SGFMF--RDDWASVITGSDEGVYAWVVANHALGTLGGD------------------
-----PSETTGIIELGGASAQVTFVSREAML---------PL-----FSRTIKF------
-GNVTYNLYSHSLLHFGLNVAHDSWREALISGNSNL------------------------
---------ASQYIQKGLRIDPCTPAGYSYNVDSWKSSPSSLSE-------KSHYHPTVQ
TRG-------NFSECRSAALVLLQKG--KEACS--YQHCDIGSTFI-PKLQGKFL---AT
ENFFHTSKFFGLG-------PQA-----YLSKLMTAGQEYCGG--DWLKLK------KKY
VSHDE-EDLLRHCFSSAYIVALLHDSLGIDMDDE--------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------
>gi|74231265|gb|ABA00733.1|	   468 residues, 50 /line  NTPDase6 [Xenopus tropicalis]
--------------------------------MPYLPLAAEERAE---------------
--WDSGSQPLA-RNS-----NREKKPL-IMKIGRLP----------CVLLFVLCVVLFIT
YIKWKPRKEQALDSS----------------DLQSKDTNDIGRL-SSKNEIFYGIMFDAG
STGTRIHVYQFSRTPSGAPN-------------LDH--EEFRALKPGLSSYADN---PLK
CAP---GINELLDIAKKEIPQNLWASTPLVLKATAGLRLLPGE---KAQKLLDMVRELFK
A---SPFLI--GKDSVSIMNGTDEGIFAWITVNFLTGSLTSH------------------
-----EKKHSGMLDLGGGSTQITFYPYSKNTLT---------SSPPGYITEFEL------
-FHNTYSLYSHSYLGYGLMSARLAIMGGEEGKA---------------------------
------------LKEGEELVTSCLTPEHKTEFKHAEITYKIKGQK---------------
-NDEPL-----YVSCYKRVLAVLGGKV-----------------ERSKE--IPNLFFYA-
-----FSYYYDRAVDAHLIDP-ELGGSLKVKDFDMAAKKECKLI----------------
-EEAP-GEKPFLCMDLTYITVLLQES-GFPVE------------------KELKLAKKIN
D----VET---------SWALGATFYY--------------------TSIMNKQH-----
------------------------------------------------------------
------------------------------------------------------------
------

Ad blocker interference detected!


Wikia is a free-to-use site that makes money from advertising. We have a modified experience for viewers using ad blockers

Wikia is not accessible if you’ve made further modifications. Remove the custom ad blocker rule(s) and the page will load as expected.