FANDOM


>gi|5020168|gb|AAD38033.1|AF149053_1	   439 residues, 50 /line  phytochrome kinase substrate 1 [Arabidopsis thaliana]
--MVTLTPSSASTPKTSFD--FMKNNNSH--SSLYVSSS-----SYLS---SKEDALVTT
KKLMEPSKTLNMSINPKQEEFGDEKKMVKKAPEDPEIGVFGAEKYFNGDMDSDQGSSVL-
---SLTNPEV-------------------E----RTVVDSKQSAKKSTGT-----PSVRS
ESSWNSQSVLLQNKLVNSCNSSFKEKKNS------NGQIQKVTNN-----KKSFL--ANL
GCKCACSDGDSVDVDEKT-----SVKR-----------------------SADPNISVI-
---TMRS-SADM------------------------------------------NTELIK
IQK-QEELSQRKSLEVF-GSPVAIEKKSSV-VQKK--LPLPPWKS-------RTEEDD--
---------------------TKSEGSDSSSDLFEIEGLTGN--PKPF--LTRQGSD-PA
----SPTCYAP-SEVSVEWSIVTAS----AADFSVMSEC-------ATSPVRRNRPTQIP
RIPITAKSAPQRRKSSSSSGGNGFL-MSCKSHKSVMVSGDLDRRS---SMNKTQ---PSY
VPRFPMETTKPKSFETRR-----------RISNSSISHTQSSLLYSQ
>gi|125551298|gb|EAY97007.1|	   410 residues, 50 /line  hypothetical protein OsI_018240 [Oryza sativa (indica cultivar-group)]
MDMDSV------------------------------------------------------
-------------VVHQRG-------GAGAGDEEEEIGVFTAERYFSGA-DEVDALWCGG
SSSSLSSAFK-----------------------TGGGQQ--EYWSAAPTTLT--AATTSS
EASWNSRSALLRDAAA---AVAVETEEPSGAGGDLCTPGTKASSPSHNLLLRWLL--GVA
ACACAGGGAEEAVIADDC-----RRDEARAA----GVAVGGE-----KRISTEAAEAVAT
TRV-----SRGMCDGDVFDAGTATPPPLPQLAEPRRIRTADSGEVSARVFNTR---ATAA
AALA-ADERRRRSLDMF-ASATRQQQSSQ----NP--AFTI----V----AGTSTAS-RD
AGGAGASATIRR----------DDPGAAAGDDAASSDGE---------------------
---LVECAYPP-SEASVVWSVVTADGVASAGNFSSAASGYYHH-Y----------YYHNG
GGG--DGRRTDAGKSSRRSSAGGLLTMGCMSDRALDAISPARVVHRRPL----PPGGGRR
WCHVARRR---------------------------------------
>gi|125593261|gb|EAZ33320.1|	   421 residues, 50 /line  hypothetical protein OsJ_016803 [Oryza sativa (japonica cultivar-group)]
MDMDSV------------------------------------------------------
-------------VVHQRG-------GAGAGDEEEEIGVFTAERYFSGA-DEVDALWCGG
SSSSLSSAFK-----------------------TGGGQQ--EYWSAAPTTLT--AATTSS
EASWNSRSALLRDAAA---AVAVETEEPSGAGGDLCTPGTKASSPSHNLLLRWLL--GVA
ACACAGGGAEEAVIADDC-----RRDEARAA----GVAVGGE-----KRISTEAAEAVAT
TRV-----SRGMCDGDVFDAGTATPPPLPQLAEPRRIRTADSGEVSARVFNTR---ATAA
AALA-ADERRRRSLDMF-ASATRQQQSSQ----NP--AFTI----V----AGTSTAA-RD
AGGAGASATIRR----------DDPGAAAGDDAASSDGE---------------------
---LVECAYPP-SEASVVWSVVTADGVASAGNFSSAASGYYHH-Y----------YYHNG
GGG--DGRRTDAGKSSRRSSAGGLLTMGCMSDRALDAISPARVVHPA------AAAAGR-
WPEMVPRG---TPPKMDT-------------------ICDGD-T--L
>gi|125569825|gb|EAZ11340.1|	   314 residues, 50 /line  hypothetical protein OsJ_001165 [Oryza sativa (japonica cultivar-group)]
MDRKAV------------------------------------------------------
-------------TVDV-----------------------ASEPRSPAT-PRTHARFENS
HVVADSTIFK-----------------------A----------NAPPPPPP--CEEEPV
KMKISPGSSTFPPPLA---NSIFAAAPNRGGGGGGAAPF--AAFPAPDIVGRRVVSSGGF
TFPVAVG-----------------------------------------------------
--------------------------------------------------------AAKV
VSTV-GDEPPRESLEVF-RPIDEESVLAD----PP--ADHL----A-------TVGG-RG
GGGGGLAAGFARAPGVAAVATDEEAMSDASSDLFDLESFAASSSF-PT--TCRGRSSRRN
SRGGRRRRRRP-SEFSFVPPPD---SAATAG----------------------------G
GGH--EGFTAAMSRSAARKKGGGFL-SSCRCEKAVSV-GPTPVRMVRPEVNVKTTGGGAA
RYHPGRVR---MP--VRT-----------------------------
>gi|125574742|gb|EAZ16026.1|	   376 residues, 50 /line  hypothetical protein OsJ_030235 [Oryza sativa (japonica cultivar-group)]
MESSRN---GDVTVTYEHQ--LFGRRR--NVAGGGGGFA-----TYLDL--VREEGDAG-
-KMPPRRPLPAP-PPHGVA-------SWRRTYADGELDVFAAERYFKGAMDGADGYNKVD
LASPVMAAAA-----------------------ARPAVA--VSRPAPWTTRASVASAGSS
GSTANSQAVLLREQRR--------------------------------------------
-------------------------------------------------RDKCCAHVGGI
LRS-----CSGKRSVHVGGAAVAATEP--------------AGDPGDELPPAT---ASRI
ECIG-AARMRPIGREEGTAATSEYSSSSF----RS--NFTL----L----APVKVTI-PA
SG---------------GDDDDDDVGSESSSDLFEIKSLMID------------------
----DCRGYEP-SEASVQWSLLTPA----PANCSFPASGRGGG-G----------GGKGR
PAA--AVAVRQQQHRRQADRPVGLL-AGCVSHRAVDVSAVAAVCRP-PP----PPGAP--
--ATATRR---RSDLSRF-------------------AHSGH----L
>gi|140058133|gb|ABE90777.2|	   477 residues, 50 /line  Histone H4 [Medicago truncatula]
--------------MQTFN--TENNNN--NNHLHDAVFS-----PYLN---IKEGNFIA-
-KIGESSQTNNPFINHRNS-------PLHQVEKAEEIGVFGAEKYFNRG--EVDTPR--P
STKYLPQRKE-----------------------TMAIET--RKYQVEYGT-----PSISS
VSTWNSQNALLKSGVR---NSIGNSKEKEHAKSVL----------------------SSL
RLKCSCSDKNSVDINDHA-----SEISFNNK-TSKYGAVQGK--TTPKKVFNLGLDDDLS
VRIRKPS-SEILINKDVY------------FQKQEKLRVGLNNEKNSLASNSRNHLVQMQ
NPLD-GEKTPRKSLEVF-GSPNPILINTKRNSLTN--DKRL----I----FPKMEEI---
-------------DNANYDDDDDDAASDASSDLFEIESLKGKPSNNNF--LTRQTSDAAS
S-CLSPNCYAP-SEASIEWSVVTASAA-------VMSDCEDQM-SE---------FTIRS
PIR--TPLK-PKVAKETPRRRPGML-LGCKSHKAVRVSGDAFITYEKQSLSPKISSRNKN
NTNSQVARFPGETNYGAKRHG-QQHGYTTPPLQASNSPHASKLLY-I
>gi|142942406|gb|ABO92981.1|	   476 residues, 50 /line  putative phytochrome-kinase-substrate [Solanum tuberosum]
MAMVKL---------------EATKST--STNLLDPSFS-----AYLIN---GTEEAIV-
-FNLESS-----------R-------DLSKKVDDGEIDIFSAEKYFNEGVDEVNNVTQNK
LKIHDDQPVA-----------------------VADIVS--LQQKIRPLT-----PSIHS
ESSWNSRSALLQKVSR---NHHYHQQHHQ------PPWPTKTNNKSYG---KKFL--ARF
GCNCYCKDKNSVEIDDQL-----GEKSFNRVKYSKSKQNIIKTRSSESSTIGANHQDLHF
KKI-----DELGVLGLKPDERFAVPVFDPKGG--------------------------IQ
MKKESEEEESRKSLEVF-GFPITEKERSKMSLEKN--IGMLTWDAI----VPKAEEIDII
NIGA----------SSNGTYEEDYAESDASSDLFEIESFPNNNTANPS--LVRQGSD---
----SMSCYAP-SEVSIDWSVVTAS----AADFSIMSDIEEVK-IP----------SIRT
TSN--SNRSVSQNGRDKAKRRSGIL-LGCNSHKAVGVVGDAYKVSEKSSIEMHQRNFKTY
EPIMPMTRFHAESKVNRFDGGNRKHEFTTRSFATTYTRRPADFLY-I
>gi|47824984|gb|AAT38757.1|	   471 residues, 50 /line  Putative phytochrome kinase substrate 1, identical [Solanum demissum]
MAMVKL---------------EATKST--SSNLLDPSFS-----SYMIN---GTEETIV-
-LNLESS-----------R-------DLSKKVDDGEIDIFSAEKYFNEGVDEENNVTQNK
HKIHDDQP-------------------------VADIVS--LQQKIRPLT-----PSIHS
ESSWNSRSALLQKVSI---NHQYQHQHHQ------LPRPTKTNNKSYG---KKFL--ARF
GCNCYCKDKNSVEIDDQL-----REKSFKS----KSKQNTIKT-----STIGANHQNLHF
KKI-----DELGVLGLKSDERFAVPVFDPKVGNP-------------------NPGVKIQ
LHKE-EEEESRKSLEVF-GFPITEKERSKMSLEKN--IGMLTWDAI----VPKAEEIDII
NIGA----------SSNGTYEEDYAESDASSDLFEIESFPSNNTANPS--LVRQGSD---
----SMSCYAP-SEVSIDWSVVTAS----AADFSIMSDIEEVK-IP----------SIRT
TSN--SNRSVSQNGRDKAKRRSGIL-LGCNSHKAVGVVGDAYKVSEKSSIEMHQRNFKTY
EPIIPMTRFHAESRVNRFDGGNRKHEFTTRSFATTYSGRPADFLY-I
>gi|147765302|emb|CAN60193.1|	   473 residues, 50 /line  hypothetical protein [Vitis vinifera]
MDNA---------------------AN--SLHLRDASFS-----AYLST---AEENFAV-
-KLAESIQSPYLPLTSTQEAAYPVNLGRXMSVEEGELRVFGAEKYFNMKMD--DGRRRLT
TSSSLXHRQI--------------------KEDRADLHC--TKPKIRPGT-----PSASS
EASWNSHAALLPRLLR---NPSPSK-----------------QRKANA---KMIF--AGF
GCNGSCSDKKSVYVDTNAEPGGVHGKEIRKKVAQNDPNPLMLDRTRL-SQPGFPVKNEI-
---HSRSFDKASI-GCKREEYYGYPIINSG---------LESLTVKGES-----------
VDK-RAEEEGRKSLEVF-GSHMLKKGDVATNLERK--LSVLTWDAI-----PKVQTVPT-
--------------TSEGTGXYEDNESDASSDLFEIENLSG--SAHPL--FNRQASDGMS
----SCTRYEPKSEASIEWSVVTAS----AADFSVTSDFDEKKQVESTENSREMNFASTP
TRP--S-KTKSSVGKEAQRSRPTGL-LGCRSDKAVRVSEPAYRTNDKVKSDP--GWHHRL
DSSMPLGKSQGENKVKDFEFPQAQHAFA-------------------
>gi|15223704|ref|NP_172880.1|	   442 residues, 50 /line  PKS2 (PHYTOCHROME KINASE SUBSTRATE 2) [Arabidopsis thaliana]
--MVTLT-SSSSTPNVSFD--FMMNNNNNSNNLYGPFSSSSTSFSYLTS---KEDALTQ-
-KNLMSGI-----TNDVLG-------INKKASEDLEISVFGAEKYFNGDMDSDHSPRLVS
P---LPDPEV--------------------PIERIFVGP-KQSSKNSSET-----PSLRS
ESSWNSQSLLLQSKYV---EKKKNIKKNSSCNSYFQEKDMSSNHKVSN--KKSFL--ATL
GCRCVCSNWSSVDVVDDK-----RRSSGLKK---------IKTQ----------------
----------LSFSGDLSSEM-------------------------------KIHQ----
QQQ-EAMLEQRKSLEIF-GSPLIEK---RIIQKK------FPWEYS----SSAKKE----
EHGF----------SVKYEEEEDGSVSDVSTDLFEIESLTGK--ANPF--LARQGSSDPD
----SPDGYAP-SEVSIQWSVVTAS----VADFSVMSEC-------ATSPVKKNRSFQIP
RIPIMAKSNREIAPQRRKSSSSGLL-MGCKSHKSVRVSGDSYTSMNRT---------PSY
VPRFPVEANPTSTETRR------------RISSSSVSHTQSPFLY-T
>gi|15237647|ref|NP_196039.1|	   406 residues, 50 /line  PKS4 (PHYTOCHROME KINASE SUBSTRATE 4) [Arabidopsis thaliana]
MAQTT-V-TVVATKRDALDPYIKILQN--RSNDIDVSFS-----SYLKP-----------
----------------------DNNEQQQKENEDTELSIFEARSYFSENGS---------
NDSRCQTRNL-------------------SGPRFSSVAS--AKVSSFTVG-----QTASS
EASWNSQTGLLSNKNR---QGSDRDGRRSSKKGP-----------------RWFF--RRR
A--CPCSSSKSVQVQESKPR------IAVPK----TGSDRIVS-----NRIVHSHQTISS
PE-------------------------PIRLTIPS-------------------NTVTRS
IDY-TANKEARAPVSNF-SFPTLNETSQLSENPKNPVLNHIKPVRI----EPALLPIKPV
LNPT----------SPKGVIIDEEATSDASSDLFEIESFSTQTAARPWAPPVRDSMEETV
----SEYGYEP-SEASVTWSVMTAE----PAS-AVAANFSRIA-----------------
---LS-SSSTAFSG--YDKKRTG-L-LNCHCEKAVMVNGDKRLVQPVKSVGVQN------
---------DVAGKVLCNNGSSK----------LSVTSRPR-----Q
>gi|18394658|ref|NP_564064.1|	   387 residues, 50 /line  phytochrome kinase substrate-related [Arabidopsis thaliana]
MDAEK--------------------KS--AHFRQISSYK-----PQLLVLSSIQENPSS-
-KISEK--------------------ANIKADNDAEIGVFGAEKYFSMKLDHVDST---A
DITKQHEKENTHDHPNANPNPNPNPHPHPHPQLTKTT--SSRSKTSRHGT-----PSVRS
ESSCNSQTFLMR--INNH---NENKQRKMNDTSI-------------------SF--GGF
RCYGPCSGVKTVHTDPKN-----SCK----------------------------------
----SRNS----------DRDFVA--YDARKHNDK-------------------PRLHFE
-----AKKADFHAQEKI-SLPI-QRSDIAMNLERK--LSLLTWDAIPNQLSTKNNNHNNN
GNNS----------SMSSNTQEEETASVASSDLFEIENITS-------------------
------SVYEP-SEASIGWSVVTGS----MADQSVISDFDMMK------RVTRNG-----
------PVVKTKPVIGEKVRSAGFL-SGCKSHKAVSVVDSSRKVKETAKVDHHEMSHQ--
------KKFKTEIRIQ-------------------------DLSF-L

Ad blocker interference detected!


Wikia is a free-to-use site that makes money from advertising. We have a modified experience for viewers using ad blockers

Wikia is not accessible if you’ve made further modifications. Remove the custom ad blocker rule(s) and the page will load as expected.