Fandom

Proteins Wiki

At2g02800.2/MSA

< At2g02800.2

47,923pages on
this wiki
Add New Page
Talk0 Share
>gi|15227042|ref|NP_178383.1|	   426 residues, 50 /line  APK2B (PROTEIN KINASE 2B); kinase [Arabidopsis thaliana]
-------MGNCL--------------DSSA------------------------------
-------------------KVDSSSHSPHANSASL-SSRVSSKTSRS----TVPS-SLSI
NSYSSVESL-PTPRTE-GE--ILSSP--NLKAFTFNELKNATRNFRPDSLLGEGGFGYVF
KGWIDGTT--LTASKPG--SGIVVAVKKLKTEGYQGHKEWLTEVNYLGQLSHPNLVKLVG
YCVEGE-----NRLLVYEFMPKGSLENHLFR---RGA--Q-PLTWAIRMKVAIGAAKGLT
FLHD-AKSQVIYRDFKAANILLDAEFNSKLSDFGLAKAGPTGDKTHVSTQVMGTHGYAAP
EYVATGRLTAKSDVYSFGVVLLELLSGRRAVDKSKVG-MEQSLVDWATPYLGDKRKLFRI
MDTRLGGQY--------PQKGAYTAASLALQCLNPDAKLRPKMSEVLAKLDQLESTKPGT
---GVGNR---------------------------------QAQIDSPR-----------
GSNGSIVQK--SPRRYSYDRPLLH--ITPGASPLPTHNHSPR------------------
------------VR
>gi|115443827|ref|NP_001045693.1|	   427 residues, 50 /line  Os02g0118200 [Oryza sativa (japonica cultivar-group)]
-------MGNICG-GSGKAHVSGDCRPPSS------------------------------
-------------------GTMTPKTSSSVTTSNS-TTGKLSSVGSS----F-MASSGSG
GTSSGFD-D-GVYP-E-GQ--ILEAP--NLRTFTFIELRTATKNFRPDSVLGEGGFGRVY
KGWVDEKT--MNPVKGG--TGMVVAVKKLNSESMQGYEEWQSEINFLGRLSHPNLVKLLG
YCFEDK-----ELLLVYEFMAKGSLENHLFK---KGC--P-PLSWELRLKIAIGAARGLA
FLHA-SEKQVIYRDFKASNILLDANYNAKLSDFGLAKLGPTGSNSHITTRVMGTYGYAAP
EYVATGHLYVKSDVYGFGVVMLEMMSGQRALDPNRPN-GQLSLVDWAKPYLADRRKLARL
MDPRFEGQY--------NSKQAVQAAQLTLNCLAGEPRSRPSMKEVLETLERIESMKSRA
---RDARG---------------------------------SGSSRDHS----------H
GRTTAHQRS--SPRPDGRRGSRTN--GHATKA----------------------------
-------------R
>gi|7270511|emb|CAB80276.1|	   415 residues, 50 /line  protein kinase-like protein [Arabidopsis thaliana]
-------MGACIS-FFSSSSP---------------------------------------
-----------------------SKTAATTNNHSN-GTEFSSTTGAT----T-NSSVGQQ
SQFSDIS-T-GIISDS-GK--LLESP--NLKVYNFLDLKTATKNFKPDSMLGQGGFGKVY
RGWVDATT--LAPSRVG--SGMIVAIKRLNSESVQGFAEWRSEVNFLGMLSHRNLVKLLG
YCREDK-----ELLLVYEFMPKGSLESHLFR---RN---D-PFPWDLRIKIVIGAARGLA
FLHS-LQREVIYRDFKASNILLDSNYDAKLSDFGLAKLGPADEKSHVTTRIMGTYGYAAP
EYMATGHLYVKSDVFAFGVVLLEIMTGLTAHNTKRPR-GQESLVDWLRPELSNKHRVKQI
MDKGIKGQY--------TTKVATEMARITLSCIEPDPKNRPHMKEVVEVLEHIQGLNVVP
---NRSST---------------------------------------------------K
QAVANSSRS--SPHHYRYKAGALG--AERKRA-TPGRFGSVE------------------
-------------K
>gi|42569425|ref|NP_180459.2|	   423 residues, 50 /line  APK1B (Arabidopsis protein kinase 1B); kinase [Arabidopsis thaliana]
-------MKMGF----------------VE------------------------------
-------------------KVKSNVFLYANYVFGC-CIGASPKYMSS----EANDSLGSK
SSS--VSIR-TNPRTE-GE--ILQSP--NLKSFTFAELKAATRNFRPDSVLGEGGFGSVF
KGWIDEQT--LTASKPG--TGVVIAVKKLNQDGWQGHQEWLAEVNYLGQFSHPNLVKLIG
YCLEDE-----HRLLVYEFMPRGSLENHLFR---RGSYFQ-PLSWTLRLKVALGAAKGLA
FLHN-AETSVIYRDFKTSNILLDSEYNAKLSDFGLAKDGPTGDKSHVSTRIMGTYGYAAP
EYLATGHLTTKSDVYSYGVVLLEVLSGRRAVDKNRPP-GEQKLVEWARPLLANKRKLFRV
IDNRLQDQY--------SMEEACKVATLALRCLTFEIKLRPNMNEVVSHLEHIQTLNEAG
---GRNID---------------------------------MVQRRMRR-----------
RSDSVAINQ--KPNAGFARQTAVG--VIATAYPRP--SDSPL------------------
------------FV
>gi|125596188|gb|EAZ35968.1|	   444 residues, 50 /line  hypothetical protein OsJ_019451 [Oryza sativa (japonica cultivar-group)]
MPSRRREERGCGCWAAVARGLRGACFRPAGVAAA-----ASGADEKGAAGGSAKGSHVHD
AAGC-----FWVRCSSILFFSITAETRYLNASNRELGDHFQTNLDDE----N--------
-------------GVN-----ASTEK--KLLRFTFQELKSATVNFRPDSILGEGGFGYVF
KGWIDPNS--TSPAKPG--TGLTVAVKSLKQDALQGHREWVAEVDFLGQLHHKHLVKLIG
YCIEDD-----QRLLVYEFMARGSLENHLFR---RA---L-PLPWPCRMKIALGAAKGLA
FLHG-GPKPVIYRDFKTSNILLDAEYNAKLSDFGLAKAGPQGDKTHVSTRVVGTYGYAAP
EYVMTGHLTSKSDVYSFGVVLLEMLTGRRSMDKKRPT-GEQNLVAWARPYLSDRRRLYQL
VDPRLGLNY--------SVRGVQKVAQICYHCLSRDTKSRPTMDEVVKHLTPLQDLNDMA
---SASYR------------------------------------------------PRSS
QRDLLHIRE--KRM-------------------NCLYSQLER------------------
------------DE
>gi|92871789|gb|ABE80695.1|	   478 residues, 50 /line  Protein kinase [Medicago truncatula]
------------------MGFRNN-------AIQ-----AGSLDVGGKSKGKMKKDCDEK
EIGCCVKFSCFGKCIPSRLKVDSSKSGTTSAHNVENASAYERSKKDR----SAPPGSSTT
SNAESIPST-PMFSEE-----LKVSS--DLRKFTFNELKMATRNFRPESLLGEGGFGCVF
KGWIEENG--TAPVKPG--TGLTVAVKTLNHDGLQGHKEWLAELNILGDIVHPNLVKLIG
FCIEDD-----QRLLVYQFMPRGSLENHLFR---KGS--L-PLPWSIRMKIALGAAKGLN
FLHEEAQRPIIYRDFKTSNILLDAEYNAKLSDFGLAKDGPQGENTHISTRVMGTYGYAAP
EYVMTGHLTSKSDVYSFGVVLLEMLTGRRAVDKNRPN-GEHNLVEWARPVLGERRLLFQI
IDPRLEGHF--------SVKGAQKSAQLAAQCLNRDPKARPMMSEVVQALKPLQNLKDMA
---IASYH---------------------------------FQVVRVDRTMSMPNSKNGT
QTQVASLSK--KGQPMRILSSPNG--QHGSPYRHYIKSPKPK------------------
------------NG
>gi|30679085|ref|NP_195722.2|	   410 residues, 50 /line  protein kinase family protein [Arabidopsis thaliana]
-------MGNCGTR----------------------------------------------
----------------------------------DEAAVFTPQAQAQ----QLQKKHSRS
VSDLSDPST-PRFRDD-SRT-PISYA--QVIPFTLFELETITKSFRPDYILGEGGFGTVY
KGYIDDNL--RVGLK-----SLPVAVKVLNKEGLQGHREWLTEVNFLGQLRHPNLVKLIG
YCCEDD-----HRLLVYEFMLRGSLENHLFR---KTT--A-PLSWSRRMMIALGAAKGLA
FLHN-AERPVIYRDFKTSNILLDSDYTAKLSDFGLAKAGPQGDETHVSTRVMGTYGYAAP
EYVMTGHLTARSDVYSFGVVLLEMLTGRKSVDKTRPS-KEQNLVDWARPKLNDKRKLLQI
IDPRLENQY--------SVRAAQKACSLAYYCLSQNPKARPLMSDVVETLEPLQCTGDAL
---IPCAT---------------------------------TTAGAAFA-------MGGV
PDYRMHRRFAKNVGPGAICRSPNPNYSPGGPA-------ACR------------------
------------VR
>gi|115450515|ref|NP_001048858.1|	   381 residues, 50 /line  Os03g0130900 [Oryza sativa (japonica cultivar-group)]
-------MG-CFG-CFS--PEVDD---DLKPSKPN-----------------YHSSD---
------------------------------------------------------------
---ESSGADARRKVAPLATD-G-GNG--YAHSFTFKDLSVATGYFNEANFIGEGGFGKVY
KGKIN---------------GQMVAVKQLTRDGVQGRNEFLVEVLMLTVLNHPHLVSLVG
FCAQGD-----ERLLVYEYMPFGSLESHLFDV-PLGK--Q-PLDWNTRMRIAVGVAEGLS
YLHNVADPPIIYRDMKAANILLDEDYRPKLSDFGLAKVGPVGDRTHVSTRVMGTYGYCAP
DYVVSGKLTMKSDIYSFGVLLLELITGRRIYDASRPK-PEQSLLTWSRPFLHDKRKFYRL
ADPALHGCY--------PTSALNQLVVISIMCLQDQPHVRPIISDVVIGLNHVASQPYVP
-----------------------------------ERSSVSLSSP-----------ARCG
SPQYAG-------------------------TP--SRRRGGR------------------
--------RVAQYA
>gi|115469792|ref|NP_001058495.1|	   402 residues, 50 /line  Os06g0703000 [Oryza sativa (japonica cultivar-group)]
--MHRWFIASCGD-IRA--AAARSS---------RRRGGDAIAPK---------------
------------------------------SAPPSPSPPPRL-------------RKTVS
ETAAVMLAV-PKDVEEFRTM-PAYGT--NLELFTYDQLRAATADFSPEQIVGEGGFGVVY
KGLIHG---------------AVVAVKQLNPLGHQGDREWLTEVSYLGQYNHPNLVELIG
YCCEDD-----HRLLVYEYMANGSLENHLFR---RSC----NLSWTTRMKIALDVARGLA
FLHG-GDRPIIYRDFKTSNILLDTDMKAKLSDFGLAKEGPRGGKTHVSTRVMGTYGYAAP
EYVATGHLTAMSDVYGFGVVLLEMLVGRRALEPPAAGCSKCNLVDWARPILIRPKKLERI
VDRRMALPAPAADYGGGVDAAVERVARLAYDCLSQNPKVRPTMGRVVHVLEAVLADHHHH
-----------------------------------AGAAAAAARPAAAAAAATAT-----
------------------------------------------------------------
--------AGRLYV
>gi|115480353|ref|NP_001063770.1|	   406 residues, 50 /line  Os09g0533600 [Oryza sativa (japonica cultivar-group)]
--------MSCLG-WFK--KRRSS---KSKESS-GRRGSTTTTVSAVSTSRS--------
---------------------------------------------------DDSGAVRPA
SKSTGSTSS-HRSISSLYEE--RGHG--QLRDFDYDELQAATNGFSRAQKLGEGGFGSVY
KGFVRSSP--ADG-KAA--DRLAVAVKCLNQRGLQGHKQWLAEVQFLGVLEHPNLVKLLG
YCAVDG-ERGPQRLLVYEYMPNKSLEDHLFV---RAY--P-PLSWNRRLQIILGAAEGLA
YLHEG-QVQVIYRDFKASNILLDKDFRAKLSDFGLAREGPTGANTHVSTAVVGTHGYAAP
DYIETGHLTVKSDVWSFGVVLYEILTGRRTLDRHRPQ-GEQKLLEWVAQFAPDSRNFRMI
MDPRLRGEY--------SVKAARDIAKLAESCLLKNAKERPTMSEVVDVLRRAVQSQPDP
----------------------------------------------PPPPAAAAAAS-GK
GKRVDVAP-----------------------QP--ARR----------------------
-------------R
>gi|90900944|gb|ABE01834.1|	   412 residues, 50 /line  NAK-type protein kinase [Nicotiana tabacum]
-------MLKCFY-IFK--DKSRS----------RRRGESAPELS--NESRR--------
---------------------------------------------------DGNSEGKKV
AKSTGSVSS-ARSIPQMYRE---KEQ--NLRVFSLSELKEATRSFNRMLKIGEGGFGSVY
KGTIQPPS------GRG--DPIVVAIKKLNTLGLQGHRQWVAEVQFLGVLEHPNLVKLLG
YCATDG-ERGIQRLLVYEYMQNKSLEDHLFN---RAV--P-VIPWKTRLKIILGAAQGMA
YLHEGLEVQVIYRDFKSSNVLLDEDFNPWLSDFGLAREGPAGDRSHVSTAPVGTLGYAAP
EYVETGHLSVKSDIWSFGVVLYEILTGRRTLERNLPV-MQQKLIDWVKQFPADSRKFSMI
IDPRLRNEF--------SLVAARRIAKLADSCLNKIAKERPKMSEVVQILTQAVQESQET
-----------------------------------TSLEITGPGPGPSRPTQLASPK-QQ
LKNKTIAE------------------TARPMRP--IAQ----------------------
-------------A
>gi|15238002|ref|NP_199518.1|	   410 residues, 50 /line  protein kinase, putative [Arabidopsis thaliana]
--------MNCLF-LFK--SKKPRKQQKDNNKN-KRKGKELLQNSAPELTNR--------
---------------------------------------------------SETSSFN--
LQTPRSLPS-PRSIKDLYTE---REQ--NLRVFSYEELSKATYVFSRKLVIGEGGFGIVY
KGKILSNG--DSS---D--PPLVVAIKKLNRQGLQGHKQWLAEVQFLGVVNHPNVVKLIG
YCSEDG-ETGIERLLVYEYMSNRSLEDHLFP---RRS--H-TLPWKKRLEIMLGAAEGLT
YLH---DLKVIYRDFKSSNVLLDDQFCPKLSDFGLAREGPDGDNTHVTTARVGTHGYAAP
EYVQTGHLRLKSDVYSFGVVLYEIITGRRTIERNKPV-AERRLLDWVKEYPADSQRFSMI
VDPRLRNNY--------PAAGARSLAKLADLCLKKNDKERPTMEIVVERLKKIIEESDSE
-----------------------------------DYP-----------MATTTTKESSQ
VRRRQVAK------------------PEKQSLR--GVSVR--------------------
-------------G
>gi|125553540|gb|EAY99249.1|	   450 residues, 50 /line  hypothetical protein OsI_020482 [Oryza sativa (indica cultivar-group)]
-------MGAGRS-VP------ARGRDSESSSRKTKAAASSS-----------------S
TAGCW-----------GRLPLLISSGGIMTSSPPDRSPPYLQTTAEPTLYAGTTNNSYKP
FLPEEAFS---GSISP-SLV--ATDF--QLRQFTYADLQHATGYFRPETFLGVGGFGRVY
KGWIQVNE--TAHGKPR--TGIPIAVKTLNCDGLQGHDEWVAEIHYLRNLKHPHLVKLIG
FCMEGD-----QRQLVYEFMSRGSLENHLFI---RSR--T-PLPWFLRVKIVLGAAKGLA
FLHE-QEMPVIFRDFKTSNILLDEDFNAKLSDFGFARDGPVGDMAHVSTRVLGTYGYAAP
EYVLTGHLTSMSDVYSFGVVLLKVLSGKKAME--------RNLVEWAHNNAND-RSIHRL
IDPGLGSNF--------SMAGAQILARTARSCTRQNPRDRPLMSEVVHTLETLHTDQRAN
-----------------------------------ATTSYSYSQSQPPSP--------SA
NPSPSRSPMRS-----------SASSPYGAPYP--YGG---------------------I
GGHGTRRA----MA
>gi|125556372|gb|EAZ01978.1|	   469 residues, 50 /line  hypothetical protein OsI_023210 [Oryza sativa (indica cultivar-group)]
-------MGGCFS-LEE--HRLQGKTEAGG------------------------------
-------------------------------------------------PDGLRKCKSDS
KATASVLAP-PKDVEDL-QI--EGYG--NVNIFTYNELRAATKNFRPDQILGEGGFGVVY
KGVIDENV--RA----GF-PSTQVAVKELNPEGFQGDKEWLAEVNYLGQLSHPNLVELIG
YCCEGS-----HRLLVYEYMACGSLEKHLFR---RVC--L-NMPWSTRMKIALGAARGLE
YLH-GAERSIIYRDFKTSNILLDADYNAKLSDFGLARTGPSGDQTHVSTRVMGTYGYAAP
EYVMTGHLTARSDVYGFGVVLLEMIIGRRAVDKSRPS-REHNLVEWARPLLVHNRKLFRI
IDPRMEGQY--------STKAAIEVAGLAYRCLSQNPKGRPTMSQVVETFEAVQNMPECQ
DIL-----LQNCMT------GAVTLYEVAKDPTESVEPEKIKQEQPAAKTVTVAPALVNG
KPVPQSRRTRPG----NGRSKSEPSL----ECK--LYIPSPDSDGQQPGLEALSSPSRDG
SIKDPPDEDLY-KI
>gi|125559658|gb|EAZ05194.1|	   393 residues, 50 /line  hypothetical protein OsI_026426 [Oryza sativa (indica cultivar-group)]
-------MGNCMG-SSK--CASASAPLESKVTRSSN------------------------
----------------------ST---TTTDNTSKASQRSS-------------------
-SAFSSGQFSRASSDESSAA--PSLS--SLKSFNMGDLRAATKNFGSNSFLGEGGFGCVY
KGWIDELT--LAPTKPG--VGKMVAIKKLKKESFQGHKEWLAEVTYLGQLHHENLVKLVG
YCSDSD----SNKLLVYEYMLRGSLENHLFR---RGT--Q-PLSWAMRVNIAVDVARGLS
FLH-GLENPIIFRDLKSSNVLLAGDYRAKLSDFGLARNGPTGDKSHVSTRVVGTRGYAAP
EYVATGHLSVKSDVYSFGVVLLELLTGRRALDAARGA-TAEMLVDWARPHLGDRRKVNRI
MDTRLGGQY--------PKKQAQDMAALALRCLHHDPKLRPAMPDDVLPQLRLLQQNTKP
------------------------------------------------------------
----------------SSSSTSAPAHRSRP------------------------------
--------FQALAS
>gi|125583879|gb|EAZ24810.1|	   449 residues, 50 /line  hypothetical protein OsJ_008293 [Oryza sativa (japonica cultivar-group)]
--MRR--MLRCFF-GG-----GGDETGGDEEKKA-------SAAAVVKNKKAVRRM----
------------------------------------------------------RSATGR
L--------RSLSLEDLSRT--LAQS--GLQAFTLAELKAATRSFSGSNFIGEGGFGPVY
KGFIDAKL------RPGLLQPQHVAVKYLDGEGDQGHREWLAEVVYLGMLSHPHLVKLIG
YCCQDD-----HRMLVYEYMARGSLEHHLFK---NLL--S-SLPWATRLKIAVGAAKGLA
FLH-DADTPVIYRDFKASNILLDSDYTAKLSDFGLAKEGPQGDATHVTTRVMGTHGYAAP
EYILTGHLTAKSDVYSFGVVLLELLTGRRSVDKRRRG-REQNLVDWARPYLRRPERLHRV
MDPSLEGGY--------SDKAAGKAAMVAYHCLHSVPKSRPHMRDVVAALEPLLQTSCGD
-VLAGPFVYTVPSAA--------AVVV------------AAKDDGKKAAAAAGE---DGE
EEVAAAAKAKRRYVASAVHAEGAMRKGEHRYAS--SVSGSPRQ-----------------
--------SRDRGG
>gi|144924984|gb|ABP03782.1|	   436 residues, 50 /line  Protein kinase [Medicago truncatula]
-------MGNCLT-TSL--QSSGDCPNSSTAPDNNNQSGSILFSAGLSNLRLIRNGNSTS
LGHSS-----------NSGGNSRL---FSSSNNHSTGNNTS------TSFWGSENSQASR
I--------RDEDEFPYGHI--LDAS--NLKVFTLAELKAATRNFRQDTLLGEGGFGKVF
KGFIKERA----ESKKG--EGLTIAIKKLNTNSMQGVAEWQSEVNFLGRLSHPNLVKLLG
FGREED-----QLFLVYEFMHRGSLDNHLYG---RGSNVQ-SLSWDRRLKVMIGAARGLN
FLH-SLEKKIIYRDLKPSNILLDKASTAKLSDFGLAKSGPSDDHTHVSTRVVGSHGYAAP
EYVATGHLYVKSDVYGYGIVLLEILTGKRIGEITRLS-QPKSLRDWLKSNLLNRGKLRSN
MDAKLEGRY--------PPNLASQVAQLAFKCIQTEPKIRPSMKEVVETLESIEAANEKP
---ADN------------------------------------------------RKKTTN
SKAVQQQHGQ--------------------------------------------------
----------PDGG
>gi|147826993|emb|CAN77773.1|	   438 residues, 50 /line  hypothetical protein [Vitis vinifera]
-------MGLKKG-------------------------T-----------------WKYA
FPSCF-----------------RH---TGSRNVAL-------------------------
---------RRRSLKRLCSS--RIAP--DLDVFTLAEVRAITHNFSLSSFLGEGGFGPVY
KGVIDEKV------RPGF-KDQQVAVKVLDLDGQQGHREWLAEVIFLGQLRHPHLVKLIG
YCSEKE-----QRVLIYEYMAKGNLENQLFR---RYS--A-SLPWTTRVKIALEAAKGLA
FLHE-EENPVIFRDFKASNILLDSDYTVKLSDFGLAKDGPEGDETHVTTRVMGTEGYAAP
EYIMTGHLTTMSDVYSFGVVLLELLTGRRSTDKSRPS-REQNLVGWALPFLKDPQKLKRI
IDPKLEGMY--------STEGAKRVAMLANQCLSQKAKCRPRMSSVVKTLESLMDLADTG
---FMPFVYIVPAESQKKGEAQITLRVCGKDEAEA---EANHNNGKEAGKKDENKEIGLL
KCPKGLRHTHRLS-----QFRSGPVYSDNKFC--------------------------IT
LQTGMNCT----NQ
>gi|15218526|ref|NP_177398.1|	   450 residues, 50 /line  protein kinase, putative [Arabidopsis thaliana]
--MRFSWKNICLP-ISCINNTNQKKTTTTNPPKEK-------------------------
-------------------------------------LLLLSRQTS-----------VPS
RVYMSDFSNSTISLNDF-SN--SFFI--NIHIFTYEELKTITQGFSKYNFLGEGGFGEVY
KGFVDDSL--KTGLK-----DQPVAVKALKREGGQGHREWLAEVIILGQLKHPHLVNLVG
YCCEDD-----ERLLVYEYMERGNLEDHLFQ---KYG--G-ALPWLTRVKILLGAAKGLE
FLHK-QEKPVIYRDFKPSNILLSSDFSSKLSDFGLATDGSEEEDSNFTKSVMGTEGYAAP
EYISAGNLTTMSDVFSFGVVLLEMLTARKAVEKYRAQ-RGRNLVEWARPMLKDPNKLERI
IDPSLEGKY--------SVEGIRKAAALAYQCLSHNPKSRPTMTTVVKTLEPILDLKDIQ
---NGPFVYIVPVAG--------------VSEVHE---IKCKDDVKVVKEETEKDAKVFP
RHRAGRRNRRKHK-----AMRSRAVYSDTALYK--S-----------------------L
GTSLYNPA-----N
>gi|15225277|ref|NP_180197.1|	   424 residues, 50 /line  ARSK1 (ROOT-SPECIFIC KINASE 1); kinase [Arabidopsis thaliana]
-----------MA-VFK--KKKTS--------------------------------LTSL
FLGCY-----------KAKNASK-----------YEGGEKAVMKIR-----TCPAFKRLS
LSDISDPSSPMSVMDDLSHS--FTSQ--KLRLFTLSELRVITHNFSRSNMLGEGGFGPVY
KGFIDDKV------KPGI-EAQPVAVKALDLHGHQGHREWLAEILFLGQLSNKHLVKLIG
FCCEEE-----QRVLVYEYMPRGSLENQLFR---RNS--L-AMAWGIRMKIALGAAKGLA
FLH-EAEKPVIYRDFKTSNILLDSDYNAKLSDFGLAKDGPEGEHTHVTTRVMGTQGYAAP
EYIMTGHLTTMNDVYSFGVVLLELITGKRSMDNTRTR-REQSLVEWARPMLRDQRKLERI
IDPRLANQH--------KTEAAQVAASLAYKCLSQHPKYRPTMCEVVKVLESIQEVDIRK
---HDG-----NNNK--------------EGK-------------KFVDINKFR------
----------HHRKG---KRRVNIAYSDSLVYK--ESKAKQND-----------------
------------GI
>gi|15232294|ref|NP_188689.1|	   386 residues, 50 /line  protein kinase family protein [Arabidopsis thaliana]
------MKINCLF-CCMS-HRRFNRRS-----------S-----------------SRQS
IKDCI-----------DAKN--NI---TTFDNISFKTDSSR-------------------
----------RRYISEEIAK--LGKGNISAHIFTFRELCVATKNFNPDNQLGEGGFGRVY
KGQIETPE-------------QVVAVKQLDRNGYQGNREFLVEVMMLSLLHHQNLVNLVG
YCADGD-----QRILVYEYMQNGSLEDHLLELARNKK--K-PLDWDTRMKVAAGAARGLE
YLHETADPPVIYRDFKASNILLDEEFNPKLSDFGLAKVGPTGGETHVSTRVMGTYGYCAP
EYALTGQLTVKSDVYSFGVVFLEMITGRRVIDTTKPT-EEQNLVTWASPLFKDRRKFTLM
ADPLLEGKY--------PIKGLYQALAVAAMCLQEEAATRPMMSDVVTALEYLAVTKTE-
---EDG------------------------------------------------QTVEGE
EEEEEDERSK--------------------------------------------------
-------------L
>gi|24059901|dbj|BAC21365.1|	   457 residues, 50 /line  phytosulfokine receptor precursor -like protein [Oryza sativa (japonica cultivar-group)]
-------MG-CFF-YS----REKNKNKNKK------QSR-----------------SSP-
-TLTV-----------DKDDFR-----------------------------DEMSKKANR
SCSLVVASS-PRSILELY-E--ERAH--ELRDFRLAELRSATGNFSRELKIGEGGFGSVY
KGFLKTSCGHLGLRNDS--GNVVVAVKKLNPNGMQGHKQWLAEVQFLAVVDHPNLVKLIG
YCGTDDGEQGPQRLLVYEFMPNKTLEYHLFN---KAY--P-TLPWKTRLSIALGVAKGLQ
YLHEGLEIQVIYRDLKSSNVLLDEEFRPKLSDFGLAREGPVDGQTHVSTAVMGTYGYAAP
DYVETGRLTARSDVWSFGVVLLELLTGHRAFDRSRPR-PDQKLVDWARRHPAGTRWFSRL
PDPRLAGRY--------SHRAAQDVAALAWRCLADRAGERPSMAEAARALERAARHGELD
---GPP-----EPPE--------------EGS-------------PPPPRCHAGSGSSSP
EAKKAATAKRRRMAH---LAKLAAG-ASAAPAA--RRLVHMKM---------------TK
AAATCNAGTQHGET
>gi|30699019|ref|NP_177589.2|	   399 residues, 50 /line  protein kinase, putative [Arabidopsis thaliana]
-------MGNCFE-SCS--KRNDNEDD--------------------------------N
LDSSV-----------NSKPFSRA---NS----------DTGRSSNLSYPWSLKPLITRK
CEAISALPP----PHKEGDI--MHSQ--YLKSFTLDELKNATGNFCPESLIGEGGFGFVH
KGCING--------GPG--IELAVAVKKLKTEGLQGHKEWLREVNYLGRLHHPNLVKLIG
YSLENE-----HRLLVYEHLPNGSLENHLFE---RSS--S-VLSWSLRMKVAIGAARGLC
FLH-EANDQVIYRDFKAANILLDSGFNAKLSDFGLAKEGPKDNRSHVTTEVMGTEGYAAP
EYLATGHLTTKCDVYSFGVVLLEILSGRRVIDKSKSR-EEENLVDWATPYLRDKRKVFRI
MDTKLVGQY--------PQKAAFMMSFLALQCIG-DVKVRPSMLEVVSLLEKVPIPRHRK
---SRS------------------------------------------------KG----
-FACTNSAS--------------------MPSK--RFLRHPK------------------
-------------D
>gi|51971074|dbj|BAD44229.1|	   381 residues, 50 /line  unknown protein [Arabidopsis thaliana]
-------MTCCFS-CLN--PRTKDIRVDIDNARC--------------------------
-------------------------------------------NSRYQTDSSVHGSDTTG
TESISGILVNG---KVNSP---IPSG--GARSFTFKELAAATRNFREVNLLGEGGFGRVY
KGRLD--------------SGQVVAIKQLNPDGLQGNREFIVEVLMLSLLHHPNLVTLIG
YCTSGD-----QRLLVYEYMPMGSLEDHLFDL-ESNQ--E-PLSWNTRMKIAVGAARGIE
YLHCTANPPVIYRDLKSANILLDKEFSPKLSDFGLAKLGPVGDRTHVSTRVMGTYGYCAP
EYAMSGKLTVKSDIYCFGVVLLELITGRKAIDLGQKQ-GEQNLVTWSRPYLKDQKKFGHL
VDPSLRGKY--------PRRCLNYAIAIIAMCLNEEAHYRPFIGDIVVALEYLAAQS-RS
---HEA------------------------------------------------RNVSSP
SPEISRTPR--------------------------------R------------------
------------DL
>gi|6554483|gb|AAF16665.1|AC012394_14	   442 residues, 50 /line  putative protein kinase; 59396-62219 [Arabidopsis thaliana]
-------MPALHP-TFPLPETGHKLRPAATPPREKPQHR-----------------TTRS
VENPP-----------REKPQEKT---RSVENPPREKPQEKTRSVETPPQEKTRPVDNPP
SKPVEKLGLGRKAVPPSGK---IVTP--NLKMFTLVELKTATKNFRPESVIGEGGFGQVF
KGWVDEKT--LAPSRAG--VGIPVAVKKSNPDSEQGLHEWQCEVRFLGKFHHPNLVKLLG
YCWEEN-----QFLLVYEYLPKGSLENHLFS---KGA--E-ALPWDTRLKIAIEAAQGLT
FLH-NSEKSVIYRDFKASNILLDSNFHAKLSDFGLAKNGPINGFSHVTTRVMGTQGYAAP
EYMATGHLYVRSDVYGFGVVLLELLTGLRALDPNRPS-AQQNLVEWAKPGLNQKKKVQKM
MDPRLEQKY--------PLLAVTKTAELILRCLEADPKNRPPMDDVLRELEVVRTIRDQP
---QEE------------------------------------------------RRKRSS
GPDTNRVRG--------------------NDSP--YGRRTGR------------------
------------TG
>gi|115449721|ref|NP_001048536.1|	   427 residues, 50 /line  Os02g0819600 [Oryza sativa (japonica cultivar-group)]
--------MRCLP-FLH--GDSKEEDPVN-------KSASVRSLSTTSTERDV-RS----
----------------------GSDFNSLNVS-DMSAESI--------------------
-----RRTQ-YPS-------FTDRPS--NLRVFSFSELKNATRNFSRSLMVGEGGFGCVY
RGVIKNSD--EP----T--ERTEIAVKQLNRKGLQGQKEWLTELNVLGIVEHPNLVKLIG
YCAEDD-ERGVQRLLVYEYMPNGSVDDHLSS---RSN--S-TLSWPMRLKVALDAARGLK
YLHEEMEFQVIFRDLKTSNILLDENWNAKLSDFGLARHGPSEGLTHVSTAVVGTLGYAAP
EYMQTGRLTAKSDIWGYGVLLYELITGRRPIDRNRPK-GEQKLLDWVKPYISDIKRFPII
IDPRLEGHY--------NLKSMTKLASVANRCLVRLPKSRPKMSEVYEMVQKIVASIETG
-----------------------------------TPQPPLHYHGSV----------SEP
GSKRPKKGSLKR-----RFQEFKFG-----CRQIVWRSWKPEI-----------------
----------IKTC
>gi|15232764|ref|NP_187594.1|	   418 residues, 50 /line  protein kinase, putative [Arabidopsis thaliana]
--------MKCFL-FSG--GDKRGEQKTP-------ISVSL--TSIFSDREIN-RS----
----------------------GSEFNSRDVS-GTSTESSMG------------------
-----RKNS-YPP-------VSTRAS--NLREFSITDLKSATKNFSRSVMIGEGGFGCVF
RGTVRNLE--DSSV------KIEVAVKQLGKRGLQGHKEWVTEVNFLGIVEHTNLVKLLG
YCAEDD-ERGIQRLLVYEYMPNRSVEFHLSP---RSL--T-VLTWDLRLRIAQDAARGLT
YLHEEMEFQIIFRDFKSSNILLDEDWKAKLSDFGLARLGPSEGLTHVSTDVVGTMGYAAP
EYIQTGRLTSKSDVWGYGVFLYELITGRRPVDRNRPK-GEQKLLEWVRPYLSDTRKFKLI
LDPRLEGKY--------PIKSVQKLAVVANRCLVRNSKARPKMSEVLEMVNKIVEASSGN
-----------------------------------GS----------------------P
QLVPLNSV--KASRDARGKNNGGGG-----EGGWFGKLWNPKT-----------------
----------IRAC
>gi|42570965|ref|NP_973556.1|	   462 residues, 50 /line  protein kinase family protein [Arabidopsis thaliana]
--------MKCFH-FTN--GDKRTTTTIE-------EGVG------GGDSVVS-RA----
----------------------SRLSWARSLSVASSTTSDPTRRSEFDSDW---------
SFSPERLTF-PKPLSQRWIGGLVPEN--DLKVFTFKELKIATKGFNRGLLIGEGGFGCVY
RGVVDVSD--SNGF--D--SKINVAVKQLNRQGLQGHKEWINEVNFLGVVNHPNLVKLVG
YCADDD-ERGMQRLLVYELMCNKSLEDHLVG---RVV--SVSLPWMMRLKIAQDAAQGLA
YLHEEMDFQLIFRDFKSSNILLDERFGAKLSDFGLARQGPPEGLGHVSTSVVGTVGYAAP
EYVQTGKLTAKSDVWSFGVVLYELITGRRAVDRNRPR-GEQKLLEWVKPYVSDSKKFHLI
VDPRLEGQY-------YCMKSVQRVAALANKCLMKQPKSRPKMSEVVSLLGRIIDEEAEN
-----------------------------------VPPPVADETEEIIKAELN--GESEP
ELKKQGSSYRKKVLDLRDKMNLNKS-----LSKLDWRNWTPGL-----------------
----------VRTW
>gi|7248457|gb|AAF43496.1|AF131222_1	   433 residues, 50 /line  protein serine/threonine kinase [Lophopyrum elongatum]
--------MQCFR-FAS--WEKEREEELQG----PARSQSALSNSSMSTDRDARRS----
----------------------GSECCSLTVSSEISVDSF--------------------
-----GRYR-QLSL------PHRPNN--DLRIFTFQELKSATRSFSRALMIGEGGFGCVY
RGTIQSTL--EP----R--RSLDVAIKQLGRKGLQGHKEWVTEVNFLGVVDHPNLVKLIG
YCAEDD-ERGIQLLLVYEFMPHGSLADHLST---RSP--K-PASWAMRLRVALDTARGLK
YLHEDSEFKIIFRDLKPSNILLDENWNAKLSDFGLARLGPQ-EGSHVSTAVVGTIGYAAP
EYIHTGRLSSKNDIWSYGVVLYELLTGRRPLDRNRPR-GEQNLVEWVKPYSSDTKKFETI
MDPRLEGNY--------NLKSAARIASLANKCLVRHARYRPKMSEVLEMVQKIVDSSDLG
-----------------------------------TPERPLISHSKK---------LASD
EKKRKGLNLKRRIA------DIKAG----DGRWFRWHKWTPKL-----------------
----------VRTQ

Ad blocker interference detected!


Wikia is a free-to-use site that makes money from advertising. We have a modified experience for viewers using ad blockers

Wikia is not accessible if you’ve made further modifications. Remove the custom ad blocker rule(s) and the page will load as expected.