Fandom

Proteins Wiki

At2g02790.1/MSA

< At2g02790.1

47,923pages on
this wiki
Add New Page
Talk0 Share
>gi|2947062|gb|AAC05343.1|	   650 residues, 50 /line  unknown protein [Arabidopsis thaliana]
-------------MGKTP------------------------------------------
---------SPGKWIKSLLG----------------------------------------
-------------KKSSKSSLEKGGE--KLVRRVNRSAKKEELVVKVKDNN---------
------------------------------------------------VSKLPT--EPPV
VSSQEV----------------------------AA------------------------
--TQTVVVPDVVIAEKQL--------------------SGDIEGDE--------------
SSNVNLESGND-SEEVKLEEAATKVQAALRAQQVNVYIFDIL------------------
----------AREESQNL----KGITRVQAVIRGHLVRRQAV-ATYSC------------
--------------IWGIVKVQ------------------------------ALVRGKKA
RSSETVAQLQKTNTETE-TSETLQGS----------------------------------
----------------------------------------------------------TY
SWMEN--PTKLSMI--DKLLVS------------------------------SPTTLPL-
K--IQYSPEDPNSAKVWLGRWTQL--QVWAPGPLVVKNL--VPKSQTKKRS-FQAVEAEK
GKLKRGVRKPTGVSTTANSSTSR--STADNEKPKRTVRKASTLGK-------ELSKIEND
KSKQSSRKSTSAIKEGSSV-------------------------------------EVKD
EKPRISHKKASL------------------------------------------------
------------------SNGIGKATRKSAEKKKEIADAVQK------------------
------------ELPIEEVSVSLVDAPEDEKMNLIPVTISKESDLDKD----EKSLV---
---------------LDKPEQDELRTA--------------------------ERDDKAE
EELKTAERDDSAEEKIQ-----------------------------EPDAQISS------
-------------------------------------------------ENGNVASENTK
PSDRRAS--LPA-KIENHHQDDGLTQSGR----KIPSYMAPT------------------
---------------ASAKAR--IRGQGSP-RIAQEK-PEK----N--------------
GTTRRHS--------------LPPA-ANG-KLS---------------------------
------------------------------------------------------------
----------------TMSPRAHRLL----------------------------------
-------------------------------------------------IAS--------
-----------------------AKGSMNSDRSFSSSKDIGGKRFK------------PI
TIHKPFCQFLLHYLHP-----------------FNKFSSCLYQTSRRKLSGNGESTKA--
--E
>gi|20268742|gb|AAM14074.1|	   437 residues, 50 /line  unknown protein [Arabidopsis thaliana]
------------------------------------------------------------
---------IVSSFLFVLVK-NKKNNKKNLNRRKFRQEFSSYNELSMGFFGRLFGSKKQE
KATPNRRRWSFATRS---------------------------------------------
--------------------------------------------------------SHPE
NDSSSHSSK--RRGDEDVL------NGDKHAIAV-A------------------------
--AATAAVAEAALAAARAA-------------AEVVRL-TNGGRNS--------------
--SVKQISRSN-RRWSQEYKAAMKIQSAFRG---------YL------------------
----------ARRALRAL----KALVKLQALVKGHIVRKQTA-DMLRR------------
--------------MQTLVRLQ------------------------------ARARASRS
SHVSDSSHPPTLMIPSS------PQSFHARCVS---------------------------
---------------------------E--------------------------------
-----------AEY--SKVIAMDHHH----------------------------------
-----NNHRSPMGSSRLLDQWRTEESLWSAPK----------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------YNEDDDKILEVDTWKPHFRESPRKRGS-------------------
------------------------------------------------------------
--------------LVV-----------------------------PTSVENSP------
-------------------------------------------------QLRSRTGSSSG
G-SRRKTPFTPA-RSE-------YEYYSG----YHPNYMANT------------------
---------------ESYKAK--VRSQSAP-RQRLQD-LPSE---S--------------
GYKR--S--------------IQG------QYY---------------------------
------------------------------------------------------------
----------------YYTPAAERSF----------------------------------
-------------------------------------------------DQR--------
-----------------------SDNGIAGYRGVSDGLDRN-------------------
------------------------------------------QSDKSKMYTSFFSSNPLF
-FQ
>gi|22209012|gb|AAC98688.2|	   796 residues, 50 /line  surface antigen PHGST#5 [Trypanosoma cruzi]
GQQHWTFANSATHAGCTN---------PIILEWEAGKIIMITSCESDRR--RVYESTDKG
NTWTEALGTLSRVWSNSLAGLGLHIQSGFITA----------------------------
--------TIGGK-KVILLTQLE------YSRHDSKGEIRLWLTDANRIYNVGL------
----------------------------------------------LATGYGATSSSLLY
ADDRLYCLY--EASGGSDSGAFFLDLTSELQRIRHA------------------------
--LDTWAAKDNALGKCSSI-------------ASDAAL----------------------
---------------SRWGCSVPFPTAGLVGH-LADRFSGHK------------------
----------WE----------DEYLGVNAVVRGATKKVPSG-LTFEGQGAGAEWPVDKQ
WPTRPLHFANYGFTLAATVSIHEVPKGITPLMGLKRMGTTTLLGLSYDKNMEWSVVNDLF
PKHFTAWEVDKTYHVVLKMHDGVGSVYVDGTLL---------------------------
---------------------------WNMRLK-NSFNEGLGTVSHF--YFGAYDEQLSS
GKIHA--TVANVFL--YNRPLN-------------------------------ETEIGAL
N--ASKVTIPPPERKPVPAAAATSSS-----VEPANERV--TTNTQPTVPSPATAGPQQT
DQTTLNASSVPSGGAPSKPAEPKS-AEPEPAEPKSAGPKPAEPKSAEPKPAEP-------
------------------------------------------------------------
------------------------------------------------------------
-------KSAEPKPAEPKSAGPKPAEPKSAEPKPAEPKSA--------------------
-------------EPKPAEPKSAEPEPAEPKSAEPKPAE-------------------PK
SAEPKPAEPKS-----AEPKPTEPKSAEPKPAEP--------------KSAEPEPAEPKS
AEPEPAEPKSAEPKPAE-----------------------------PKSAEPEPTEPKSA
GPKPAEPYSAEPKPAE---------------------PKSAEPEPTEPKSAEPEPTEPKS
AGPKPAEPYSAEPKPAEPKSAEL----NA----TTPSAREGA------------------
---------------ADQSAS--VTSSGAS-STDVGA-SSSDDAQT--------------
VGME--------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------GGDMMQADQPVQFSVGTPDAAN-----------------------------
--------------------------------AATHNAEGKGQ-----------------
----------------------------------DGLHPQVKEAEAATL---------SS
S-L
>gi|30022804|ref|NP_834435.1|	   728 residues, 50 /line  Spore germination protein IA [Bacillus cereus ATCC 14579]
---------------MI-------------------------------------------
-----------WNWLRKKKK-SNKPEANETDNQEQ--------------------HSNNE
EDDNKEQTRSMKHNKGKNHEQKD------------------SSQDKQQSTKQKD------
----------------------------------------------SSQDKQQSTKQEDS
SQDKQQSTK--QED-SSQD------KQQSTKQKDSS------------------------
--QDKQQSTKQEDSSQDKQ-------------QSAKQDEPSQDKQQNSKQDDSSQDKQQS
AKQEDSSQDKQ-QNSKQDDSSQDKQQNSKQD---------DS------------------
----------SQDKQQSTKQEDSSQDKQQGAKQGDSSQDKQQ-NAKQD------------
--------------EPSQSKQQHSKGNSIYDF--------------------TKPEKDRI
HSLQNL--------------------------I---------------------------
---------------------------EKLKKS-SDFVNYHTSDDET--MPYWISYYRPS
LDGEK--LQKYLMP--TLLERPNASLEE--------------------------------
------------------------------------------------------------
--------------------------------------------------LKEHIPMSGI
TITNDLQKIEDMVLKGHAII------------------------------------QLNQ
QDQKCMLANIAIDNYRAPTPPLNESTVIGPQEGFVEDID---------------------
-------TNINLVRKRLPV-----------------------------------------
-----------------------------------------------------------L
DLQTKEMIIGEFSKTKVVMMYLDNLAEKDNVDFL--------------EESLRAL--EYD
QINDSAYLQELMGEKSI-----------------------------FPLYINTE---RTD
RVTKALIDGKIAIFVDGSPSVLLTPVSYFDFFISPEDYN---------------------
-------VSWMYATFSRILRLIAVLFSIC----ATPLYVAVLNYHYELIPSDLLETLILS
RAQVPFPPLIEALFLELAIDL--LREAGAR-LPMKVG-QT--------------------
LGIVGGI--------------VIGQ-ASVQAGL---------------------------
------------------------------------------------------------
----------------TSNILLIIVALSALASFITPIYKMGNAVRLLRFPFLMFAEIGGL
FGISLG----FIFLFTHLFRLTSLRKPYALFYPTRQQSVKDSWIRFPLTMID--------
-----------------------TRDVQARPQHVKKAAKG--------------------
---------------------------------------------------ISTKHRSDF
D-D
>gi|30686055|ref|NP_173318.2|	   572 residues, 50 /line  IQD30; calmodulin binding [Arabidopsis thaliana]
-------------MGKP-------------------------------------------
-----------ARWLKSV------------------------------------------
---------LLGK-KPSKSSGSKDKE---------RIVNGKEVVVISKIEESDV------
----------------------------------------------VSDLSSIG--NAAV
YTS-------------------------------GI------------------------
--VETQNLKHEDVSDDEIQ-------------VSE---VQPTDSQD--------------
VASVPDDSLSE-SEKIQQEIAAVTVQAAYRG---------YL------------------
----------ARRAFKIL----KGIIRLQALIRGHMVRRQAV-STLCC------------
--------------VMGIVRLQ------------------------------ALARGREI
RHSDIGVEVQRKCHLHHQPLENKANSVV--------------------------------
-------------------------------------------------------DTHSY
LGINK--LTGNAFA--QKLLAS------------------------------SPNVLPL-
S--LD----NDSSNSIWLENWSAS--CFWKPVPQPKKAS--LRKSQKKFASNPQIVEAEF
ARPKKSVRKVP--SSNLDNSSVAQ-TSSELEKPKRSFRKVSTSQSVEPLPSMDNPQVDLE
KVKRGLRKVHNPVVENSIQP------------------------------------Q---
------LVPQIA----VEKPNGSLEESVNAFDEEKED------EVAET------------
-VVQQPE-------ELIQTHTPLGTNESLDSTLVNQIEESEE------------------
------------NVMAE-------------------------------------------
------------------------------------------------------------
----------EKEDVKE-----------------------------ERTPKQNH------
-------------------------------------------------KENSAGKENQK
S-GKKASSVTATQTAEFQESGNGNQTSSP----GIPSYMQAT------------------
---------------KSAKAK--LRLQGSS-SPRQLG-TTE-------------------
KASRRYS--------------LPSS-GNSAKIT---------------------------
------------------------------------------------------------
----------------SHSPKT-RVS----------------------------------
-------------------------------------------------NSS--------
-----------------------GKSGNKTEKTLLSSREGNG------------------
-----------------------------------------------------KATPVEW
K-R
>gi|3292832|emb|CAA19822.1|	   543 residues, 50 /line  putative protein [Arabidopsis thaliana]
-------------MGKA-------------------------------------------
-----------SRWFRSLFG-VKKPDPGYPDLSVE--------------------TPSRS
TSSNLKRRWSFV-KSKREKESTPINQ--------------------VPHTPSLP------
----------------------------------------------NSTPPPPSHHQSSP
RRRRKQKPM--WED-EGSE------DSDKHAIAV-A------------------------
--AATAAVAEAAVAAANAA-------------AAVVRL-TSTSGRSTRSPVKARFSDGFD
DVVAHGSKFYG-HGRDSCELAVIKIQSIFRG---------YL------------------
----------AKRALRAL----KGLVRLQAIVRGHIERKRMS-VHLRR------------
--------------MHALVRAQ------------------------------ARVRATRV
IVTPESSSSQSNNTKSS-HFQNPV-----SLVK---------------------------
---------------------------FPMIVP-FNLKHGPPTPEKL--EHSISSRSSKL
AHSHL--FKVLHFQ--LLF--VSSVFVAC-------------------GPISSKFQRLYK
L--L---TLLYVQNKSNLKNWNGS--KASDNNRLYPAHR--ETFS---------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------ATDEEEKILQIDRKHISSYTRRNRPDMFYSSHLI----LDNAGLSE
PVFATPFSPSS-------------------------------------------------
---------SHEEITSQ-----------------------------FCTAENSP------
-------------------------------------------------QLYSATSRSKR
S-A------FTA-SSIAPSDCTK-SCCDG----DHPSYMACT------------------
---------------ESSRAK--ARSASAP-KSRPQL-FYE----R--------------
PSSKRFG--------------FVDL-PYC-GDT---------------------------
------------------------------------------------------------
----------------KSGPQKGSA-----------------------------------
-------------------------------------------------LHT--------
-----------------------SFMNKAYPGSGRLDRLG--------------------
-------------------------------------------------------MPIGY
R-Y
>gi|53749315|gb|AAU90174.1|	   538 residues, 50 /line  hypothetical protein [Oryza sativa (japonica cultivar-group)]
-------------MGKK-------------------------------------------
-----------GKWFDAVQR-ALSTSENDS---HE--------------------NEKKG
KRSTLKKILQFS--KSSASTSSPPVT----------------------------------
--------------------------------------------------SPSA--RQQP
HHHHPPPPQ--AAPPDRQR------DDG--------------------------------
--IKEAKSSDAAAAAAQKT-------------ATATAV----------------------
-TRPTTTAPRA-PARSAEELAAVKIQKACRV---------YL------------------
----------GRRSQRA-----RGLDRLMLLLEGLAVKRQTY-EALYC------------
--------------MQTMTRVQ------------------------------TQIHSRRV
KTEEDKKALKSQVHVKQ-S-------------L---------------------------
---------------------------DRIKIG-ESWDHGHQSKEQI--ETVLTMKQEAA
LRRQR--ALAYAFS--HQETFICASLAAS-------------------NVHGHRQPQLGM
----ELGGAMDGGGEAVGEPDHAGEQRPCSRGGERRRQR--EAGAHVGAD-T--------
---------------HVDAGVGQV------------------------------------
------------------------------------------------------------
-------------------------------------HPPAELPVAVD------------
-THAAVAVEDVGGAAVE-------------------------------------------
-------------------------------PGRQPVPEVGDGDDRPA------------
----------------------------------------------------------PH
DEPAAGAAAELRAARGG-----------------------------ERQPGPR----REG
RRRPPLAAAHDEPAVRGAAEEAE-------------------------------------
------------------------------------------------------------
--------------------P--RRRRRRP-GERRRG-AADAELH---------------
----ADD--------------QVRE-GQG-GSA---------------------------
------------------------------------------------------------
----------------GGDRGPRHRRE-----------------DGARSPSGD--LTVGD
QQA---PFPGLRGQAEQRPVAEQGEGREVDAATLAASEP---------------------
--------------------------------KVLISQQPNV------------------
-------------------------------------------------NPVAAMLRSGW
LVA
>gi|6723396|emb|CAB66405.1|	   535 residues, 50 /line  SF16-like protein [Arabidopsis thaliana]
-------------MGKKG------------------------------------------
---------S-GGWFSTVKKKVFKSSPKDS---KR--------------------EN---
-----------------------------------NIGSNNADIWQQQHDTQEV------
----------------------------------------------VSFEHFPA--ESSP
EISHDVEST--ASTPATNV------GDRKHAMAV-A------------------------
--IATAAAAEAAVAAAQAA-------------AKVVRL-AGY------------------
------------NRQTEEDSAAVLIQSHYRG---------YL------------------
----------ARRALRAL----KGLVRLQALVRGNHVRKQAQ-MTMKC------------
--------------MQALVRVQ------------------------------GRVRARRL
QVAHDRFKKQFEEEEKR-SGMEKPNKGFANLKT---------------------------
---------------------------EREKPK-KLHEVNRTSLYQT--QGKEKERSEGM
MKRER--ALAYAYT--YQRQMQ----------------------------HTNSEEGIGL
S--SNGPD-RNQWAWNWLDHWMSS--QPYTGRQTGPG-----------------------
------------------PGPGQY--------------NPPPY---PPFPTAAAT-----
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------TTSDDVSEKTVEMDVTTPTS----------------------------
---------------------------LKGNIIG--------------LI----------
------------------------------------------------------------
------------------------------------------------------------
---DREYIDLGS-YRQ---GHKQ-RKSPT----HIPSYMAPT------------------
---------------ASAKAK--VRDQG-P-TVKLQG-TSFMPYWN--------------
SSTKNGS--------------VNGS-G---CDS---------------------------
------------------------------------------------------------
----------------SSSGGAITTGYPG----PRSPNPKSDIRRKPVSPSQSPTGVVFE
LCANEKTSHEVTPIPTEALSLWHYKEKSEDSHSKTRTSR----------ACC--------
-----------------------LQRNCVVLDLALMLEHFRK------------------
-------------------------------------------------TWG----QSAE
S-S
>gi|92867060|gb|ABE77483.1|	   725 residues, 50 /line  IQ calmodulin-binding region [Medicago truncatula]
-------------MGKGR------------------------------------------
---------SPGKWIRS-------------------------------------------
--------LLSGGKKSSSKSSSSKKN------DIFKSSSNKDALGSSELTVSNP------
----------------------------------------------ISTVDSLQ--ISA-
------------------------------PISGAN------------------------
--VAKAVISEKEVVNKSSH-------------ERGILSNGDEKAQA--------------
PAFANVASQDD-LETLRLTEAAIKLQSACRG---------YQ------------------
----------ARREFQTL----KAITQLQAFIRGHLVRRQAV-SALYC------------
--------------VKGIVTVQ------------------------------ALARGYNV
RRSDIGLEVLKIRKDTQ-CSKSIGVV----------------------------------
----------------------------------------------------------TS
TPADK--LSENAFV--CQLLAS------------------------------STHAFPL-
S--LNSDLGEPYLASKWLDRWTTS--SFWAPLPKLKKKL--DSV------------SAEK
VQVKRTTRKSP--AVKADEGSSSG-SNKQKQRPKKDSNH--SL---VSAQAQEHPKKEIE
KSSLKKTR----VQNVSDRS------------------------------------EIVN
EKRKHSSRATSD----QTVTDVSEQGSGSSSEKIKETTVPKSEKVLEE------------
-NNDQPKKNSNGGAKEEKVLGKKTLEEKNDKPKKSLNGSAKD------------------
------------EKSLEQKTLEENNDKPKKSLNGSAKEEKSLGQKTPE----ENNDKPKK
SLNGGVKEEKDLGQKTQEENNDKPKKSLNGGVKE--------------EKDLGQKTQENN
DKPKKSLSGGAKEEKGL-----------------------------GQKAQEEN---NGK
PKKSLNGSAKEEKGLRQKALEQEGHNDPNAVLQTSMKKVGDEEIGVSEDLNGGDKIISNN
Y-QRRAS--LPA-NFNDQENEIH-NTPSP----RVPSYMAPT------------------
---------------ESAKAR--LRGQGSP-RFATDI-IDK----N--------------
SFTRRHS--------------LSSS-LNS-KSG---------------------------
------------------------------------------------------------
----------------SFSPRVEKLI----------------------------------
-------------------------------------------------TLS--------
-----------------------GRGVARTDKSLSSSRDGTD------------------
-----------------------------------------------------KMTQPQW
R-R
>gi|92876066|gb|ABE83811.1|	   438 residues, 50 /line  IQ calmodulin-binding region [Medicago truncatula]
-------------MGV--------------------------------------------
---------P-GKWIRA-------------------------------------------
--------LVGL-KKSEKRESLEKDG------NASKFRHRRKNSVEIDNGKLQN------
------------------------------------------------------------
------------------------------EFDNDG------------------------
--AAPIGDADHANPQSNLE-------------AHYSPS----------------------
TSQQVQDPAHN-HQITSEEWAAICIQTAFRG---------FL------------------
----------ARRALRAL----KGLVRLQALVRGHAVRKQAA-ITLRC------------
--------------MQALVRVQ------------------------------ARVRARRV
RLSLESQTEQQKLQQQL-VNEARVREIE--------------------------------
----------------------------------EGWCDSVGSVEEI--QAKILKRQEAA
AKRER--AMAYALA--HQWQAG------------------------------SRQQAIS-
S--GFEPD-KSSWGWNWLERWMAV--RPWENRFLDINTK--DG--VKADE-NDVMDGRNG
IRPQFKSTNTK--SN---------------------------------------------
------------------------------------------------------------
---LANIHPSVV----SHKTGPSLSDG---------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------------------------------------------------------CDSSS
T-SKSAG--LLE-TSNTQSVKPK---SNA----NVQNPVEET------------------
---------------NSKSGV--QRSQSNP-KERNSQ-VDK----P--------------
-AKKRLS--------------LPNH-GVG-SGA---------------------------
------------------------------------------------------------
----------------QTAKYPTRSNM---------------------------------
-------------------------------------------------KGT--------
-----------------------RSTQKPTRDKPKLNGGGDV------------------
-------------------------------------------------NLT-KSVPPPA
V-V
>gi|92877351|gb|ABE84487.1|	   584 residues, 50 /line  IQ calmodulin-binding region [Medicago truncatula]
-------------MGK--------------------------------------------
---------SPGKWIKT-------------------------------------------
--------VLFG-KKASKSNIPRGRE---------KLVNQKEGVVASKVSETGL------
------------------------------------------------------------
------------------------------ALEP-T------------------------
--SNTIAVHEEDLELENKE-------------AENVLP-GNQEIDT--------------
VGPVDQDAPLD-PEKMKLEEAATKAQAAFRG---------YL------------------
----------ARRAFRAL----KGIIRLQALIRGHLVRRQAV-ATLCC------------
--------------MYGIVKLQ------------------------------ALVRGQII
RKSDVGFEIHEKCNLLK-LQDAKPVKPI--------------------------------
----------------------------------A-----------------------IS
GKIMK--LSANTFT--RKLIAS------------------------------STTIMAL-
R--LQYVCGDPNSVLSWSERWSAC--RFWKPIPQPKKIR--DTKSQKKQG-NISTGDAQM
TKSKRTHRKLP--TANFDVAPAQA--NPEVEKPKRNTRKFPSQ---PSDPLLENPQIELE
KVKRNLRKVHNPVVEAAVLS------------------------------------EVES
EIPKPHLEKEIV----ASSAGVSQQGVINSNEMVKKEATLTSE-----------------
-------------------------------PEMGITPSPRD------------------
-----------------LVTKEVFDTPSSYQVNVESKPLTDITSKDKN----ISDDEVK-
------NEPKDLEET---------------------------------------------
---------VCKDENSH-----------------------------LTNGDLNH------
-------------------------------------------------KEDQTGSENQK
P-TRKAS--IGA-KQERAENGLI---NSP----TVPSYMAAT------------------
---------------ESAKAK--LRAQGSP-KVVQDG-SEK----N--------------
NSARRQS--------------LPSP-TNS-KIS---------------------------
------------------------------------------------------------
----------------SHSPRTQRPV----------------------------------
-------------------------------------------------HSG--------
-----------------------GKGGHKSDKAASSSRDGNG------------------
-----------------------------------------------------KVVQAEW
K-R
>gi|92881543|gb|ABE86306.1|	   441 residues, 50 /line  IQ calmodulin-binding region [Medicago truncatula]
-------------MGF--------------------------------------------
---------LRRLFGAK--KPIPPSDGSGK---KS--------------------DK---
---DNKRRWSFG-KQSSKT-KSLPQP---------PPSAFNQFDSSTPLERNKH------
------------------------------------------------------------
------------------------------AIAV-A------------------------
--AATAAVAEAALAAAHAA-------------AEVVRL-TSSGVAG--------------
----SSNKTRG-QLRLPEETAAVKIQSAFRG---------YL------------------
----------ARRALRAL----KALVKLQALVRGHIVRKKTA-DMLRR------------
--------------MQTLVRLQ------------------------------TKARASRA
HLSSDNLHSFKSSLSHY-PVPEEYEQPH--------------------------------
----------------------------------H-----------------------VY
S--------TKFGG--SSILKR------------------------------CSSNSNF-
R--KIESEKPRFGSNWLDHWMQ--------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------------ENSISQTKNASSKNR------------------
-------------------------------------HPDEH------------------
-----------------KSDKILEVDTWKPQLNKNENNVNSMSNESPS----KHSTKAQ-
------NQSLSVKFH---------------------------------------------
---------KAKEEVAA-----------------------------SRTADNSP------
-------------------------------------------------QTFSASSRNGS
G-VRRNTPFTPT-RSECSWSFLG---GYS----GYPNYMANT------------------
---------------ESSRAK--VRSQSAP-RQRHEF-EEY----S--------------
STRRPFQ--------------GLWD-VGS-TNS---------------------------
------------------------------------------------------------
----------------DN------------------------------------------
-------------------------------------------------DSD--------
-----------------------SRSNKVSPALSRFNRIGSS------------------
-----------------------------------------------------NL-----
--R
>gi|10086499|gb|AAG12559.1|AC007797_19	   805 residues, 50 /line  Unknown Protein [Arabidopsis thaliana]
-------------MGRSP---------------------------------------A--
-----------SSCLRLISC-SGGDDTSADPNS----------------------TALEN
KSSGDKRGWSFR-KKSGKQRGLITSVVSETTPASRTRETLE-------------------
-------------SALLKSPSPDNNNVS-EKQQQSFSVD--EKKSQLPVVTYVA--EPVD
EKKTQSVI-EEKTELLSVE------EQIDHRTEV-SPVIVESKGTETEEDDLIGTELQGP
SAADAAKIEEDVTSEVEMASKVEPEESESDDVIIVRKE-SDEK-----------------
------------VDEKLDESVIVVIQAAVRG---------FL------------------
----------ARRELLRS----KKVIKLQAAVRGHLVRSQAM-GSLRC------------
--------------VQAIVKMQ------------------------------AMVRARHS
TKD--GSRVSATSDKS-EPNA-------------AAQKLLEN-----K-FAKHLMES---
----------------TP------------------------------------------
----------------------KTKP-------------------------------INI
---KCDP-TKPSSAWNWLERWMSV--PKPEKTSKANLTTEEQNLEETQN--V--------
-------KISP--QADFVNSDSTVENKTETDMPSYEASKVEGQ---NVELSETEKMSQYD
SPEASAEVYYDSIQSQPLAAKPD------SLLEEPEYVDGQIKHSLK-------------
-------RKVSN-----PSFIAAQSKFEELTSSTGSNKAMTLSSKDDVL---GEEGKTDI
DSPDTTNTIKDH-----SLEDVTPAELSGSECGTELSVTSSLD------TLEKKSDAEG-
AEPRVEAKLLEDDTFKTDQAELIEIDVKDATSMGTVEDPKEKVENA---K--DEVEISAT
HHEPVISTP-DSKKRRAEDESGPQAYALSEGALTPMTITESQATPASQASSSVKARKGKS
EKSGSSQKRKVSKKITSSPKQ-----------------------EI-----GTG------
-------------------------------------------------EATEQEEGKEQ
K---SGRRTSFG-YDQEARESSG---GKN----SLPRFMQPT------------------
---------------QSAKAK--VQEHNSP-RSSPDL-QERDV----------------V
SAKKRHS--------------LPGVT----------NGKQVS------------------
------------------------------------------------------------
----------------PRIQRSAS------------------------------------
------------------------------------------------------QAQQGT
KGKNNLLQ---------------SFL----CNHSS-------Q-----------------
------------------------------------------------------------
--F
>gi|110737787|dbj|BAF00832.1|	   534 residues, 50 /line  hypothetical protein [Arabidopsis thaliana]
-------------MGKKS---------------------------------------GS-
---------S-SSWLTAVKR-AFRSPTKKEHNNNAHG--NE--------------VDEDE
DKKKEKRRWLFR-KSTNHDSPVKTSGVGKDAPAQKSTET---------------------
------------------------------------------------------------
-----TTI-INPTV---LS------SVTEQRYDA-S------------------------
--TPPATVSAASETHPPSTT------------KELPNL-TRR------------------
------------TYTAREDYAAVVIQTGFRG---------YL------------------
----------ARRALRAL----KGLVKLQALVRGHNVRKQAK-MTLRC------------
--------------MQALVRVQ------------------------------SRVLDQRK
RLSHDGSRKSAFS---------------------DTQSVLES-----R-YLQEIS-----
------------------DRRSMSREG--SSIA-EDWDDRPHTIEEV--KAMLQQRRDNA
LRRESNNSISQAFS--HQV--RRTRG-------------------------------SYS
---TG-D-EYEEERPKWLDRWMAS--KPWDKRASTDQR----------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------VPPVYKTVEIDTSQPYLTHGNSR--TGASPS---R--SQRPSS-P
SRTSHHYQQ-H-----NFS---------------SATPSPAKSRP---------------
-----------IQIRSASPRI-----------------------QRDDR--SAY------
-------------------------------------------------NYTSNTPSLRS
N---YSFTARSG-YSVCTTTTTA---TNA----ALPNYMAIT------------------
---------------ESAKAR--IRSQSAP-RQRPST-PEKERI---------------S
SARKRLS--------------FPVPP----------LPQQMD------------------
------------------------------------------------------------
----------------GQSLRSPS------------------------------------
------------------------------------------------------FKSIGG
SQLGALEQQS-NYSSCCTESLGGGGE----ISPASTSDYRRWL-----------------
------------------------------------------------------------
--R
>gi|115474509|ref|NP_001060851.1|	   543 residues, 50 /line  Os08g0115200 [Oryza sativa (japonica cultivar-group)]
-------------MGKKA---------------------------------------GT-
---------T-SSWLTAVKR-AFRSPSKDDSPNKAAR--LRD-------------DTDDD
KGKRERRRWLFR-KSSSPSPAPPTPPPPQQQQQQSRAAA---------------------
------------------------------------------------------------
-----------------VT------EEQRHAIAL-A------------------------
--VATAATAEAAVATAQAA-------------AEVVRL-TRPS-----------------
------------SSFVREHYAAIVVQTAFRG---------YL------------------
----------ARRALRAL----KGLVKLQALVRGHNVRKQAN-MTLRC------------
--------------MQALVRVQ------------------------------ARVRDQRM
RLSQDSISLSAAAASA-APCGSSK-----SSYSVDTSTFWDS-----K-YTHDFAAA---
----------------DRRSIERSRDGSSFAAG-DDWDDRPRTIEEI--QAMLQTRKDAA
LKRER--ALSYAFS--HQI--WR-NP-------------------------------APS
---VE-E-MDVDGQPRWAERWMAS--RASFDTSRSTVRASAA------------------
------------------------------AAPGRA------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------STDHRDQVKTLEIDTARPFSYS---------TPR---R--HGNASY-H
ASSSPMHRA-H-----HHS---------------PVTPSPSKARPP--------------
-----------IQVRSASPRV-----------------------E---R--GGG------
-------------------------------------------------GGGSYTPSLH-
--------------SHRHHASSG---GAA----AVPNYMAAT------------------
---------------ESAKAR--VRSQSAP-RQRPAT-PERDRMSFGGGGG-------GG
GAKKRLS--------------FPVPI----------DPYGAY------------------
------------------------------------------------------------
----------------AQSLRSPS------------------------------------
------------------------------------------------------FKSAAG
RFSS--EQRS-NVSSSCAESLGGD-V----VSPSSTTDLRRWL-----------------
------------------------------------------------------------
--R
>gi|147790453|emb|CAN76669.1|	   537 residues, 50 /line  hypothetical protein [Vitis vinifera]
-------------MGKKG---------------------------------------G--
-----------SSWLTAVKR-AFRSPXKDNEKKSSRR--RED---H-------ELEEEEE
EKKREKRRWIFR-KPTTTTTTTKSCFKFQECETKMISST---------------------
------------------------------------------------------------
-----TV--PTNPI---LV------AEQRHAIAV-A------------------------
--AATAAAAEAAVATAQAA-------------VEIVRL-TRPS-----------------
-------------SFFREHYAAVVIQTAFRG---------YL------------------
----------ARTALRAL----KGLVKLQALVRGHNVRKQAK-MTLKC------------
--------------MQALVRVQ------------------------------SRVRDQRA
RLSHEGSRRSMFA---------------------ETNSLWES-----R-YLQEIR-----
------------------HRKSMSRDR--SSIA-DECCGXPHXIEEI--EAMFRSRKEGA
LKREK--ALAYAFS--HQV--WRSGR-------------------------------NPF
---AGDE-EDLEERTKWLQRWMAT--KRWESSSRAS------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------------TDKRDAIKTVEIDTSRPYSXSASNVRRSSVYQN---Q--HLRPPTPH
STASPFHKA-HHNLSLHXS---------------PVTPSPSKTRP---------------
-----------LQVRSASPRC-----------------------LKEEE----S------
-------------------------------------------------HSTAHTPNLAS
I---HCFNGSXC-RXGASTNGDV---ASA----VLPNYMAAT------------------
---------------ESAKAR--VRSESAP-RQXPST-PERERGG--------------G
SARKRLS--------------YPVPE----------APLSST------------------
------------------------------------------------------------
----------------STTCSSML------------------------------------
------------------------------------------------------SKSLRS
PS--FKSVHA-NXSSCYTDSLGGE-I----SPTTTSTEQRGWL-----------------
------------------------------------------------------------
--R
>gi|115440873|ref|NP_001044716.1|	   500 residues, 50 /line  Os01g0833800 [Oryza sativa (japonica cultivar-group)]
-------------MGKK-------------------------------------------
-----------GNWFSAVKK-VFSSSDPDGR----------------------EAKIEKA
DKSRSRRKWPFG-KSKKSDPWTSTVAVPTSTAPPPQPPPP--------------------
--------------------------------------------------------PPTH
PIQPQPEEIKDVKAVETDS------EQNKHAYSV-A------------------------
--LASAVAAEAAAVAAQAA-------------AEVVRL-TTATTAVP-------------
---------KS-PVSSKDELAAIKIQTAFRG---------YL------------------
----------ARRALRAL----RGLVRLKSLVDGNAVKRQTA-HTLHC------------
--------------TQTMTRVQ------------------------------TQIYSRRV
KMEEEKQALQ---------------------------RQLQL-----K-HQREL------
---------------------------EKMKID-EDWDHSHQSKEQV--ETSLMMKQEAA
LRRER--ALAYAFS--HQW--KNSGRT-----------------------------ITPT
---FTDQ-GNPNWGWSWMERWMTS--RPWESRVISDKDPKD-------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------HYSTKNPSTSASRTYVPRAISIQ-RPATPN---K--SSRPPSRQ
SPSTPPSRV-P-------------------------------------------------
--------SVTGKIRPASPRD-----------------------SWLYKEDDLR------
-------------------------------------------------SITSIRSERPR
R---QST---GG-ASVRDDASLT---STP----ALPSYMQST------------------
---------------ESARAK--SRYRSLL-TDRFEV-PERVPL------V-------HS
SIKKRLS--------------FPVAD----------KPNGEH------------------
------------------------------------------------------------
----------------ADKLMERG------------------------------------
------------------------------------------------------RRHSDP
P------------------------K----VDPASLKDVPV-------------------
------------------------------------------------------------
--S
>gi|115453071|ref|NP_001050136.1|	   501 residues, 50 /line  Os03g0355700 [Oryza sativa (japonica cultivar-group)]
------------MERK--------------------------------------------
---------R-RGWLERIKR-LFVSEPKQKPKPD--------------------------
-KKVKSKRWMFA-GKLKTQHSFALPAPAPA------------------------------
------------------------------------------------------------
--------VEEEQIRQAED------EQSKHAMAV-A------------------------
--LATAAAAEAAVAAAHAA-------------AEVVRL-TGKTAALAP------------
----APATTTT-PTPYGHEHAALMIQSVYRG---------YL------------------
----------ARRALRAL----KGLVRLQALIRGQAVRRQTA-ATLRG------------
--------------LESLMKIQ------------------------------ARQRARAS
SAAAAGGDHNAAN--------------------SPAPDGMDALL---R-RGRELY-----
------------------YAAAAAV--HEQQLS-KGWDSSTLSKEEM--SAMSRSREEAA
LKRVR--ALQYASL--HQS--EKVGVR-----------------------------RQPM
S--REEM-ETLNQRWSWLEEWVGS--QPPFDKDIPVAHQSPS------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------RDAAGAAMNDDERPPPP---------------------------
----------------------------------PVLRSRSRADRL--------------
--------------------------------------------ACVGGDDDD-------
---------------------------------------------------ADRQLGYSA
R---RSFTRAGR-RTPARDDDGG---GAA----AFPGYMAST------------------
---------------ASAKAK--FRSMSTP-KERSGA-GAADAYS----EQ-------CF
PFADRLL--------------SPIPS-MS-PIPSIASDIVFA------------------
------------------------------------------------------------
----------------RSSRPAAA------------------------------------
------------------------------------------------------QRSPRV
KGPMTPTRSR-SRRSPGRHSFGSEA-----ALHQLQMEQYTPI-----------------
------------------------------------------------------------
--R
>gi|115454245|ref|NP_001050723.1|	   447 residues, 50 /line  Os03g0636700 [Oryza sativa (japonica cultivar-group)]
--------------------------------------------------------MGR-
---------A-GRWLRSFLP-GKKDRARAPAPEKEQAV-----------------AVVTT
PGAKEKRRWSFR-RPAVKDGGGGFLE----------------------------------
------------------------------------------------------------
----------------PRV------DPDQHAVAV-A------------------------
--IATAAAAEAAVAAKQAA-------------AAVVRL-AGSSRRGV-------------
------------VVVGIEEAAAIKIQCVFRS---------YL------------------
----------ARKALCAL----RGLVKLQALVRGHLVRRQAS-NTLRC------------
--------------MQALVAAQ------------------------------HRARAARL
RLLDDDKEKPLLH--T-PRMMPTR-----RSPHHP------------R-FRHQQQQQ---
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------EAEENVKIVEVDTGFGGGGGSGEAHCT--------P--RTSSRRSS
CYATPLCRT-PSK-VELYQ---------------KVSPTPS--ALTDASA----------
--------------RTYSGRY-----------------------------DDFS------
-------------------------------------------------FSTARNSPWHH
H---HASDAPCK-PHHPHHGNGD---HPL----FFPNYMANT------------------
---------------ESSRAK--ARSQSAP-RQRASV-SSSASEA-----SSVRWERQ-A
SARRRAS--------------LEAQ--AA-SAPPNKCGAAMM------------------
------------------------------------------------------------
----------------ARVQRCPS------------------------------------
--------------------------------------------------QA----SAPA
SCPWGSRLPD-HDSECGSTSTVLTAATTTYCWSLATDNAAAAM-----------------
------------------------------------------------------------
--A
>gi|77557025|gb|ABA99821.1|	   466 residues, 50 /line  IQ calmodulin-binding motif family protein, expressed [Oryza sativa (japonica cultivar-group)]
-------------MAHCSAACSLLLQHCSGLQEFAVLQIYLTECMCKKK--KKKSKMGK-
---------A-GRWLRSFLT-GGKKDRKGKDGGQPPAP-----------------PSPAP
PSAKEKRRWSFR-RPPAQATTN--TS----------------------------------
------------------------------------------------------------
----------------SLC------FSDVHAVSP-A------------------------
--PEAESSAAADVAEENEA-----------------------------------------
-----------------AAAAAVRIQAAFRS---------YL------------------
----------ARKALCAL----RGMVKLQAMVRGQLVRRQAS-TTLRR------------
--------------MQALVAAQ------------------------------RRARAERL
CLLDDDKDKHARSPRP-PTTTSRR-----SSPQHH------------R-SRKPLEVV---
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------DRGSEENVRVVEVDNGGGGGGA---------------A--RGCGRRST
CGAAA---A-AAK-GELYQ---------------KVSPTPS--ALTEASA----------
--------------RTMSGRL-----------------------------DDYS------
-------------------------------------------------FSAAASEASGR
H---HSVPAAAV-A-GGDHAAAL---QQL----FPKNYMSNT------------------
---------------ESSRAK--ARSQSAP-RQRHDQ-PISAAASPSPSPSCGEWTTTPG
DRRRRAS--------------LDPR--DL-AAPASAAGVGVG------------------
------------------------------------------------------------
----------------ARMERCAS------------------------------------
--------------------------------------------------QARASASASA
ACPWAVRMDR-STASLAGGSDGG----SSAATAVTAATAARVT-----------------
------------------------------------------------------------
--S
>gi|125531951|gb|EAY78516.1|	   490 residues, 50 /line  hypothetical protein OsI_032475 [Oryza sativa (indica cultivar-group)]
--------------------------------------------------------MGK-
---------A-GRWLRSFLA-GKKDGGGRRSGERQQHGGGDA---T-------PAVEVAA
ASTREKKRWSFR-RSSASASAAAMGKPAAVTAPSTP------------------------
--------------------------------------------------------EPSV
SGLASVSER--ARDVADLE------GQSKHAMAV-A------------------------
--AVATAAEGDDV-----------------------------------------------
------------SASAVEVVAAVMIQATYRG---------YL------------------
----------ARKALCAL----RGLVKLQALIRGNLVRKQAT-ATLRR------------
--------------MQALLVAQ------------------------------ARLRAQRM
RMLEEEEDDDVHGH---GHHHHRR-----SSPHHP------------R-HRRSYEM----
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------DRSGEEQAKIVEVDVGEPAPPRRGRSSCS--------V--AASESRE-
-------RR-MAE-YGYYA---------------QCSPAPSSSAFTAAAAAS--------
----------PPRDASYSGHF-----------------------------DDFS------
-----------------------------------------------------PFEPATA
R---SSPYIPP---SPAGGGGGG---GGE----FFPNYMANT------------------
---------------QSSGAK--ARSQSAA-EAAHRA----SPPAPPPAAAALRAAAQPP
PRRRRAEERQDAAFVVARRRSGGAR--LP-PPPPLQLRAVSMVGEAAGQIERV-------
------------------------------------------------------------
----------------AQGQRVRVDD----------------------------------
-------------------------------------------------ELRPHRRHHRR
LLPLPRRLRP-PQGPLLIDQTLARSP--ISVKVCINFNQFRVV-----------------
------------------------------------------------------------
--F
>gi|115459996|ref|NP_001053598.1|	   464 residues, 50 /line  Os04g0569900 [Oryza sativa (japonica cultivar-group)]
--------------------------------------------------------MGW-
---------A-SRWLRGLLG-GGKKPNSGS---------------------------GDP
KPAREKKRWGFG-KSFREKSPAHPPPPPPP------------------------------
--------------------------------------------------------SAAV
QRAVTPRRAYT-ASDEGDD------EQSKRAIAV-A------------------------
--AATAAVAEAAVAAAQAA-------------AAVVRL-TSSGRCAP-------------
------------AAAKREEYAAVRIQAAFRG---------YL------------------
----------ARRALKAL----RGLVKLQALVRGNIVRRQAA-ETLRC------------
--------------MHALVRVQ------------------------------RRARACRA
IRSQHVSAHP--------------------------------------------------
----------------------------GPPTP-EKYDQAT---------------HEGV
PKHGR--SGSLKGS--S-------SKT-----------------------------PGSE
R--LTRE-RSESCGRNWLDKWVEE--RYLDDE----------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------KNAKILEVDTGKPGRHASRRRSGSHHHHSSCSS--MTSEQKSR
SYA-------------------------------TMPESPSKDSTTAQQSV---------
---PSPPSVGMAEALSPLLMA-----------------------VDIAELCDSP------
-------------------------------------------------QFFSATSRPGS
S---RSRAFTPT-KSECSRSLFG---GYS----DYPNYMANT------------------
---------------ESFRAK--ARSQSAP-KQRPQY-EKSSSLRKASAHAFGPGSCAPV
AQR---------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------TTAS-LHSKFTNKAYPGSGR-------LDRLGMPV-K-----------------
------------------------------------------------------------
--Y
>gi|125524760|gb|EAY72874.1|	   455 residues, 50 /line  hypothetical protein OsI_000721 [Oryza sativa (indica cultivar-group)]
--------------------------------------------------------MGG-
---------S-GKWVKSLIG-LKKPDRED-CKEKLQ------------------VPSVNG
GGGGKGRKWKLW-RSSSGDHGSLWRGSRGG------------------------------
------------------------------------------------------------
-----------------GG------GGGHHRSAS-S------------------------
--DASDDASSAAGDPFTAA------------VATVARA-P--------------------
--------AKD-FMAVRQEWAAIRVQTAFRG---------FL------------------
----------ARRALRAL----KGLVRLQAIVRGRQVRKQAA-VTLRC------------
--------------MQALVRVQ------------------------------ARIRARRV
RMSTEGQAVQ---------------------------KLLEA-----R-RT---------
-------------------KLD-----ILREAE-EGWCDSQGTLEDV--RVKLQKRQEGA
IKRER--AIAYAYS--QQI--EGATKC-NFWTKCVIFLVFAQQQPKPTSYGRLNQSGMLL
K--HQHF-DKSNGNWSWLERWMAA--RPWENRLMEEHNQTNSSSPDLLS--S--------
-------KN---------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------CEDSFGILGDFSEPNSVK---------------V--RKNNVSKR
VCAKPPVVS-H-------------------------------------------------
--------HQRIKAQSISSLS-----------------------TELHNDESSA------
-------------------------------------------------SSSSCF-----
----ASTPISFS-TFVTTEKTED---SIR----ARPNYMNMT------------------
---------------ESIKAK--RKACNAQ-RTTAGK-LMEDRK----------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------------------ASGVELKVAQ-----------------
------------------------------------------------------------
--V
>gi|125527441|gb|EAY75555.1|	   440 residues, 50 /line  hypothetical protein OsI_003402 [Oryza sativa (indica cultivar-group)]
--------------------------------------------------------MGA-
---------S-GKWIRTLVG-LRPAAEREKER---------------------------G
GGGGKGRKWSRL-WR---------------------------------------------
------------------------------------------------------------
---------------------------------------------SSSSQRGGGNASASE
VYSETSS---SADALSSV-------------VAAVVRA-P--------------------
--------PRD-FRLIRQEWAAVRIQTAFRA---------FL------------------
----------ARRALRAL----RGIVRLQALVRGRRVRKQLA-VTLKC------------
--------------MQALVRVQ------------------------------ARARDRRA
RISADGLDSQ---------------------------DMLDE-----R-GG---------
-------------------RVD-----PVKEAE-AGWCDSQGTADDV--RSKIHMRHEGA
IKRER--ALTYAQS--HQR--CSNHG------------------------GRPSSPAVSL
KHHGNGA-TRSNHSWSYLEGWMAT--KPWESRLMEQTHTENSTNSR--------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------CSESVEEVSVGGPKLSDASSVK----------I--RRNNVTKR
VAAKPPSMISATSSDFVCDESSP-------------------------------------
------------------------------------------------------------
--------------------------------------------------STSSVTPLSA
N---NSL--------ATERRSDC---GQV----GGPSYMSLT------------------
---------------KSAKAR--LSGYGSH-KPPLQR-QRSGD----------------L
LHHNRMA--------------FSSID-VQ-STAGSEVSVTSKRLNSLALK----------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------GRATRSLDKEN-----------ERRPSSL-----------------
------------------------------------------------------------
--L
>gi|125527495|gb|EAY75609.1|	   582 residues, 50 /line  hypothetical protein OsI_003456 [Oryza sativa (indica cultivar-group)]
--------------------------------------------------------MGK-
---------SPAKWIKSVLL-GKKSAKSNSTKAKDLAKAANN---K-------PVL----
------------------------------------------------------------
-------------------------------------S---------EDPPVIS--EPAL
VNSHND--------GNAEN------CKLPNGVAV-E------------------------
--AMGQGVENQNIV----------------------------------------------
----GSKAPTS-PEKLSEELAAVKAQAAFRG---------YL------------------
----------ARRAFRAL----KGIIRLQALIRGHLVRRQAA-STLRV------------
--------------TWLIVKLQ------------------------------ALVRGRNV
RLSGASIQFVVKSGQH-KFLSDK-------PSDAWKEKVSSN-----A-YVRKLLSS---
----------------SI------------------------------------------
----------------------GLEA-------------------------------LHL
---QYDK-RDPNSLYNWLERWTIS--QIWKSSSQPKK--VADGKPQVRK--ASYAMETES
AKLKRNVRKSS--AVTVDSFQTNM--TVEPEKIKRNSRKFSSS---AADSVPDSQLSELE
KVKRNLRKVTNSMAEASKISSSR------AD-------ASKVSSSMA-------------
-------DASKV-----SSSTADASKVSDSVAQIPPSLVNGISDHQDNQ---CEEAQQNA
-CVSFPPETQELHSGILLEDNSHMNLLEPDLISNPETPFTSIL------TWEKFNDSTA-
DAQEVEVLPLQN------------------------------------------------
------------------------------------------------------------
---------IDNEDNFPENGV-----------------------LGKKEKPRSK------
-------------------------------------------------EEPLSNGNLKT
S---KRRSSFST-KSDYPENGAQ---NTP-VPRRKPSYMAAT------------------
---------------ESAKAK--LRGQNSP-RLDSDSPADMN------------------
GFTRRQS--------------LPSST-NS-KLN---------------------------
------------------------------------------------------------
----------------PHSPHTQGPI----------------------------------
-------------------------------------------------Y----------
---------------------------FKF------------------------------
------------------------------------------------------------
--D
>gi|125595019|gb|EAZ35078.1|	   567 residues, 50 /line  hypothetical protein OsJ_018561 [Oryza sativa (japonica cultivar-group)]
--------------------------------------------------------MGK-
---------SPAKWIKSVLF-GKKSSRSGSTKAKDLSKGSNN---K-------GYA----
------------------------------------------------------------
-------------------------------------AA--GKDAGFESSPVIS--EPVL
VTPHNNEAVQEV--GRGEN------SSLQGEVVV-R------------------------
--DVSQDLEKQNTV----------------------------------------------
----VSDASND-PERLREEQAAVKAQAAFRG---------YL------------------
----------ARRAFRAL----KGIIRLQALIRGHLVRRQAV-ATLRA------------
--------------TWLIVKFQ------------------------------ALVRGRNV
RLSTNTIQVNWKLVQQ-QSGSGK--------RDAWKEKLSSN-----A-FARKLLAS---
----------------PI------------------------------------------
----------------------LVEA-------------------------------LHF
---QYDE-RDPNSAFNWLERWTIG--RVWRPISHPKRAAVTDAKPHTRK--ASYAMETES
GKLKRNSRRSS--AAPVESSQTNI--AMETEKSRRNPRKFTSS---TADSVPESQLTELE
KVKRNLRKVTNSMAEASKVSTPA------TE-------I---------------------
------------------------------------------PERQEVQ---CEKPQRTA
EEVPNYPEIQEPQNGNLLE-NAKTDILVPDLQPEPEVPSYQVE------TEEKVAELTV-
ADPTVETMPLQD------------------------------------------------
------------------------------------------------------------
---------IHNEENALVND----------------------------MEQRSK------
-------------------------------------------------EEPLSTESLKS
S---KRRSSFST-KTEYPENGSK---NSP----AVPSYMAAT------------------
---------------QSAKAK--LRGQNSP-RLSSDS-AEKN------------------
GFTRRHS--------------LPSS--NG-KLN---------------------------
------------------------------------------------------------
----------------SHSPRTQRPT----------------------------------
-------------------------------------------------HAG--------
-----------------------GKEGVKADKSMLSSRDASGK-----------------
------------------------------------------------------------
--L
>gi|125528700|gb|EAY76814.1|	   559 residues, 50 /line  hypothetical protein OsI_004661 [Oryza sativa (indica cultivar-group)]
-------------MGKK-------------------------------------------
-----------GGWITALKK-AFTSGPKDKPTNGQLV-AQYS---H-------QHRSGGG
GAARDKKRWGFG-RSRQHAEPSPAG-ALINIPLYREPSSIEKILVDAEMEQQHRQYRAQY
QITPAKPATVTAPAAAASLPAPPPPVSARERQRRRDVDD--DKPAIVLPLPPPS--PPPL
I-----------RRFDHDR------EQQQKLQQM-Q------------------------
--QQTRAETEWRRPQAQR-----------------------------R------------
----RAARPRGPAPPDRARAAAVAIQSAFRG---------YM------------------
----------ARRNYRSL----RGLIRLQGVVRGPSVRRQTA-HAMRC------------
--------------MQMLVRVQ------------------------------SQVRASRV
EAMERRNRHHHAA-----------------------------ML---R-DA---------
-----------------------ARWRAASQDG-GIWEDSLLSRDEM--DARTKRKVEAV
IKRER--ALAYAYS--HQL--LKATPM-----------------------------AAHA
ILADLQS-GRNPWWWTPIERRHEA--EAAAAVLS------------RQR--VEHVGNGGG
GGRHVAVTATP--ARSVVSSYSTA--TTAARPRATRPAKVASS---YG------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------GG-GSIRDDESLT---SCPAFGGALPNYMTPT------------------
---------------MSASAK--ARARAQM-LRQQQE-KQAQAAQE--------------
--KPRFS--------------FGLGQ-SI-GSWAK-------------------------
------------------------------------------------------------
------------------SPFWKGGA----------------------------------
-------------------------------------------------AAAPPSISSRV
ATPAASVAGRHRPTRSSVSELSVDSA-----VSMPAGIGRRTF-----------------
------------------------------------------------------------
--K
>gi|125539079|gb|EAY85474.1|	   501 residues, 50 /line  hypothetical protein OsI_006707 [Oryza sativa (indica cultivar-group)]
-------------MGKKHAA------------------------------------AGS-
---------G-GGWLAAVRK-VFRPSKDAADKK------------G-------G-----G
GGDREEEAAAEV-LLLEHFPAGGTSPSAEGTGNDQGGTV---------------------
------------------------------------------------------------
--------VGKGEGEEEDG------EDGYGEVER-A------------------------
--RALAAAAEAAVAAAEAA-------------ARVVRM-SAL------------------
------------RRASREERAAVRIQAFYRG---------YLLKYNEFDVK--ILT----
---LGVIQLKARRALRAL----RGLVRLQALVRGHQVRRQVH-LTMRC------------
--------------MQALVRAQ------------------------------ARVRARRL
ITDHLHAGVAPLRLPP-LPPATAA--ATYSSRRREGGYSWHPLLNNSY-HAQLGERDE-S
DDDVDGDGGKVGEHARQQQQRQRGNDVRSRSPF-RSWDGSSRTPEED--RAEGARRHDAA
ARRER--ARAYAYG--YQQ--QRQWQ----------------------------------
--------EKA-GGFQWLDRWMAA--QAQQHAPEPDKSRRRAALTA-----A--------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------ADGTTMPERTVEMDTTSYRSP---------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------------LNSHSAAVQG---RPP----AVPGYMAAT------------------
---------------QAARAR--ARTAPPAT-------PAHARSRS-------------G
AVLAG--DTSSSGQSGSGSG----------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------GGGAHV
QKPC--AVYS-PESRGTGDWTPPRL-------AVSSRATRLVY-----------------
------------------------------------------------------------
--A
>gi|54290891|dbj|BAD61551.1|	   470 residues, 50 /line  calmodulin-binding protein-like [Oryza sativa (japonica cultivar-group)]
-------------MGKKPGG------------------------------------AGA-
---------G-AGWLATVRK-VFKPGTSKDPRLAKKRGGDEN---A-------A-----G
GGGGGVGQAVEI-LSMEHFPAAETSPEVT-TNEGSGGSA---------------------
------------------------------------------------------------
--------FGR-----ERL------HVGR-DEAE-G------------------------
--AWRARRGMAASRAVRNA-------------AA------RG------------------
------------RAAGREERAAVRIQAFYRG---------YL------------------
----------ARRALRAL----RGLVRLQALVRGHQVRRQVH-LTMRC------------
--------------MQALVRAQ------------------------------ARVRARRL
-TSHVALARPA--------PHAAG--LQYSCGHR------------GR-FVAPDQQND-G
DEDDAGETETTMPHMVARPRRNSSHIVDERPPFNSGWRDAVP-------YGEGRRRHDPG
PRREM--APIPTSTYGYQQ--QREEQ----------------------------------
--------DECTVGWQWLEQCMAG-VQPPRHVPEHHVVVAAAAETSYVT--A--------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------AATDGVSEKTVEMDAGRKLCP---------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------------AKD---LYPV---RPP----AVPGYMAAT------------------
---------------QSARAK--ARMAPASAHVAPRAAQSHARSRS-------------S
SVALAGASTATSGWSTNNNC----------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------SGGAGG
RAPLHRAGYS-PESSCSGDRTPPPP-------PQGGGRGRAAY-----------------
------------------------------------------------------------
--A
>gi|125550655|gb|EAY96364.1|	   500 residues, 50 /line  hypothetical protein OsI_017597 [Oryza sativa (indica cultivar-group)]
-------------MGKK-------------------------------------------
-----------GKWFGAVKK-VFSPESKEKKEE---------------------------
-----RL----R-RKLAASNPNPPDLTPSA------------------------------
------------------------------------------SLEVNVSVPPPP--PPPP
V-----QQIEEVKVPEVEQ------EQSKHVTVE-AVP----------------------
----EAVPVPA----------------------------QTSSL----------------
-----------PPGVSREEQAAIKIQTAFRG---------YLLSENSSWLF--ISSAAFI
YHCVGANITKARRALRAL----RGLVRLKSLVEGNSVKRQAA-STLRC------------
--------------MQTLARVQ------------------------------SQIRSRRL
KMSEENQALQ---------------------------RQLLL-----K---QEL------
---------------------------ESLRMG-EQWDDSTQSKEQI--EASLISRQEAA
VRRER--ALAYAFS--HQW--KSTSRS-----------------------------VNPM
---FVDP-NNPQWGWSWLERWMAA--KPWEGRAGTDKESNLD------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------RASAKSASLNLGEGEITKAFNRRGSKPDKSSPTTPKLTRPASRQ
SPSTPSAKV---------------------------------------------------
------S-PIFAKKKSATPKN-----------------------GLSQVDDDAK------
-------------------------------------------------SVFSVQSERPR
R---HSI---AT-STVRDDESLA---SSP----SVPSYMAPT------------------
---------------KSARAK--LRLQGSA-VTDGAETPPEKVAS-------------VG
SVKKKLS--------------FQAGM-VP-PSPMRRHSGPPKVEV---------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------VKDIAEPPQPEALVINGGS-----------------
------------------------------------------------------------
--K
>gi|92868235|gb|ABE78306.1|	   468 residues, 50 /line  IQ calmodulin-binding region [Medicago truncatula]
-------------MGKK-------------------------------------------
-----------GNWFSTVKK-ALSPDSKKSSKS---------------------------
-----KKKWFGK-QKLQTSDP---------------------------------------
------------------------------------------SVEIDTALPLPP--P---
---------EDIKLTDIEN------QNNHHNVA--EIT----------------------
----TVVDVEEPVRSVQTA-------------VVKTQA-ATVSR----------------
-----------FAGKPKDEVAAIKIQTAFRG---------YL------------------
----------ARRALRAL----RGLVRLKTLMEGPAVKRQAM-STLRS------------
--------------MQTLARVQ------------------------------SQIRSRRV
RMLEENQALQ---------------------------RQLLQ-----K-HAKEL------
---------------------------ETMRIG-EEWDDSLQSKEQI--EAKLLSKYEAT
MRRER--ALAYAFT--HQQNSKNSSRS-----------------------------MNPM
---FVDP-TNPTWGWSWIERWMAA--RPWESRGLVDKELN-D------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------HSSVKSSSRSIIGGEISKSFARFQLNSEIHSPVASQNPGSPSFQ
SNSTPTKPA---------------------------------------------------
------SASVARKLKKASPK------------------------GSWVMDDDSK------
-------------------------------------------------SMASVQSDRFR
R---HSI---AG-SSVRDDESLA---SSP----SVPSYMVPT------------------
---------------QSAKAR--LRTQSQS-PLA-KENGKQEKGS-------------FG
TAKKRLS--------------FPAS-----PARPRRHSGPPKVET---------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------AIN------AELPVPNGVA-----------------
------------------------------------------------------------
--S
>gi|145357576|ref|NP_568110.2|	   461 residues, 50 /line  IQD2 (IQ-domain 2); calmodulin binding [Arabidopsis thaliana]
-------------MGKK-------------------------------------------
-----------AKWFSSVKK-AFSPDSKKSKQK---------------------------
-----LAE---G-QNGVISNPPVVDNVRQS------------------------------
-----------------------------------------------SSSPPPA--LAP-
---------REVRVAEVIV------ERNRDLSPP-STAD---------------------
--AVNVTATDVPVVPSSSA-------------PGVVRR-ATPTR----------------
-----------FAGKSNEEAAAILIQTIFRG---------YL------------------
----------ARRALRAM----RGLVRLKLLMEGSVVKRQAA-NTLKC------------
--------------MQTLSRVQ------------------------------SQIRARRI
RMSEENQARQ---------------------------KQLLQ-----K-HAKEL------
---------------------------AGLKNG-DNWNDSIQSKEKV--EANLLSKYEAT
MRRER--ALAYSYS--HQQNWKNNSKS-----------------------------GNPM
---FMDP-SNPTWGWSWLERWMAG--RPLESSEKEQSNSNND------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------NAASVKGSIN--RNEAAKSLTRNGS----TQPNTPSSARGTPRN
K----NSFF---------------------------------------------------
------SPPTPSRLNQ----S-----------------------SRKSNDDDSK------
-------------------------------------------------STISVLSERNR
R---HSI---AG-SSVRDDESLA---GSP----ALPSYMVPT------------------
---------------KSARAR--LKPQSP---LGGTTQENEGFTD-------------KA
SAKKRLS--------------YPTSP-AL-P-KPRRFSAPPKVES---------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------G---------GVTVTNGAG-----------------
------------------------------------------------------------
--S
>gi|125587286|gb|EAZ27950.1|	   508 residues, 50 /line  hypothetical protein OsJ_011433 [Oryza sativa (japonica cultivar-group)]
-------------MDTCAGHAS--INDFLPTPPHLLLPMELSFTGGSLNYIKRLFVMGI-
---------S-SKWFKSLVG-IRKQEKARNAEKQEKAQNAES---C-------ET-STPA
AQLLHKRKHSLD------------------------------------------------
------------------------------------------------------------
----------------------------------------TERAILVEELAVQSEPLTDD
TNTQT-----------------VSDSISSDSTLLG-------------------------
----VHISQTE-EHKTKEDVAATLIQSAFRA---------FL------------------
----------ARRALRAL----KGIVILQALVRGHIIRKQTS-ETLQC------------
--------------MQALVRAQ------------------------------ARVRARQV
RVSLENQVAR---------------------------KKVPE-----Q-DDHEN------
---------------------------HVREIE-ERWCGSIGSVEEL--QAKVLKRQEAA
AKRER--AMAYALT--HQRQA--GSRQ--------------------------QKPTTPQ
---GLEL-DDSHWGSNWLERWMAV--RPWENRLLDSNTKETMPLCD-----DKQDMETKS
QITPKGKVQVS--SALSNGSNKK--KGINHKKSYSDVTCASFG---RSPNIPSTSLG---
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------SCKQ-KSKLSDEALE---EVS----SQPTDLASL------------------
---------------STCQPKAKLVQANTP-VKKWLSLPTNGVQMVQFFSIFHWQLVGEQ
-------------------------Q-RA-RPTATRFADPP-VPSLIQNH--G-------
------------------------------------------------------------
----------------QMLLTNPG------------------------------------
------------------------------------------------------------
-----------SKLSCRPDCTF-------------PFPSDFGQ-----------------
------------------------------------------------------------
--R
>gi|125593074|gb|EAZ33133.1|	   499 residues, 50 /line  hypothetical protein OsJ_016616 [Oryza sativa (japonica cultivar-group)]
--------------------------------------------------------MGK-
---------A-ARWFRNMWG-GGRKEQKGE------------------------------
APASGGKRWSFG-KSSRDSAEAAAAAAAAAAEASGGNAA---------------------
-----------------------------------------------------------I
ARAAEAAWL-RSVYADTER------EQSKHAIAV-A------------------------
--AATAAAADAAVAAAQAA-------------VAVVRL-TSKGRSAPV------------
-----LAATVA-GDTRSLAAAAVRIQTAFRG---------FL------------------
----------AKKALRAL----KALVKLQALVRGYLVRRQAA-ATLQS------------
--------------MQALVRAQ------------------------------ATVRAHRS
GAGAAANLPHLHHAPF-W------------------------------------------
------------------PRRSLVRRW---LNLADDIAMYMFDVDVVCWRWMQQERCAGD
DTRS--EHGVAAYS--RRLSASIESSSYGYDRRPQDRGGGHRGGP---------------
------------------------------------------------------------
---------------------------------SRGRRRRGGR---APPLLLDARW--VR
ERRRGLVRQLHVVAAPVL------------------------------------------
------------------------------------------PPRRRAA---APHRRPDV
APLPRLRLVR--------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------------------AGEGPAG------
-------------------------------------------------DGAEHAAVRAR
A---ADADQERV-RRRRRRRHPL---VAA---QLPELHVQHA------------------
---------------VVRGRR--CRSQSAP-KQRPET-GGAGA----------------G
GGRKRVP--------------LSEVV-VV-ESRASLSGV---------------------
------------------------------------------------------------
------------------------------------------------------------
-------------------------------------------------------GMQRS
CNRVQEAFNFKTAVVGRLDRSSESGE--NDRHAFLQRR----------------------
------------------------------------------------------------
--W
>gi|140068222|gb|ABE77889.2|	   491 residues, 50 /line  IQ calmodulin-binding region [Medicago truncatula]
--------------------------------------------------MQRKLHMGR-
---------K-GSWFSAVKK-LFISDSKKDQKHLHKS-----------------------
----NSKLTCFG-HPQHHH-----------------------------------HHHHHH
YEDAEWKSGGVSPITVVPVPSLPPKEDVKP------------------------------
------------KKTDAEN------EQDKQAFSL-I------------------------
--LATAVATGAAVAAAKTAA-----QAAAEAALEAARI-TSLRPC---------------
-----------YIGKTNEEIAAIKIQTAFRG---------YL------------------
----------ARRTLRGL----RGLARLKALVKGQSVQRQAA-TTLQC------------
--------------MQTLSRLQ------------------------------SQVSARKI
RMSEENQSFQ---------------------------RQLQQ-----K-REKELD-----
-------------------------KLQAAPIG-EKWDYSSQSKEQI--QARLLNRQIAA
MRREK--ALAYAST--HQQTWRNSSKA-----------------------------TDAT
---IMDP-NNPHWGWNWLDRWMAS--RPWEGQNTKDQKNHRS------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------GKGVASHTMSVGEISKLYALRD-QNQDDKKSPTS-------Q
KANNPNQAS---------------------------------------------------
RVAVPSTSTRGKAKTSSSPRV-----------------------GSWGGDGDSK------
-------------------------------------------------FTFNKNSESNR
R---HSI---AV-APVKEDESLV---NTPA----------KF------------------
---------------SKVKSN--VQSPSVKKQL---------------------SFTASS
SGSRRHS--------------IPTKM-G--------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------MNSNKNVAATIPEVKVKNGGS-----------------
------------------------------------------------------------
--K
>gi|140070016|gb|ABO84084.1|	   534 residues, 50 /line  IQ calmodulin-binding region [Medicago truncatula]
-------------MGKK-------------------------------------------
-----------GSWFAAIKR-VFTHHSKGKDSENK-------------------------
--STKEKKKGVG-K-LKHGETNSF------IPLFREPSSIEKIFGDFEREQQVLAIRPPT
PPERP-------------------------------KTPPFVPPRVASPRPPSP--KPPS
PRDPSPRAA---------------------------------------------------
--SPRVTSPKAASSRNVHQ-------------HKEVRY-RP-------------------
-----------EPTLQNQHVSATKIQSAYRG---------YM------------------
----------ARKSFRAL----KGLVRLQGVVRGQNVKRQTV-NAMKH------------
--------------MQLLVRVQ------------------------------SQIQSRRI
QMLENQARYQAEFKN--------------------------------E-AGSTLG-----
--------------------KSALGHGSEAGNN-EDWDDSLLTKEEV--EARLQRKVEAI
IKRER--SMAFAYS--HQL--WKATPK-----------------------------STQT
PVTDMRS-SGFPWWWNWLERQLPA-SNPPEKQVLKNFQFTPP------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------RPYSEQKTSPRPGSSSQRPFAFDN-MDTPTPKSTR--------
STIFPSSRP---------------------------------------------------
---------------SRTPPF-----------------------RTPQGNTSSA------
-------------------------------------------------TSKYSRPRGVG
S---NSP---FD-VPLKDDDSLT---SCP--PFSVPNYMAPT------------------
---------------VSAKAK--VRASSNP-RERFGG-GSSGCATPT-----------ST
DSKRRVS--------------FPLSQ-GI-GSFKWNK---------------G-------
------------------------------------------------------------
----------------SMF----S------------------------------------
------------------------------------------------------RNKDPH
GSHR---TPDKYQSLESIGNVSVDSA-----VSLPARVERKPF-----------------
----------------------------------------------------------TR
-FV
>gi|15231733|ref|NP_191528.1|	   517 residues, 50 /line  IQD13 (IQ-domain 13); calmodulin binding [Arabidopsis thaliana]
-------------MGKK-------------------------------------------
-----------GSWFSAIKR-VFTPHSKEKQLSNNN------------------QEPEIK
SENKEKKKKGFG-KKLRNGETNSF------LPIFRQPSSIEKILSEAEREH-NLVFRPPT
PTDRA-NSSSTSVASPLVRPASPKVPSQRYVSSPKPISPRVAYPQVHYPKPPSP--KPPS
PRAVSPRIV---------------------------------------------------
--Q-----------------------------RREFVH-RP-------------------
-----------EPSLLVKNAYAIKIQAAFRG---------YM------------------
----------ARRSFRAL----KGLVRLQGVVRGHSVKRQTM-NAMKY------------
--------------MQLLVRVQ------------------------------TQVQSRRI
QMLENRARNDKDDTK---------------------------------------------
--------------------------LVSSRMS-DDWDDSVLTKEEK--DVRLHRKIDAM
IKRER--SMAYAYS--HQL--WKNSPK-----------------------------SAQD
IRTS-----GFPLWWNWVDRQKNQ-NQPFRLT--------PT------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------RP----SLSPQPQSSNQNHFRLNNSFDTSTPNSSK--------
STFVTPSRP---------------------------------------------------
---------------IHTP--------------------------------QPY------
-------------------------------------------------SSSVSRYSRGG
G---RAT---QD-SPFKDDDSLT---SCP--PFSAPSYMAPT------------------
---------------VSAKAK--LRANSNP-KERMD-------RTPV-----------ST
NEKRRSS--------------FPLG------SFKWNK---------------G-------
------------------------------------------------------------
----------------SLFMSNNS------------------------------------
------------------------------------------------------NNKGPG
SSSSGAVVLEKHKTLKSVGNLSIDST-----VSMPATIGRRAF-----------------
----------------------------------------------------------NR
-FA
>gi|140071620|gb|ABO84581.1|	   784 residues, 50 /line  IQ calmodulin-binding region [Medicago truncatula]
-------------MVKS-------------------------------------------
-----------SSCLRLITC-GGGSDKEDH------------------------HVVSEA
KDSNDKRGWSFR-KRSARHRVLSNTVITAETTSSENK-----------------------
------------------------------------------------------------
-------EISEYPSISFQS------SAEPNVVEK-ICT----------------------
----TDFSNEKPQLSSDVC-------------SEMPET-I--------------------
----VTETENK-VDVNPPESAVIIIQASIRG---------YL------------------
----------ARRALLKS----KNAVKLQAAVRGHLVRRHAV-GTLRC------------
--------------VQAIAKMQ------------------------------LLVRSRHA
QKSHTDGKN---------------------------------------------------
------------------------------------DYSKTTDNEHY--TAESNVKHTSV
---EK--LLSNKFA--CQLLESTPKNK-----------------------------PIHV
---KCDP-SKGDSAWKWLERWMFV--SAKDSAEDKKPICTTEQSDETKD--STHASQSET
DIPSQVILQLS--DSPLPSEDEEK--TATYYDTNSHFQASLSS---SSLIKDNLEESPPE
KTVTYDSKVTSTEIDSFQNEIMESNASVGHEPNSPQNQEIGEQYKLSTKAFASDQLETEG
KKITFGSRKLSN-----PSFIAAQSKFEELSSNSNSGRPSGLLDQDVSVESQADSAYISK
EFISS------------ENSTPYPSRNADPESGTVLSISSTLDSPDRSETLEIEHDAKD-
LVEGIVNPENKTDHGVEANTPTSNLPISDSDQLETVNGSRGNVVD------SVMPENSKE
HAVEPEKIASDLLREQTETVLQDFTYSQQASPGSYMTIPESQGTPSSQ--VSVKTKENKI
NKTGSSSRRRVLSVGNKSPANSNQDSGSRVFVGTKSPANANHDSGSRGSREQLP------
-------------------------------------------------KDQLNGKRRNS
F---GSIKPEHT-DQEPTKDNSS---SNN----TLPRFMQAT------------------
---------------QSAKAK--INANSSP-RSSPDV-HDTD-----------------I
NIKKRHS--------------LPGAT-GK-QGS---------------------------
------------------------------------------------------------
----------------PRVEQSLSPA----------------------------------
-------------------------------------------------P----------
-------------------------QGTKGNGSTER------------------------
----------------------------------------------------------KW
-QR
>gi|147771893|emb|CAN66770.1|	   570 residues, 50 /line  hypothetical protein [Vitis vinifera]
--------------------------------------------------------MGK-
---------T-GKWIRNFLT-GKKDKERDREKDKEKLNSIAIENPS-------TPILIPP
TTPKEKRRWSFR-RSSATSAGHKDSISMDT------------------------------
------------------IATTPP------------------------------------
---------AGQTILDSEN------EQKKHAMAV-A------------------------
--AATAAAAGAAVAAAQAA-------------AAVIRL-TAAATG---------------
------------RAGAIEEAAAVKIQAAFRA---------HL------------------
----------ARKALCAL----KGLVKLQALVRGNLVRKQAT-ATLRC------------
--------------MQALVTVQ------------------------------ARARVQRI
RMTEETKPVNQRQLTQ------------RKSTQD------------NR-FRNTNHDKDRG
MEENIKIVEMDQG---------------------ESKGSSKGRNSYS--NHAQTERAEPR
FSTNY--ATNHAYS--KQDNQ---------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------QISPAPS--ALTDMSP----------
--------------RACSGHF---------------------EEYCFTTTQSSP------
-------------------------------------------------QCYSAVSKPDC
T----GVPFAFP-QTDCAESLSY---DYP----FFPNYMANT------------------
---------------ESSKAK--VRSHSAP-KQRPES-XERQP-----------------
-SRRRAS--------------MEGRN-IP-RAMRMQRSSSHVGSTAQGYQYPWSIKLDRS
TVSLKDSECGSTSTVLTNTNYCKSLFAYDXTLNTKTTNIYQGRDGLNKTLREZRVPVEDG
VVLELLIGGERERWTRQNEAFEGNGE----------------------------------
-------------------------------------------------LLRLHNYSATS
SNPGLHNYSATSSNPGRXTLSTAKSXMEKRNGKERKQTVPMCF-----------------
------------------------------------------------------------
--L
>gi|147777534|emb|CAN75939.1|	   530 residues, 50 /line  hypothetical protein [Vitis vinifera]
--------------------------------------------------------MGK-
---------A-SKWFRGLLG-LKKTDSPAPTPA----------------------PAPAR
LDKSVKRRWSFV-RSYREKDHTRHAND---------------------------------
-----------RRGALYGEPHPP-------------------------------------
------------SAYADGV------DPNKHAIAV-A------------------------
--AATAAVAEAAVAAAQAA-------------AAVVRL-TSSGRSAAP------------
-----SAYVSA-GFSAREEWAVIKIQSLFRG---------YLRFAASLGKINMAEAEAAD
TVTTSSFCVSARRALRAL----KALVKLQALVRGHIVRKQTA-DMLRR------------
--------------MQALVRAQ------------------------------ARARAGRA
QISESSHSSGKSSQFH-HP-----------------------------------------
----------------------------GPATP-EKFEHAI--------RAKNMKQDQSS
ILKVC--AVIFGLR--NSS--KASGRN---------------------------------
---IIDQ-DKTHLSRNWSDRRLDE--GSWDQQGSSIRAGP--------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------------TDDEKSDKILEIDTGKPNFTPKRRNLFQSSHHG------VASDQISH
SFTT--------SKDSTTH---------------QTVPSPSSCEVQSLSP----------
--------------LKFCQEV---------------------EEGSFCTADNSP------
-------------------------------------------------QFYSASSRAGS
S---RRGPFTPT-KSDGSRSYLS---GYS----DHPNYMAYT------------------
---------------ESSKAK--VRSFSAP-KQRPQY-ERSSSTKRYSVHGFGDSRSN--
----------AQRVSAM-------------------------HANFTSKAYPGSGRLDRL
GMPIR-SEAFGLSGGFSNSR----------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--Y
>gi|147781999|emb|CAN72165.1|	   595 residues, 50 /line  hypothetical protein [Vitis vinifera]
----------MVDLGFRECAF---------------------------------SVMGK-
---------SPGKWIKGLLF-GKKSSKSNLSKGREISKHASKGDA---------------
---------------------LVCAKVPA---------------SDLTV-----------
------------------------------------------------DAPLTS--LPVP
LTTARN-------------------------------------GVVSDSEKGTASRLPND
G-------------------VILSSSKENGDTETIM------------------------
----NLGLSKD-PERIRHEQAATKAQAAFRG---------YLFTDAS-------------
-----LISLKARRAFRTL----KGIIRLQALGRGRLVRRQAI-ATLCC------------
--------------VQGIVKFQ------------------------------ALVRGRSV
RHSNIGTEVHEKLSAR-KFLDAKCSNSFGLQTSNQAEKLSKN-----V-FVCTLLAS---
----------------SP------------------------------------------
----------------------TSMP-------------------------------LHL
---QYGP-GEPNSAWDWLERWTKS--HFWEPLTKPKKII--DSKSQKKRG-TSQTVETDR
SRPKRSVRKAT--SAKFENGSTQS--TLESDKPKCNLRKVSSH---PVDSVQEHPKNATE
KTKSKLRKNLKSTSDAS------------------------------------DQLEVKA
EKPKHSLRKSSS-----AASDAPEQGTGDSLKKIKKDMAVTVSKQSDI------------
------------------------------------ETSLKPP------AENELVDDVH-
DHTLADLQCVEN------------------------------------------------
------------------------------------------------------------
---------NGKSENIPEAN----------------------------KDMSYK------
-------------------------------------------------DNDISNDDQKT
X---QRRASLPG-KHDYQENGLH---NTP----RLPSYMAAT------------------
---------------ESAKAK--LRALGSP-RFGQDE-ADKN------------------
GITRRHS--------------LPSSSTNG-KLS---------------------------
------------------------------------------------------------
----------------SWSPRAQRLV----------------------------------
-------------------------------------------------QAS--------
-----------------------GKGVFRSDRSLMSSRDGSGK-----------------
------------------------------------------------------------
-NF
>gi|147841475|emb|CAN62103.1|	   519 residues, 50 /line  hypothetical protein [Vitis vinifera]
--------------------------------------------------------MGK-
---------SPGKWIKTLLF-GKKASKSNFSKGREFD-------------------PNVK
KVANEREVWVAA-KAPEADLG---------------------------------------
------------------------------------------------LDPLVA--SEAP
N------------------------------------------IIDKNEMLEFENREASA
G-------------------GILSGDLDADIQGCR-------------------------
----QLSTLNN-PERIRQERAATKAQAAFRG---------YL------------------
----------ARRAFRAL----KGIIRLQALIRGHLVRRQAI-CTLYC------------
--------------MLGIVKIQ------------------------------ALARGRRI
RHSELGLRVNKKCIQV-KPLKGKLGDPAGVSSSTQIAKRTAN-----A-FVHKLWRA---
----------------------------------------------LPSRAMKLXNQSKV
WKRCRA------------------------------------------------------
-----LQ-DMMFWSRAWVQILQRQ--MNMETPVTVSKLPEVETTT---------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------------------------------------------EPPAVIWVNEASDSLHN
DQTVVELQPVEN------------------------------------------------
------------------------------------------------------------
---------SGKDENIPVAN----------------------------EELSSK------
-------------------------------------------------EDAISNENQKS
S----RKASIPA-KPERVENGLE---SSP----KLPSYMATT------------------
---------------QSAKAK--LRAQGSP-RLGQDV-PEKN------------------
NITRRHS--------------LPSS-TNG-KMN---------------------------
------------------------------------------------------------
----------------SLSPKTQKPV----------------------------------
-------------------------------------------------QGN--------
-----------------------GKGGNRSERSILSSKDGNGKELVISLEFLILVFSCDA
ASHFPKV-FVLHLSHHTQARPDSMLLPIFQEFWFSSFNNTLKHTL-RIVSLVLLQPGELD
-PT
>gi|147859390|emb|CAN83552.1|	   489 residues, 50 /line  hypothetical protein [Vitis vinifera]
-------------MAKR-------------------------------------------
-----------RSWFHIVKR-FFIPETHPKTEKVDMLLVCLVSLPG-------STTQGLN
FSQEKRRRWLFG-RLKIKRLASIEAPPSP-------------------------------
------------------------------------------------------------
--------VKERVLSEAEE------EQSKHALTV-A------------------------
--IATAAAAEAAVAAARAA-------------AEVVRL-TTTPQATEECDKKTEETPPVE
IPIIATPLPDLHHESEDQVLAAIKIQTAFRG---------YL------------------
----------ARKALRAL----KGLVRLQAIVRGRAVRRQAI-TTLKC------------
--------------LQSIVNIQ------------------------------SQVCARRC
QKAEECVNCDDIKQLQ-D------------------------------------------
-----------------------LKDKMDSNSQ-RRWDDSLLSKEEG--NALFLSKKEAV
MKRER--IKEYTFG--QRE--RKSXHK-----------------------------PAZS
E---QNK-LNGRWRY-WLEKWVDT--QVAKREELPSLDTVWSSNARSREE-FPGKQHTPR
N-----------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------NQRQYH------
-------------------------------------------------IEGLGSPVLVP
R---RSFHHRKE-RSI-GDENSF---SSP----PIPTYMAAT------------------
---------------ESAKAK--VRSVSSP-KLRPGS-LDTFSDS-------------NS
PHKNRLS--------------LISSISSE-ATNCSRIS----------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------KPGMPQ
QRSPSLRGPGPIKSSRSTKELSFDSE-----CSLLNWDR---------------------
------------------------------------------------------------
-RL
>gi|15225299|ref|NP_180209.1|	   516 residues, 50 /line  IQD4 (IQ-domain 4); calmodulin binding [Arabidopsis thaliana]
--------------------------------------------------------MKD-
---------L-SENFRRKW-----------------------------------------
KPEKPKRKWSFG-KQKSRESFDFPLEETPPVDPSPS------------------SVHRPY
PPPPPLPDFAPQPLLPPPSPPPPPPAYTI-------------------------------
-----------NTRIYGES------KESKNRQAL-A------------------------
--LASAVAAEAAVVAAHAA-------------AEVIRL-TTPSTP---------------
-----------QIEESKEETAAIKIQNAYRC---------YT------------------
----------ARRTLRAL----RGMARLKSLLQGKYVKRQMN-AMLSS------------
--------------MQTLTRLQ------------------------------TQIQERRN
RLSAENKTRH---------------------------RLIQQ-----KGHQKE-------
-------------------------NHQNLVTA-GNFDSSNKSKEQI--VARSVNRKEAS
VRRER--ALAYAYS--HQQTWRNSSKL-----------------------------PHQT
---LMDT-NTTDWGWSWLERWMAS--RPWDAESIDDQVSVKSSLKR---E-NSIKSSPAR
SKTQKSASQSS--IQWP-------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------------------------------------------------------VNNDT
KSRKIEVTNRRHSIGGGSSENAKDDESVGSSSSRRNSLDNTQTVKSKVSVETTS------
-------------------------------------------------NVSNAQTVKPK
A---NVG---AK-RNLDNTKTLK---SK--SSVGTTGNLANT------------------
---------------EAVKSK--VNVGTTSMPKKEVVADKKKPPQ-------------MV
LPKKRLS--------------SSTSLG---------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------KTKKLSDSDKATTGVANGEKKRRNGGS-----------------
------------------------------------------------------------
--S
>gi|15232741|ref|NP_187582.1|	   454 residues, 50 /line  IQD1 (IQ-DOMAIN 1); calmodulin binding [Arabidopsis thaliana]
-------------MVKK-------------------------------------------
-----------AKWLKNVKK-AFSPDSKKLKHESVEC-----------------------
--QDSVISYPVL-IATSRSSSP--------------------------------------
------------------------------------------------------------
--------QFEVRVDEVNY------EQKKNLYPP-SSD----------------------
--SVTATVAHVLVDSPPSS-------------PESVHQ-AIVVNR---------------
-----------FAGKSKEEAAAILIQSTFRG---------HL------------------
----------ARRESQVM----RGQERLKLLMEGSVVQRQAA-ITLKC------------
--------------MQTLSRVQ------------------------------SQIRSRRI
RMSEENQARH---------------------------KQLLQ-----K-HAKEL------
---------------------------GGLKNG-GNWNYSNQSKEQV--EAGMLHKYEAT
MRRER--ALAYAFT--HQQNLKSFSKT-----------------------------ANPM
---FMDP-SNPTWGWSWLERWMAG--RPWESSEKEQNTTNND------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------NSSVKNSTNRNSQGGETAKSSNRNKLNSSTKPNTPSASSTATRN
PRK---------------------------------------------------------
------KRPIPSSIKSKS------------------------------SDDEAK------
-------------------------------------------------S-----SERNR
R---PSI---AR-PSVSDDETLS---SSTA--RRSSNLIPTT------------------
---------------KSARGK--PKSQTSS-RVAVTT-STTEESSILP---------EKA
PAKKRLS--------------TSASPA----PKPRRSSAPPKVEK---------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------------------------GVLKAER
-TP
>gi|15240633|ref|NP_196850.1|	   443 residues, 50 /line  IQD11 (IQ-domain 11); calmodulin binding [Arabidopsis thaliana]
-------------MAKK-------------------------------------------
-----------KGLFTVLKR-IFISEVNS-------------------------------
EKKEKRRKWTFW-KLRIKKRLPSITAPP--------------------------------
------------------------------------------------------------
---------EHRTSHESHE------EQKEEIVSD------------------VGEISQVS
CSRQLDSIEESKGSTSPETA------------DLVVQY-QM-------------------
-----------FLNRQEEVLAATRIQTAFRG---------HL------------------
----------ARKALRAL----KGIVKLQAYIRGRAVRRQAM-TTLKC------------
--------------LQSVVNIQ------------------------------SQVCGKRT
QIPGGVHRDYEESNIF-ND-----------------------------------------
-----------------------NILKVDTNGQ-KRWDDSLLTKEEK--EAVVMSKKEAS
LRRER--IKEYAVT--HRKSAESY------------------------------------
----QKR-SNTKWKY-WLDEWVDT--QLTKSKELEDLDFSSKTK----------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------------------PKDETLNEKQLKTPRNSSP----------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------------------------------R
R---LVNNHRRQ-VSIGEDEQSP---AAV--TITTPTYMVAT------------------
---------------ESAKAK--SRSLSSP-RIRPRS-FDTQSES-------------YS
PYKNKLC--------------LTTSMMSE-APSKVRIANNGSNTR---------------
------------------------------------------------------------
------------------------------------------------------------
-------------------------------------------------PSAYQQRSPGL
RGFNIGPLKSCNNNNTLLNDLSINS-----ERSLPSWNKQSSL-----------------
------------------------------------------------------------
--R
>gi|18421483|ref|NP_568529.1|	   442 residues, 50 /line  IQD33 (IQ-domain 33); calmodulin binding [Arabidopsis thaliana]
-------------MGVT-------------------------------------------
-----------GGLVRSIFF-RNKSFGAHDY-------------------------NNGR
GNLGEKKRWSSV-RSYLCGDEFNSVRAVNDSESIKDSEAL-----LTMSQQLSSEFGMPF
GSVIAIEDSA--------------------------------------------------
------------SVRHLED------EDSGS---------VKSSEATVTQPLLEEKSKGLD
CYLKEEDVE------------------DNQSEATETHI-PKKHQTTP-------------
-----------ISKLFLEEDAAVIIQSAFRS---------YL------------------
----------AIRRSKEE----EETFAKEESFSGEESQDNASMGTSLE------------
--------------AQTGNSVK------------------------------APFF-RRK
RVSAN--------------------------------RRTLQ-----K------------
------------------------NNTQVLRIK-EDWDDSTVSSTIS--KSRIQSRVEAM
TKRER--ALAYAFS--QQLRICSKKKQ-----------------------------IDR-
----SSE-DDSNIGWSWLERWMAT--RVPDSIPIEPRTDVATKNQSLIRK-NRAFGTAG-
----------------------------------------------------ELESCASN
DLPLHFESISETQGDAT------------------------------------TVLQTEK
SSF---------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------KPSIS---KRK----SVPSYKSQR------------------
---------------KH------HKLQATKSDLQQQT----------------------K
KAKKAKT--------------TPTSCK---------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------------------TGNECEETSHKLNS
-ST

Ad blocker interference detected!


Wikia is a free-to-use site that makes money from advertising. We have a modified experience for viewers using ad blockers

Wikia is not accessible if you’ve made further modifications. Remove the custom ad blocker rule(s) and the page will load as expected.