FANDOM


>gi|42568881|ref|NP_178377.2|	   268 residues, 50 /line  ATWHY3/PTAC11 (A. THALIANA WHIRLY 3); DNA binding [Arabidopsis thaliana]
----------------MSQL----------------------------------------
------------LSSPPMAV----------------------------------------
------------FSKTF-----INHKFSDARFLSSHSI-LTSGGFAGKI--IPLKPTAR-
--LKLTV-KSRQSDYFEK---------QR-----------FGDSSSSQ------------
----------------------------------------NA----EVSSPRFYVGHSIY
KGKAALTIEPRAPEFVALE---------------SGAFKLTKEGFLLLQFAPAAG-----
--------VRQYDWSRKQVFSLSVTEIGNLVS---LGPRESCEFFHDPFKGKGSDEGKVR
KVLKVEPLPDGSG-RFFNLSVQNKLLNVDESVYIPITKAEFAVLISAFN--------FVL
PHLIGWSAFANSIKPE--DSNRLNNASPKYGGDYEWSR-------
>gi|115444353|ref|NP_001045956.1|	   228 residues, 50 /line  Os02g0158400 [Oryza sativa (japonica cultivar-group)]
------------------------------------------------------------
------------------------------------------------------------
--------------------------------------------------------MQR-
--LSRFV-PSSS------RRVTD-------------------------------------
---------------------LKDALWSGSLTFQH--ALSTFA-ADENTSGRKFASYTVF
KGKAALSMQPILPSFSKLE---------------SGGSRVNKNGSVMLTFFPAVG-----
--------QRKYDYSKKQLFALSPTEVGSLIS---LGPAESCEFFHDPSMKS-SHEGQVK
KSLSVTPLGNDSG-YFLNITVLNNLQKTTERLSLPISKAEFTVMRTALS--------FAL
PHILGWDQALTNHQPS--PSPASKPRVERPHPDSEWER-------
>gi|125538158|gb|EAY84553.1|	   304 residues, 50 /line  hypothetical protein OsI_005786 [Oryza sativa (indica cultivar-group)]
-----------MAHSLMAVGPGRPDWAVGWPTCQARKR----------------------
---------------------------------------------------------RHR
CGWLPETSGAFPAAFFLFSH----------SIRHPLLGGQR----DGGG--KPRPTMQR-
--LSRFV-PSSSSVFPLLRRVTD-------------------------------------
---------------------LKDALWSGSLTFQH--ALSTFA-ADENTSGRKFASYTVF
KGKAALSMQPILPSFSKLE---------------SGGSRVNKNGSVMLTFFPAVG-----
--------QRKYDYSKKQLFALSPTEVGSLIS---LGPAESCEFFHDPSMKS-SHEGQVK
KSLSVTPLGNDSG-YFLNITVLNNLQKTTERLSLPISKAEFTVMRTALS--------FAL
PHILGWDQALTNHQPS--PSPASKPRVERPHPDSEWER-------
>gi|116055682|emb|CAL57767.1|	   240 residues, 50 /line  DNA-binding protein p24 (ISS) [Ostreococcus tauri]
------------------------------------------------------------
------------------------------------------------------------
------------------------MRAIGTTCAATARALRR----ASTS--ADVARADR-
--ARDRRPRPRDGDRRERHHRWTSSTAYGASTPPPRS-----------------------
-----------------------------------WDDGARRD-DGRAPPPTTFVDFGVY
KTRGAMKMKAVRPTLGALG---------------ENAV-VRRPGGVLLELANATA-----
--------PRTYDWQNKGSFMLSGTEAAELAD--RMAANGSCSFFHDSAKANGGGGGTLG
KAFKVEPMPDGSGGMFVNLTVTLSENRGQQRFSVPVSYGESAAIRQLLV--------YLV
PRVLGFDEVFK----------------------------------
>gi|145355417|ref|XP_001421958.1|	   152 residues, 50 /line  predicted protein [Ostreococcus lucimarinus CCE9901]
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------------------------FVDYGVY
KTKGALKLKAVRATFESDA---------------SGRRIMKRAGGVLLELANATA-----
--------PRQYDWGNKGSFMLSATEAAELAD--RMASNAPCSFFHDPGAGG-ANRGNVN
KAFKVEPMPDGSGGLFVNL--QTTSGGNKSFVSVPVSYGESAALRHILV--------YLV
PKIAGF---------------------------------------
>gi|124262628|ref|YP_001023098.1|	   421 residues, 50 /line  hypothetical protein Mpe_B0084 [Methylibium petroleiphilum PM1]
MCSNASKDSEASYNALMEPKHIDPAQLAAAVRALKIPTPNEKIINEILQVEGTMLVRALE
GAKRGSARESHYLRGVLLACHESTIQRLQRGRLAALSTRTMVAIGKAEGPDFAMRVREWD
EAGLPDGDNARYIRLTIARHLEAEAAAAEAPAQPPARGAAT----TAVV--MPNAMHY--
----------RPG---------RGAPAAAAPAPSPRGDAPHGDDRPAPPEFDEDIPGRAH
MGRDSGRREPAARQEQRTEH--RPEPQRQDQRHEQRQQARQAE-PAEASADQEYLSQHIY
GGKAALCF--------------------------SADQTRAKVHTVRLEAAEASA-----
--------TRQYDWQRKIAIQLSQRELPLVLA---V-----FMGWINRFEGK-GHGENNS
KWFTIEQQ----G-NKLYLSVNA---KGQSPRGVPIMPGDGYAVTTLLMRQMLKNDPFLT
PEIL------LSLVRK--QA--ELFNAPAQAPAARA-A-------
>gi|124484361|dbj|BAF46291.1|	   238 residues, 50 /line  transcription regulator Pbf-2 [Chlamydomonas reinhardtii]
-----------------MLLSRLAHSALPASL----------------------------
------------------------------------------------------------
--------------------RASAASSASSQLHAVP----R----VASA-----------
------------------------------------------------------------
--------APRAPSHVAQY----SNGSAAPVPPNF--AAPNDR-AATSSSDRVYTNYYVY
KTRAAMCLRLLPPTFAKAQ---------------AGKV-LERDGTMLLEFATANAAAPGA
GNGPAGNVNRTYNWGNKVTFALSPVELGNILAGDAVASDKGLVLWHDPAK-L-GKTGEPI
KKLSLKQLPDGNI-SF-------NLTAGPENFSVPVTKGEFEVIKSVAQ--------FAI
PRLLGFDAVFE----------------------------------
>gi|22330568|ref|NP_177282.2|	   238 residues, 50 /line  ATWHY2 (A. THALIANA WHIRLY 2); DNA binding [Arabidopsis thaliana]
--------------------MMKQARSLLSRS----------------------------
------------------------------------------------------------
--------------------------------LCDQSKS---------------------
------------------------------------------------------------
-------------LFEAS-TLRGFASWSNSSTPGR--GFPGKDA--AKPSGRLFAPYSIF
KGKAALSVEPVLPSFTEID---------------SGNLRIDRRGSLMMTFMPAIG-----
--------ERKYDWEKKQKFALSPTEVGSLIS---MGSKDSSEFFHDPSMKS-SNAGQVR
KSLSVKPHADGSG-YFISLSVNNSILKTNDYFVVPVTKAEFAVMKTAFS--------FAL
PHIMGWNRLTGHVNTEALPSRNVSHLKTEPQLELEWDK-------
>gi|92867067|gb|ABE77490.1|	   261 residues, 50 /line  ssDNA-binding transcriptional regulator [Medicago truncatula]
----------------MKMLQLQPPQSYTTTN----------------------------
------------------------------------------------------------
----------------------PFSVPTHSFIINTPKKSIF----LRRV-----------
------------------------------------------------------------
--------GPTFSLTCHHPELFHPKPFPPPQRPQS--SSSSFSSSVGELPARVHVSRSVY
KGKAVLVVSPVLPKFTSSD---------------SGTFKISKEGLMLLQFVPSAG-----
--------FRQYDWNRKQVFSLSVDEMGNLIN---LGARESCEIFHDPFMGR-SDEGKVR
KVLKVEPLHDGSG-HMFKLSVQNQLKNIDENIFIPVTKAEFAVFNSLFS--------FIM
PYLLGWNAFADSIKPE----VNIANPR-RREEDFEWNR-------
>gi|115466382|ref|NP_001056790.1|	   287 residues, 50 /line  Os06g0145800 [Oryza sativa (japonica cultivar-group)]
--------------------MPPP---------------SPPL-----------------
---------FLSLPSPPPP-----------------------------------------
-----------PLPHLL-----PSHRPAAALTLAPALSSRRVSSV---------------
---CPVA-SQRHSDYFDP---------RAPPPPPPRDG--YGGPAYSP------------
----------------------------------------PAA-QGGQQNGRVFSTYSIY
KGKAAMSLDPRPPQFVPLDVGRGGAAACELRDCESGAYKVVKEGFVLLQFAPAVA-----
--------TRQYDWTRKQVFSLSVWEMGSLLT---LGPTDSCEFFHDPFKGR-SDEGKVR
KVLKVEPTPDGNS-RFFNLSVQNRLLNIDENIYIPITKGEFAVIVSTFN--------YII
PHLMGWSTFTNSIKPE--DSRAYT--RPQSGPEYEWRR-------
>gi|125554053|gb|EAY99658.1|	   289 residues, 50 /line  hypothetical protein OsI_020891 [Oryza sativa (indica cultivar-group)]
--------------------MPPP---------------SPPL-----------------
---------FLSLPSPPPPP----------------------------------------
----------PPLPHLL-----PSHRTAAALTLAPALSSRRVSSV---------------
---CPVA-SQRHSDYFDP---------RAPPPPPPRDG--YGGPAYSP------------
----------------------------------------PAA-QGGQQNGRVFSTYSIY
KGKAAMSLDPRPPQFVPLDVGRGGAAACELRDCESGAYKVVKEGFVLLQFAPAVA-----
--------TRQYDWTRKQVFSLSVWEMGSLLT---LGPTDSCEFFHDPFKGR-SDEGKVR
KVLKVEPTPDGNS-RFFNLSVQNRLLNIDENIYIPITKGEFAVIVSTFN--------YII
PHLMGWSTFTNSIKPE--DSRAYT--RPQSGPEYEWRR-------
>gi|55296373|dbj|BAD68418.1|	   272 residues, 50 /line  putative DNA-binding protein p24 [Oryza sativa (japonica cultivar-group)]
--------------------MPPP---------------SPPL-----------------
---------FLSLPSPPPP-----------------------------------------
-----------PLPHLL-----PSHRPAAALTLAPALSSRRVSSV---------------
---CPVA-SQRHSDYFDP---------RAPPPPPPRDG--YGGPAYSP------------
----------------------------------------PAA-QGGQQNGRVFSTYSIY
KGKAAMSLDPRPPQFVPLD---------------SGAYKVVKEGFVLLQFAPAVA-----
--------TRQYDWTRKQVFSLSVWEMGSLLT---LGPTDSCEFFHDPFKGR-SDEGKVR
KVLKVEPTPDGNS-RFFNLSVQNRLLNIDENIYIPITKGEFAVIVSTFN--------YII
PHLMGWSTFTNSIKPE--DSRAYT--RPQSGPEYEWRR-------
>gi|119638471|gb|ABL85062.1|	   266 residues, 50 /line  expressed protein [Brachypodium sylvaticum]
--------------------MP------------------PPL-----------------
---------SLSLPSPPPL-----------------------------------------
-------------LSLL-----LPHHAKAFQSLTLAPP-RTLASVA--------------
---CSVV-PARHSDYFDP---------RARTPP-PRDE--YGEPPPPP------------
----------------------------------------LAP-AQGGQSGRVFASYSIY
KGKAALSFDPRPPQFVPLD---------------SGAYKVAKEGFVLLQFAPAVA-----
--------ARQYDWTRKQVFSLSVWEMGTLLT---LGPTDSCEFFHDPFKGR-SDEGKVR
KVLKVEPTPDGNG-RFFNLSVQNRLLNIDESVYIPITKGEYAVIVSTFN--------YII
PHIMGWSTFTNSIKLE--ESQPYS--RPQSSPELEWRR-------
>gi|15223748|ref|NP_172893.1|	   263 residues, 50 /line  ATWHY1/PTAC1 (A. THALIANA WHIRLY 1, PLASTID TRANSCRIPTIONALLY ACTIVE1); DNA binding [Arabidopsis thaliana]
----------------MSQLLSTP------------------------------------
----------------LMAV----------------------------------------
----------NSNPRFL-----SSSSVL------------VTGGFAVKRHGFALKPTTKT
VK-LFSV-KSRQTDYFEK---------QR-----------FGDSSSSP------------
----------------------------------------SPA---EGLPARFYVGHSIY
KGKAALTVDPRAPEFVALD---------------SGAFKLSKDGFLLLQFAPSAG-----
--------VRQYDWSKKQVFSLSVTEIGTLVS---LGPRESCEFFHDPFKGK-SDEGKVR
KVLKVEPLPDGSG-HFFNLSVQNKLVNVDESIYIPITRAEFAVLISAFN--------FVL
PYLIGWHAFANSIKPE--ETSRVNNASPNYGGDYEWNR-------
>gi|21730639|pdb|1L3A|C	   182 residues, 50 /line  Chain C, Structure Of The Plant Transcriptional Regulator Pbf-2
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------------------------------------------------TPKVFVGYSIY
KGKAALTVEPRSPEFSPLD---------------SGAFKLSREGMVMLQFAPAAG-----
--------VRQYDWSRKQVFSLSVTEIGSIIS---LGTKDSCEFFHDPNKGR-SDEGRVR
KVLKVEPLPDGSG-HFFNLSVQNKLINLDENIYIPVTKAEFAVLVSAFN--------FVM
PYLLGWHTAVNSFKPE-------------SGAELEWNLEHHHHHH
>gi|9651810|gb|AAF91282.1|AF233342_1	   274 residues, 50 /line  DNA-binding protein p24 [Solanum tuberosum]
----------------MSNFSLSP---------------SPTS-----------------
---------GFSLNLQNPTK----------------------------------------
----------TSYLSFS-----SSINTI-----FAPLSSNTTKSFSGL-------THKAA
LPRNLSL-TCRHSDYFEP---------QQ-----------QQQQQQQQ------------
----------------------------------------P-Q---GASTPKVFVGYSIY
KGKAALTVEPRSPEFSPLD---------------SGAFKLSREGMVMLQFAPAAG-----
--------VRQYDWSRKQVFSLSVTEIGSIIS---LGAKDSCEFFHDPNKGR-SDEGRVR
KVLKVEPLPDGSG-HFFNLSVQNKLINLDENIYIPVTKAEFAVLVSAFN--------FVM
PYLLGWHTAVNSFKPE--DASRSNNANPRSGAELEWNR-------
>gi|21730640|pdb|1L3A|D	   171 residues, 50 /line  Chain D, Structure Of The Plant Transcriptional Regulator Pbf-2
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------------------------------------------------TPKVFVGYSIY
KGKAALTVEPRSPEFSPLD---------------SGAFKLSREGMVMLQFAPAAG-----
--------VRQYDWSRKQVFSLSVTEIGSIIS---LGTKDSCEFFHDPNKGR-SDEGRVR
KVLKVEPLPDGSG-HFFNLSVQNKLINLDENIYIPVTKAEFAVLVSAFN--------FVM
PYLLGWHTAVNSFKPE--------------GAELE----------
>gi|145328252|ref|NP_001077872.1|	   267 residues, 50 /line  ATWHY3/PTAC11 (A. THALIANA WHIRLY 3) [Arabidopsis thaliana]
----------------MSQL----------------------------------------
------------LSSPPMAV----------------------------------------
------------FSKTF-----INHKFSDARFLSSHSI-LTSGGFAGKI--IPLKPTAR-
--LKLTV-KSRQSDYFEK---------QR-----------FGDSSSSQ------------
----------------------------------------NA----EVSSPRFYVGHSIY
KGKAALTIEPRAPEFVALE---------------SGAFKLTKEGFLLLQFAPAAG-----
--------VRQYDWSRKQVFSLSVTEIGNLVS---LGPRESCEFFHDPFKGK-GDEGKVR
KVLKVEPLPDGSG-RFFNLSVQNKLLNVDESVYIPITKAEFAVLISAFN--------FVL
PHLIGWSAFANSIKPE--DSNRLNNASPKYGGDYEWSR-------
>gi|2947067|gb|AAC05348.1|	   192 residues, 50 /line  hypothetical protein [Arabidopsis thaliana]
----------------MSQL----------------------------------------
------------LSSPPMAV----------------------------------------
------------FSKTF-----INHKFSDARFLSSHSI-LTSGGFAGKI--IPLKPTAR-
--LKLTV-KSRQSDYFEK---------QR-----------FGDSSSSQ------------
----------------------------------------NA----EVSSPRFYVGHSIY
KGKAALTIEPRAPEFVALE---------------IVMMKINWFG----------------
------------------------------------------------------------
------------E-RYYDCGVQNKLLNVDESVYIPITKAEFAVLISAFN--------AGV
-HLLTPSN-QKTLTAL--TMLRLSMEETTNGVDDG--D-------

Ad blocker interference detected!


Wikia is a free-to-use site that makes money from advertising. We have a modified experience for viewers using ad blockers

Wikia is not accessible if you’ve made further modifications. Remove the custom ad blocker rule(s) and the page will load as expected.